Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/gamma

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
gamma
Image logo représentative de la faculté
Annexe 1
Recherche : Les clusters de gènes tRNA et rRNA chez les procaryotes
Précédent :Sommaire
Suivant :alpha
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Annexe : gamma
Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/gamma
 », n'a pu être restituée correctement ci-dessus.



Shewanella[modifier | modifier le wikicode]

spl opérons[modifier | modifier le wikicode]

S1. Shewanella pealeana
39.1%GC 30.6.19 Paris  147  doubles interca
45136..46685 16s @1 339
47025..49946 23s 112
50059..50174 5s
51490..53039 16s 339
53379..56298 23s 114
56413..56528 5s
182271..183820 16s @2 71
183892..183968 atc 65
184034..184109 gca 364
184474..187395 23s 112
187508..187623 5s 100
187724..187800 gac
191614..191689 aca 8
191698..191782 tac 35
191818..191891 gga
235182..236731 16s 374
237106..240025 23s 114
240140..240255 5s
243631..245180 16s 338
245519..248440 23s 113
248554..248669 5s 68
248738..248813 acc 17
248831..248946 5s
416766..416842 cgg 39
416882..416957 cac 41
416999..417075 cca + 58
417134..417210 cca 2 cca
493711..495260 16s 339
495600..498519 23s 114
498634..498749 5s
641376..641466 tca @3 1172
642639..642729 tca
645847..647396 16s 71
647468..647544 atc 65
647610..647685 gca 329
648015..650937 23s 156
651094..651209 5s
728115..728199 ttg
comp 1168942..1169018 atgi
comp 1339706..1339781 aca + 52
comp 1339834..1339909 ttc 2 ttc 539
comp 1340449..1340524 aca 2 aca 52
comp 1340577..1340652 ttc
comp 1342467..1342542 aca 52
comp 1342595..1342670 ttc
1456724..1456815 21
1456837..1456913 cgt + 30
1456944..1457020 cgt 7 cgt 32
1457053..1457129 cgt 3 agc 30
1457160..1457236 cgt 33
1457270..1457346 cgt 9
1457356..1457447 agc 76
1457524..1457600 cgt 35
1457636..1457712 cgt 9
1457722..1457813 agc
comp 1627363..1627438 agg
comp 1770483..1770558 gta + 37
comp 1770596..1770671 gta 11 gta 37
comp 1770709..1770784 gta 37
comp 1770822..1770897 gta 37
comp 1770935..1771010 gta 37
comp 1771048..1771123 gta 37
comp 1771161..1771236 gta 37
comp 1771274..1771349 gta 37
comp 1771387..1771462 gta 37
comp 1771500..1771575 gta 39
comp 1771615..1771690 gta
1773910..1773985 gcc + 80
1774066..1774141 gaa 13 gaa 102
1774244..1774319 gaa 2 gcc 102
1774422..1774497 gaa 102
1774600..1774675 gaa 102
1774778..1774853 gaa 102
1774956..1775031 gaa 102
1775134..1775209 gaa 102
1775312..1775387 gaa 253
1775641..1775716 gaa 102
1775819..1775894 gaa 102
1775997..1776072 gaa 102
1776175..1776250 gaa 102
1776353..1776428 gaa 47
1776476..1776551 gcc
2081297..2082846 16s 338
2083185..2086104 23s 114
2086219..2086334 5s
comp 2143274..2143350 ccc
comp 2366164..2366240 atgf + 40
comp 2366281..2366357 atgf 4 atgf 40
comp 2366398..2366474 atgf 40
comp 2366515..2366591 atgf
2376218..2376308 tca
2379767..2379842 ggc 13
2379856..2379929 tgc 85
2380015..2380100 tta
2550857..2550932 ggc 13
2550946..2551019 tgc + 95
2551115..2551200 tta 3 tgc 634
2551835..2551908 tgc 3 tta 95
2552004..2552089 tta 479
2552569..2552642 tgc 132
2552775..2552860 tta
2558019..2558109 tca
comp 2717566..2717655 tcc
comp 2759730..2759806 atgf + 189
comp 2759996..2760072 atgf 4 atgf 45
comp 2760118..2760194 gtc 2 gtc 2
comp 2760197..2760273 atgf 35
comp 2760309..2760385 gtc 13
comp 2760399..2760475 atgf
2858823..2858907 tac + 30
2858938..2859022 tac 5 tac 85
2859108..2859192 tac 107
2859300..2859384 tac 107
2859492..2859576 tac
2866268..2866343 aac + 45
2866389..2866464 aac 7aac 41
2866506..2866581 aac 26
2866608..2866683 aac 32
2866716..2866791 aac 33
2866825..2866900 aac 40
2866941..2867016 aac
comp 2929429..2929505 gac + 97
comp 2929603..2929679 gac 4 gac 97
comp 2929777..2929853 gac 83
comp 2929937..2930013 gac
comp 3120289..3120364 aaa + 58
comp 3120423..3120498 aaa 12 aaa 58
comp 3120557..3120632 aaa 58
comp 3120691..3120766 aaa 59
comp 3120826..3120901 aaa 57
comp 3120959..3121034 aaa 58
comp 3121093..3121168 aaa 58
comp 3121227..3121302 aaa 59
comp 3121362..3121437 aaa 58
comp 3121496..3121571 aaa 59
comp 3121631..3121706 aaa 59
comp 3121766..3121841 aaa
comp 3269860..3269935 cac 8
comp 3269944..3270020 aga 63
comp 3270084..3270160 cca
comp 3757983..3758059 atgf
comp 3758163..3758249 ctc
comp 3835257..3835331 caa + 51
comp 3835383..3835467 cta 5 caa 131
comp 3835599..3835673 caa 5 cta 20
comp 3835694..3835778 cta 3 atg 96
comp 3835875..3835949 caa 49
comp 3835999..3836083 cta 211
comp 3836295..3836371 atg 5
comp 3836377..3836451 caa 47
comp 3836499..3836583 cta 55
comp 3836639..3836715 atg 5
comp 3836721..3836795 caa 47
comp 3836843..3836927 cta 55
comp 3836983..3837059 atg
comp 3862885..3862961 tgg + 167
comp 3863129..3863205 tgg 2 tgg
comp 3867049..3867164 5s 114
comp 3867279..3870198 23s 338
comp 3870537..3872086 16s
3882154..3882229 ttc
comp 4331488..4331563 ggc + 130
comp 4331694..4331769 ggc 6 ggc 47
comp 4331817..4331892 ggc 162
comp 4332055..4332130 ggc 16
comp 4332147..4332222 ggc 48
comp 4332271..4332346 ggc
comp 4616881..4616996 5s 112
comp 4617109..4620030 23s 364
comp 4620395..4620470 gca 65
comp 4620536..4620612 atc 71
comp 4620684..4622233 16s
comp 5129770..5129846 gac 100
comp 5129947..5130062 5s 115
comp 5130178..5133097 23s 339
comp 5133437..5134986 16s

spl cumuls[modifier | modifier le wikicode]

  • Lien tableur: spl cumuls
  • Note:
    - Moyenne et variance pour les intercalaires entre aas sans rRNAs inférieurs à 81, respectivement 39 et 14.
cumuls. Shewanella pealeana
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 11 1 0 1 1 100
16 23 5s 0 6 20 12 50 20 200
16 atc gca 3 40 27 100 40 300
16 23 5s a 2 60 28 150 60 400
max a 3 80 3 200 80 500
a doubles 0 100 8 250 100 600
spéciaux 0 120 13 300 120 700
total aas 9 140 3 350 140 800
sans opérons 29 160 0 400 160 900
1 aa 8 180 2 450 180 1000
max a 15 200 1 500 200 1100
a doubles 15 6
total aas 133 103 0 0 0 0
total aas 142
remarques 3
avec jaune moyenne 88
variance 143
sans jaune moyenne 58
variance 35

spl blocs[modifier | modifier le wikicode]

S1. Shewanella pealeana, blocs à rRNA.
16s 339 339 374 339 338 338
23s 112 114 114 114 114 114
5s
16s 71 71 71 16s 338 16s 339
atc 65 65 65 23s 113 23s 115
gca 364 329 364 5s 68 5s 100
23s 112 156 112 acc 17 gac
5s 100 5s
gac

spl remarques[modifier | modifier le wikicode]

  • Remarques :
    1. @1   8 blocs 16-23-5s. Ils ont tous les mêmes intercalaires, 338 113 68.
        - 6 blocs sont solo avec un dont l'intercalaire 16s-23s fait 11% de plus que le reste, 36/338.
        - 2 blocs avec 1 aa dont un possède en plus un 5s, gac et acc-5s.
    2. @2   Les 2 blocs 16-atc-gca ont les mêmes intercalaires, 71 65 364 112. L’intercalaire 23s-5s est le même que les 6 autres blocs.
        - Les 2 blocs n'ont que 5 aas, soit pour les 8 opérons à rRNA 7 aas au total. Ce qui est quasiment nul.
    3. @3   Les intercalaires élevés ne touchent que 3 opérons sans rRNAs
				
	-		anciens	-		nouveaux	-
	intercalires	n aas	doubles		nv doubles	nv opérons
	1172		2	2			0	2
	539		4	2,2			0	2
	634, 479	6	3,3			0	3
					
	résultats	ancien 	nouveau		
	total opérons	29	33		
	1 aa		8	10		
	max aa		15	15		
	doubles		15	12		
  • Séquences des doubles : Les intercalaires excessives ne changent pas fondamentalement le spectre des doubles et leurs séquences. Ainsi les répétitions suivantes sont caractéristiques de ce génome.
    - opéron à 13 gaa avec 11 intercalalires identiques de 102 bases, soit 11 répétitions d’une séquence de 180 bases environ, longueur de gaa+102.
    - Les répétitions de séquences sont nombreuses. La plus longue est celle de l’opéron à 5 cta 5 caa 3 atg. Ce sont 5 séquences caa-cta avec un intercalaire de 50 interrompues par 2 atg et 2 intercalaires de 100 bases environ.
    - Les 2 autres opérons à séquences répétées sont, 4atgf 2gtc (2*(2atgf-gtc)) et 6 ggc (avec 2 ggc-ggc séparées par des intercalaires longs).
    - Répétitions du même codon avec son intercalaire comme pour le cas de l'opéron à 15 codons,
				
	codon	répétition	intercalaire		
	gaa	13		102		
	gta	11		37		
	tac	5		100		
	aac	7		35		
	gac	4		97		
	aaa	12		58		
	atgf	4		40		

Vibrio parahaemolyticus[modifier | modifier le wikicode]

vpb opérons[modifier | modifier le wikicode]

  • Liens: gtRNAdb [3], NCBI chr1 [4], NCBI chr2 [5], génome []
  • Lien tableur: vpb opérons
  • Légende:
    - cds1 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF
    - cds2 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF
    - cds3 180 MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS
vpb1. Vibrio parahaemolyticus BB22OP
45.3%GC 6.7.19 Paris  126  doubles interca
chr1
33614..35175 16s @4 80
35256..35331 gaa 2
35334..35409 aaa 30
35440..35515 gta 55
comp 35571..35768 cds1 59
35828..38743 23s 73
38817..38932 5s
49997..50073 cgg 32
50106..50181 cac + 72
50254..50330 cca 2 cac 49
50380..50455 cac 2 cca 24
50480..50556 cca
comp 400045..400120 atgi
577971..579532 16s 88
579621..579696 gcc 12
579709..579784 gaa 258
580043..582958 23s 73
583032..583147 5s 30
583178..583254 gac 35
583290..583366 tgg
comp 769649..769733 cta + 29
comp 769763..769847 cta 10 cta 47
comp 769895..769971 atg 4 atg 24
comp 769996..770080 cta 5 caa 52
comp 770133..770207 caa 29
comp 770237..770321 cta 53
comp 770375..770451 atg 24
comp 770476..770560 cta 52
comp 770613..770687 caa 29
comp 770717..770801 cta 54
comp 770856..770930 caa 29
comp 770960..771044 cta 35
comp 771080..771154 caa 48
comp 771203..771287 cta 31
comp 771319..771403 cta 77
comp 771481..771557 atg 77
comp 771635..771709 caa 31
comp 771741..771825 cta 40
comp 771866..771942 atg
786939..787015 cca
comp 802315..802391 agg
910219..910295 aga
comp 982089..982173 tac + 81
comp 982255..982339 tac 4 tac 81
comp 982421..982505 tac 81
comp 982587..982671 tac
1124715..1124802 tcc
1418321..1418397 gtc + 32
1418430..1418506 gtc 2gtc
comp 1988127..1988202 ggc + 10
comp 1988213..1988299 tta 2 ggc 76
comp 1988376..1988451 ggc 20
comp 1988472..1988545 tgc
2164082..2164157 aac
2193593..2193683 tca
comp 2547884..2547960 atgf 56
comp 2548017..2548100 ctc
2652092..2652168 cgt + 56
comp 2652225..2652301 cgt 9 cgt 57
comp 2652359..2652435 cgt 2 agc 57
comp 2652493..2652569 cgt 57
comp 2652627..2652703 cgt 57
comp 2652761..2652837 cgt 56
comp 2652894..2652970 cgt 210
comp 2653181..2653257 cgt 31
comp 2653289..2653380 agc @5 320
comp 2653701..2653777 cgt 31
comp 2653809..2653900 agc
2735697..2735772 ttc + 64
2735837..2735912 aca 3 ttc 7
2735920..2735995 ttc 2 aca 70
2736066..2736141 aac 2 aac 71
2736213..2736288 aca 7
2736296..2736371 ttc 43
2736415..2736490 aac
2738623..2738698 ttc 51
2738750..2738825 aca + 21
2738847..2738922 aac 2 aca 39
2738962..2739037 aca 2 aac 15
2739053..2739128 aac
comp 2741263..2741339 gac 31
comp 2741371..2741487 5s 57
comp 2741545..2741620 acc 100
comp 2741721..2741836 5s 73
comp 2741910..2744825 23s 257
comp 2745083..2745158 gca 41
comp 2745200..2745276 atc 56
comp 2745333..2746894 16s
comp 2755928..2756012 ttg
comp 2847646..2847722 tgg 68
comp 2847791..2847867 gac 30
comp 2847898..2848013 5s 73
comp 2848087..2851002 23s 258
comp 2851261..2851336 gaa 80
comp 2851417..2852978 16s
comp 2987485..2987561 atgf + 56
comp 2987618..2987693 ggc 5 atgf 18
comp 2987712..2987788 atgf 8 ggc 35
comp 2987824..2987899 ggc 50
comp 2987950..2988025 ggc 49
comp 2988075..2988150 ggc 49
comp 2988200..2988275 ggc 30
comp 2988306..2988382 atgf 55
comp 2988438..2988513 ggc 30
comp 2988544..2988620 atgf 39
comp 2988660..2988735 ggc 19
comp 2988755..2988831 atgf 35
comp 2988867..2988942 ggc
comp 3060924..3061000 tgg 68
comp 3061069..3061145 gac 30
comp 3061176..3061291 5s 73
comp 3061365..3064280 23s 257
comp 3064538..3064613 gta 14
comp 3064628..3064703 gca 32
comp 3064736..3064811 aaa 2
comp 3064814..3064889 gaa 80
comp 3064970..3066531 16s @3 319
comp 3066851..3066966 5s 73
comp 3067040..3069955 23s 261
comp 3070217..3071778 16s
comp 3105094..3105169 acc 13
comp 3105183..3105257 gga 35
comp 3105293..3105377 tac 36
comp 3105414..3105489 aca
comp 3111073..3111149 gac 30
comp 3111180..3111295 5s 73
comp 3111369..3114284 23s 261
comp 3114546..3116107 16s @1 317
comp 3116425..3116540 5s 73
comp 3116614..3119529 23s 261
comp 3119791..3121352 16s
comp 3175944..3176034 tca 69
comp 3176104..3176219 5s 73
comp 3176293..3179211 23s 257
comp 3179469..3179544 gca 41
comp 3179586..3179662 atc 56
comp 3179719..3181280 16s @2
comp 3217187..3217263 gac 30
comp 3217294..3217409 5s 73
comp 3217483..3220398 23s 59
3220458..3220655 cds2 55
comp 3220711..3220786 gta 30
comp 3220817..3220892 aaa 2
comp 3220895..3220970 gaa 80
comp 3221051..3222612 16s
chr2
132908..134469 16s 80
134550..134625 gaa 2
134628..134703 aaa 16
134720..134795 gca 14
134810..134885 gta 54
comp 134940..135122 cds3 19
135142..138059 23s 73
138133..138248 5s 69
138318..138408 tca
comp 192886..192969 ctc
comp 591931..592021 tca
comp 1009457..1009530 tgc 73
comp 1009604..1009690 tta
comp 1021568..1021641 tgc 73
comp 1021715..1021801 tta
comp 1029973..1030048 ggc 3
comp 1030052..1030125 tgc
1125193..1125267 gga

vpb cumuls[modifier | modifier le wikicode]

cumuls. Vibrio parahaemolyticus BB22OP
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 9 1 0 0 1 1 100
16 23 5s 0 0 20 9 8 50 20 200
16 atc gca 2 40 24 4 100 40 300
16 23 5s a 1 60 21 2 150 60 400
max a 6 80 9 2 200 80 500
a doubles 0 100 3 0 250 100 600
spéciaux 6 120 0 0 300 120 700
total aas 33 140 0 0 350 140 800
sans opérons 25 160 0 0 400 160 900
1 aa 11 180 0 0 450 180 1000
max a 19 200 0 0 500 200 1100
a doubles 8 1 0
total aas 93 67 16 0 0 0
total aas 126
remarques 5
avec jaune moyenne 46 26
variance 29 22
sans jaune moyenne 43
variance 17

vpb blocs[modifier | modifier le wikicode]

vpb1. Vibrio parahaemolyticus BB22OP, blocs à rRNA.
16s 80 16s 80 16s 80
gaa 2 gaa 2 gaa 2
aaa 30 aaa 30 aaa 16
gta 55 gta 55 gca 14
cds 198 59 cds 198 59 gta 54
23s 73 23s 73 cds 180 19
5s 5s 30 23s 73
gac 5s 69
tca
16s 56 16s 56 16s 88 16s 80
atc 41 atc 41 gcc 12 gaa 258
gca 257 gca 257 gaa 258 23s 73
23s 73 23s 73 23s 73 5s 30
5s 100 5s 69 5s 30 gac
acc 57 tca gac
5s 31
gac
16s 261 16s 261
23s 73 23s 73
5s 319 5s 317
16s 80 16s 261
gaa 2 23s 73
aaa 32 5s 30
gca 14 gac
gta 257
23s 73
5s 30
gac

vpb remarques[modifier | modifier le wikicode]

  • Remarques : 2 chromosomes circulaires. EFTU et beaucoup de doubles.
    1. @1 Blocs 16-23-5s, il y en a 3 dont 2 sont sur un opéron avec 1 aa. Le 4ème appartient à un opéron spécial.
        - Les 3 ont les mêmes Intercalaires, 73 261. L’intercalaire 23-5s se retrouve dans tout les autres opérons.
        - Les 2 blocs accolés sont séparés du reste par de grands intercalaires, 320 bases.
    2. @2 Les opérons 16-atc-gca sont au nombre de 2 avec 3 aas en plus.
        - 4 de leurs intercalaires, 73 257 41 56, sont identiques et le 5ème est du même ordre de grandeur, 100 69.
        - Un opéron est clasisque et a un aa en plus, le 2ème a la séquence 5s-aa-5s-aa donc 2 aa en +.
    3. @3 Les opérons analogues aux 16-atc-gca sont au nombre de 3 et ont 2 intercalaires en commun avec eux, 257 73 correspondant à aa-23s-5s.
        - Un opéron 16-gcc-gaa-23s-5s avec 2 aas entre les 2 rRNAs. Il a 4 aas.
        - Un opéron 16-gaa-23s-5s avec 1 aa entre les 2 rRNAs. Il a 3 aas.
        - Un opéron 16-gaa-3aas-23s-5s avec 4 aas entre les 2 rRNAs. Il a 6 aas.
    4. @4 Les opérons analogues aux 16-atc-gca avec une protéine sont au nombre de 3 et ont l’intercalaire 73 du 23s-5s comme tous les autres opérons.
      - Différence importante avec lam qui a des opérons analogues, la protéine est dans le brin complémentaire du brin des RNAs. Alors que dans lam protéine et RNAs sont sur le même brin.
      - La séquence est 16s-gaa-aaa-xxx-gta-protéine-23s-5s et les 3 opérons ont en commun les 4 mêmes intercalaires, 16s-80-aaa-2-xxx-gta-55-protéine-23s-73-5s.
      - Deux opérons, sans xxx, sont identiques en aas, intercalaires et protéines mais un a un aa en plus après 5s. Ils ont respectivement 3 et 4 aas.
      - Un opéron a une protéine plus petite, 180 aas au lieu de 198, avec xxx=gca entre les rRNAs plus 1 au-delà du 5s, soit 5 aas au total.
    5. @5 L’opéron 9cgt 2agc a une intercalaire élevée, 320 bases.
  • Séquences des doubles : beaucoup de doubles et de séquences répétées comme cbn.
      - 8 opérons sur 14 à 2aas et plus sont remarquables :
	opéron			n*séquence
	cgg+4			2*2
	10 cta 5caa 4atg	3*4
	4 tac			4*1
	2 gtc			2*1
	9 cgt 2agc		8*1
	ttc+6			2*3
	ttc+4			2*2
	8 ggc 5atgf		5*2

Escherichia albertii[modifier | modifier le wikicode]

eal opérons[modifier | modifier le wikicode]

eal1. Escherichia albertii
49.6%GC 10.3.19 Paris  89  doubles interca
219063..219144 tac + 212
219357..219438 tac 2 tac
413135..413219 tcc
462888..462972 tca
comp 489120..489191 gga 6
comp 489198..489270 aca
615149..615233 tcc
comp 756823..756895 aaa + 5
comp 756901..756973 gta 3 aaa 48
comp 757022..757094 aaa 2 gta 5
comp 757100..757172 gta 48
comp 757221..757293 aaa
834529..834602 atg + 10
834613..834694 cta 2atg 26
834721..834792 caa 2caa 37
834830..834901 caa 2 cag 18
834920..834993 atg 51
835045..835116 cag 35
835152..835223 cag
comp 968958..969031 aga
comp 1192416..1192488 acg
comp 1269526..1269599 gac
comp 1277040..1277113 gac 52
comp 1277166..1277285 5s @1 169
comp 1277455..1280377 23s 186
comp 1280564..1280636 gca 45
comp 1280682..1280755 atc 70
comp 1280826..1282367 16s
1567231..1567314 ctg + 31
1567346..1567429 ctg 3 ctg 35
1567465..1567548 ctg
comp 1657309..1657390 ttg
comp 1765401..1765473 ggc + 159
comp 1765633..1765705 ggc 2 ggc
1795516..1795588 ttc
comp 2006002..2006121 5s 169
comp 2006291..2009214 23s 186
comp 2009401..2009473 gca 45
comp 2009519..2009592 atc 70
comp 2009663..2011202 16s
comp 2042057..2043241 tuf1 CDS 1185pb 117
comp 2043359..2043431 acc 9
comp 2043441..2043512 gga 119
comp 2043632..2043713 tac 11
comp 2043725..2043797 aca @3
comp 2047429..2047548 5s 169
comp 2047718..2050648 23s 186
comp 2050835..2050907 gca 45
comp 2050953..2051026 atc 68
comp 2051095..2052636 16s
comp 2208305..2208424 5s @2 169
comp 2208594..2211517 23s 198
comp 2211716..2211788 gaa 85
comp 2211874..2213418 16s
comp 2267554..2267627 cca 43
comp 2267671..2267754 ctg 23
comp 2267778..2267850 cac 61
comp 2267912..2267985 cgg
comp 2305358..2305430 tgg 11
comp 2305442..2305515 gac 52
comp 2305568..2305687 5s 169
comp 2305857..2308779 23s 198
comp 2308978..2309050 gaa 85
comp 2309136..2310676 16s
comp 2426158..2426248 tga
2556305..2556378 ccg
2810766..2812307 16s 85
2812393..2812465 gaa 198
2812664..2815586 23s 169
2815756..2815875 5s 151
2816027..2816099 acc 40
2816140..2816259 5s
2911129..2911212 ctc
2913088..2913161 atgf
comp 3010332..3010404 atgi
comp 3177717..3177789 ttc
3301617..3301687 ggg
comp 3366868..3366941 atgf + 37
comp 3366979..3367052 atgf 3 atgf 37
comp 3367090..3367163 atgf
3469914..3470003 agc 6
3470010..3470083 cgt + 201
3470285..3470358 cgt 3 cgt 200
3470559..3470632 cgt
3505321..3505393 atgi
3563056..3564598 16s 85
3564684..3564756 gaa 198
3564955..3567876 23s 169
3568046..3568165 5s
comp 3779750..3779822 aaa 7
comp 3779830..3779902 gta + 47
comp 3779950..3780022 gta 2 gta
3782718..3782790 gcc + 42
3782833..3782905 gcc 2 gcc
comp 3810369..3810440 agg
comp 3993500..3993573 ccc
comp 4232176..4232248 aac
4233996..4234068 aac
comp 4242952..4243024 aac
comp 4248342..4248414 aac
4249406..4249492 tcg
4256696..4256768 atgi 100
4256869..4256942 aga
4317980..4318052 ggc 56
4318109..4318179 tgc 14
4318194..4318277 tta
comp 4556753..4556826 gtc + 7
comp 4556834..4556907 gtc 2 gtc

eal cumuls[modifier | modifier le wikicode]

cumuls. Escherichia albertii
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 7 1 0 - 1 1 100
16 23 5s 0 0 20 11 50 20 200
16 atc gca 3 40 8 100 40 300
16 23 5s a 0 60 7 150 60 400
max a 3 80 1 200 80 500
a doubles 0 100 1 250 100 600
spéciaux 4 120 1 300 120 700
total aas 13 140 0 350 140 800
sans opérons 38 160 1 400 160 900
1 aa 23 180 0 450 180 1000
max a 7 200 1 500 200 1100
a doubles 10 2
total aas 72 33 0 0 0 0
total aas 85
remarques 3
avec jaune moyenne 53
variance 59
sans jaune moyenne
variance

eal blocs[modifier | modifier le wikicode]

eal1. Escherichia albertii, blocs à rRNA.
16s 70 70 68
atc 45 45 45
gca 186 186 186
23s 169 169 169
5s 52
gac
16s 85 85 85
gaa 198 198 198
23s 169 169 169
5s 52
gac
16s 85
gaa 198
23s 169
5s 151
acc 40
5s

eal remarques[modifier | modifier le wikicode]

  • Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles.
  1. @1 Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.
    - Les intercalaires sont les mêmes pour les 3 opérons, 70 45 186 169.
    - Un seul opéron a un aa en plus.
  2. @2 4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s.
    - Les intercalaires sont les mêmes pour les 4 opérons, 85 198 169.
    - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.
    - Les aas suplémentaires sont absents pour 2 opérons et sont 2 pour un autre.
    - Le 4ème opéron a 1 aa et 1 5s en supplément.
  3. @3 2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB
  • Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.
    - 5 opérons à 2 aas répétés
    - 3 opérons à 3 aas répétés
    - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.
    - Un opéron à 5 aas a une séquence répétée, aaa + 2*2.
    - 5 opérons sans répétitions
		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca
  • Notes :

Escherichia coli[modifier | modifier le wikicode]

eco opérons[modifier | modifier le wikicode]

eco1. Escherichia coli str. K-12 substr. MG1655
50.6%GC 10.3.19 Paris  89  doubles interca EcoCyc adIP
223771..225312 16s 68 opéron
225381..225457 atc 42 ileV [10]
225500..225575 gca 183 « 
225759..228662 23s 93 « 
228756..228875 5s @1 52 « 
228928..229004 gac aspU [11]
236931..237007 gac
262871..262946 acg
564723..564799 aga
comp 696430..696504 cag + 37 opéron
comp 696542..696616 cag 2 cag 47 glnT [12]
comp 696664..696740 atg 2 atg 15 « 
comp 696756..696830 caa 2 caa 34 « 
comp 696865..696939 caa 23 « 
comp 696963..697047 cta 9 « 
comp 697057..697133 atg
780554..780629 aaa + 135 lysT [13]
780765..780840 gta 5 aaa 2 opéron
780843..780918 aaa 2 gta 149 « 
781068..781143 gta 3 valZ [14]
781147..781222 aaa 146 opéron
781369..781444 aaa 132 lysZ [15]
781577..781652 aaa lysQ [16]
EcoCyc [17]
comp 925884..925971 tcc InfA-serW [18]
comp 1031625..1031712 tca
comp 1097565..1097652 tcc
comp 1287087..1287176 tpr cds 90pb 67 tpr
comp 1287244..1287328 tac + 209 opéron
comp 1287538..1287622 tac 2 tac tyrT [19]
1746435..1746511 gtc + 4 valV [20]
1746516..1746592 gtc 2 gtc opéron
«RNA 67pb
comp 1991815..1991901 tta 12 leuZ [21]
comp 1991914..1991987 tgc 54 « 
comp 1992042..1992117 ggc opéron
comp 2043468..2043557 tcg
2044549..2044624 aac
comp 2058027..2058102 aac
2059851..2059926 aac
2062260..2062335 aac
2286211..2286287 ccc
2466309..2466383 agg
comp 2518041..2518116 gcc + 39 alaX [22]
comp 2518156..2518231 gcc 2 gcc opéron
2520931..2521006 gta + 44 valU [23]
2521051..2521126 gta 3gta 46 opéron
2521173..2521248 gta 4 « 
2521253..2521328 aaa « 
comp 2726069..2726188 5s @2 92 opéron
comp 2726281..2729184 23s 184
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s
comp 2785762..2785837 atgi
comp 2817784..2817860 cgt + 198 « 
comp 2818059..2818135 cgt 4 cgt 62 « 
comp 2818198..2818274 cgt 198 « 
comp 2818473..2818549 cgt 3 opéron
comp 2818553..2818645 agc serV [24]
2947387..2947463 atgf + 33 opéron
2947497..2947573 atgf 3 atgf 33 metW [25]
2947607..2947683 atgf « 
comp 2998984..2999057 ggg
3110366..3110441 ttc
3215598..3215673 atgi
comp 3318213..3318289 atgf
comp 3322072..3322158 ctc
comp 3423423..3423542 5s 37 « 
comp 3423580..3423655 acc 12 « 
comp 3423668..3423787 5s 92 « 
comp 3423880..3426783 23s 174 « 
comp 3426958..3427033 gca 42 « 
comp 3427076..3427152 atc 68 ileU [26]
comp 3427221..3428762 16s opéron
comp 3708616..3708692 ccg
3836222..3836316 tga
ecoliwiki [27]
3941808..3943349 16s 85 gltU [28]
3943435..3943510 gaa 193 opéron
3943704..3946607 23s 92 « 
3946700..3946819 5s 52 « 
3946872..3946948 gac 8 aspT [29]
3946957..3947032 tgg trpT [30]
3982375..3982451 cgg 57 argX [31]
3982509..3982585 cac 20 opéron
3982606..3982692 ctg 42 « 
3982735..3982811 cca « 
4035531..4037072 16s 68 opéron
4037141..4037217 atc 42 ileT [32]
4037260..4037335 gca 183 « 
4037519..4040423 23s 93 « 
4040517..4040636 5s « 
4166659..4168200 16s 171 opéron
4168372..4168447 gaa 193
4168641..4171544 23s 92
4171637..4171756 5s
4175388..4175463 aca @3 8 thrU [33]
4175472..4175556 tac 116 opéron
4175673..4175747 gga 6 « 
4175754..4175829 acc 114 « 
4175944..4177128 tufb cds 1185 pb « 
4208147..4209688 16s 85 opéron
4209774..4209849 gaa 193
4210043..4212946 23s 93
4213040..4213159 5s
comp 4362551..4362626 ttc
4392360..4392435 ggc + 36 opéron
4392472..4392547 ggc 3 ggc 35 glyX [34]
4392583..4392658 ggc « 
4496405..4496489 ttg
comp 4606079..4606165 ctg + 34 opéron
comp 4606200..4606286 ctg 3 ctg 28 leuV [35]
comp 4606315..4606401 ctg « 

eco cds[modifier | modifier le wikicode]

  • Liens: gtRNAdb [36], NCBI [37], génome [orgn]
  • Lien tableur: eco cds
  • Légende
    - protéines1: metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp
    - protéine2: secG
    - évidence faible1, avec un pseudo.
eco2. les CDS eco pour opérons
cluster 6.8.19 Paris interca cdsa promoteur terminateur notes
222833..223408 cds 362 192 sigma FIS
223771..225312 16s 68
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93
228756..228875 5s 52
228928..229004 gac 162 Terminateur + sigma
229167..229970 cds 268
comp 2724448..2725746 cds 322 433 rien début opéron rien
comp 2726069..2726188 5s 92
comp 2726281..2729184 23s 184
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s 442 sigma FIS
comp 2731600..2734173 cds 858
3422436..3423194 cds 228 253 Terminateur fin opéron rien
comp 3423423..3423542 5s 37
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92
comp 3423880..3426783 23s 174
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 sigma FIS
3429236..3429790 cds 185
comp 3940635..3941327 cds 480 231 sigma FIS
3941808..3943349 16s 85
3943435..3943510 gaa 193
3943704..3946607 23s 92
3946700..3946819 5s 52
3946872..3946948 gac 8
3946957..3947032 tgg 95 Terminateur fin opéron rien
comp 3947128..3947967 cds 280
4034608..4035153 cds 377 182 Sigma Lrp-leu
4035531..4037072 16s 68
4037141..4037217 atc 42
4037260..4037335 gca 183
4037519..4040423 23s 93
4040517..4040636 5s 228
4040865..4040900 rprg 5 pas de Term fin opéron rien
comp 4040906..4041433 cds 176
4165428..4166285 cds 373 286 Sigma Lrp-leu
4166659..4168200 16s 171
4168372..4168447 gaa 193
4168641..4171544 23s 92
4171637..4171756 5s 300 Terminateur début opéron rien
4172057..4173085 cds 343
comp 4205943..4207532 cds 614 530 sigma FIS
4208147..4209688 16s 85
4209774..4209849 gaa 193
4210043..4212946 23s 93
4213040..4213159 5s 74 Terminateur début opéron rien
4213234..4213617 cds 128
695101..696276 cds 31 392
comp 696308..696378 rprg 51 Terminateur fin opéron rien
comp 696430..696504 cag 37
comp 696542..696616 cag 47
comp 696664..696740 atg 15
comp 696756..696830 caa 34
comp 696865..696939 caa 23
comp 696963..697047 cta 9
comp 697057..697133 atg 379 sigma FIS fin opéron rien
comp 697513..699177 cds 555
779598..780389 cds 164 264 sigma FIS fin opéron rien
780554..780629 aaa 135
780765..780840 gta 2
780843..780918 aaa 149
781068..781143 gta 3
781147..781222 aaa 146
781369..781444 aaa 132
781577..781652 aaa 432 Terminateur début opéron NadR pas sigma
782085..783128 cds 348
1286709..1286984 cds 81 92 Terminateur
comp 1287066..1287236 ncRNA -150
comp 1287087..1287176 tpr 67 30
comp 1287244..1287328 tac 209
comp 1287538..1287622 tac 159 sigma FIS
comp 1287782..1288624 cds 281
solitaire promoteur terminateur interc avant interc après protéines lien
236931..237007 gac sigma FIS Term 1 133 328 [38]
262871..262946 acg sigma FIS rien 115 204 [39]
564723..564799 aga sigma FIS rien 243 16 [40]
comp 925884..925971 InfA-tcc sigma FIS Term 1 344 254 [41]
comp 1031625..1031712 tca sigma FIS Term 2 207 427 [42]
comp 1097565..1097652 tcc sigma FIS Term 4 736 234 [43]
comp 2043468..2043557 tcg sigma - Term 1 570 94 [44]
2044549..2044624 aac sigma - Term 1 101 314 [45]
comp 2058027..2058102 aac sigma - Term 1 453 101 [46]
2059851..2059926 aac sigma - Term 1 5 38 [47]
2062260..2062335 aac sigma NtrC rien 327 56 [48]
2286211..2286287 ccc sigma FIS Term 1 75 103 [49]
2466309..2466383 agg sigma - Term 1 76 162 [50]
comp 2785762..2785837 atgi rien rien 410 -37 évidence faible1 [51]
comp 2998984..2999057 ggg sigma FIS rien 156 79 évidence faible [52]
3110366..3110441 ttc sigma FIS Term 1 106 149 [53]
3215598..3215673 atgi sigma - Term 1 125 54 [54]
comp 3318213..3318289 atgf sigma FIS Term 2 207 348 protéines1 [55]
comp 3322072..3322158 ctc sigma - Term 1 459 15 protéine2 [56]
comp 3708616..3708692 ccg sigma FIS Term 2 911 92 [57]
3836222..3836316 tga sigma - rien 293 109 [58]
comp 4362551..4362626 ttc sigma FIS Term 1 198 107 [59]
4496405..4496489 ttg sigma FIS Term 1 196 261 [60]

eco cumuls[modifier | modifier le wikicode]

cumuls. Escherichia coli
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 7 1 0 - 1 1 100
16 23 5s 0 0 20 11 50 20 200
16 atc gca 3 40 10 100 40 300
16 23 5s a 0 60 6 150 60 400
max a 3 80 1 200 80 500
a doubles 0 100 0 250 100 600
spéciaux 4 120 1 300 120 700
total aas 14 140 2 350 140 800
sans opérons 36 160 2 400 160 900
1 aa 23 180 0 450 180 1000
max a 7 200 2 500 200 1100
a doubles 10 1
total aas 72 36 0 0 0 0
total aas 86
remarques 3
avec jaune moyenne 57
variance 60
sans jaune moyenne
variance

eco blocs[modifier | modifier le wikicode]

eco1. Escherichia coli, blocs à rRNA.
16s 68 16s 68 68
atc 42 atc 42 42
gca 174 gca 183 183
23s 92 23s 93 93
5s 12 5s 52
acc 37 gac
5s
16s 85 171 171 85
gaa 193 184 193 193
23s 92 92 92 93
5s 52
gac

eco remarques[modifier | modifier le wikicode]

  • Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles. Comme eal.
    1. @1  Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.
      - Les intercalaires sont les mêmes pour les 3 opérons, 68 42 183 93.
      - Cependant les 3 1ers intercalaires diminuent de 3 bases chacun et le 4ème est divisé par 2.
      - Par rapport à eal un opéron sans aa de plus, s'est transformé avec 1 aa et 1 5s en plus. Son intercalaire gca-23s a diminué de 5 % par rapport aux 2 autres, 9/183.
    2. @2  4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s, comme eal.
      - Les intercalaires sont les mêmes pour 2 opérons sans aa supplémentaire, 171 193 92.
      - Pour les 2 autres opérons le 1er intrcalaire est divisé par 2, 85 193 92.
      - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.
      - Par rapport à eal, l'opéron avec 1 aa et 1 5s a perdu ces suppléments. Et l’on a 3 opérons sans et 1 opéron avec 2 aas en supplément.
    3. @3  2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB
  • Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.
    - Il y a 4 remaniements qui consistent tous en une ou 2 répétions de plus des répétitions déjà existantes
    - 2 opérons sans rRNAs et sans doubles ont été perdus de eal à eco.
    - Pour eco il y a toujours 10 opérons avec répétition et 3 sans répétitions:
    - 3 opérons à 2 aas répétés
    - 4 opérons à 3 aas répétés
    - 1 opéron à 4 aas répétés.
    - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.
    - Un opéron à 7 aas a une séquence répétée, 3aaa + 2*2.
		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca
  • Notes :

Escherichia coli Nissle 1917[modifier | modifier le wikicode]

ecoN opérons[modifier | modifier le wikicode]

  • Liens: gtRNAdb [61], NCBI [62], génome [63]
  • Lien tableur: ecoN opérons
  • Phylogénie: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia.
  • Légende: cdsa: cds aas, cdsd: cds dirigé
G7. Escherichia coli Nissle 1917
50%GC 21.8.19 Paris  123   doubles intercal cds aa avec aa cdsa cdsd protéines
231864..232436 CDS 365 365 191 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
232802..234321 16s 73 1520
234395..234471 gaa 12 12
234484..234557 gca 174
234732..237319 23s 83 2588
237403..237518 5s 54 116
237573..237649 gac 162 162 162
237812..238615 CDS 268 2,5-didehydrogluconate reductase DkgB
244934..245665 CDS 132 132 244 DNA polymerase III subunit epsilon
245798..245874 gac 120 120 120
comp 245995..246852 CDS 286 DUF4942 domain-containing protein
367329..368582 CDS 114 114 418 114 glutamate-5-semialdehyde dehydrogenase
368697..368772 acg 154 154
368927..369265 CDS 113 DUF4102 domain-containing protein
comp 631149..632015 CDS 270 270 289 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
632286..632362 aga 15 15 15
comp 632378..632997 CDS 207 tyrosine-type recombinase/integrase
733188..734363 CDS 153 153 392 153 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
comp 734517..734591 cag + 37 37
comp 734629..734703 cag 2 cag 48 48
comp 734752..734828 atgj 2 atgj 15 15
comp 734844..734918 caa 2 caa 34 34
comp 734953..735027 caa 23 23
comp 735051..735135 cta 10 10
comp 735146..735222 atgj 380 380
comp 735603..737267 CDS 555 asparagine synthase B
807377..808169 CDS 164 164 264 164 Pseudo, cell division protein CpoB
808334..808409 aaa + 35 35
808445..808520 gta 5 aaa 2 2
808523..808598 aaa 2 gta 51 51
808650..808725 gta 3 3
808729..808804 aaa 48 48
808853..808928 aaa 33 33
808962..809037 aaa 277 277
809315..810358 CDS 348 quinolinate synthase NadA
950069..952345 CDS 343 343 759 343 ATP-dependent Clp protease ATP-binding subunit ClpA
comp 952689..952776 tcc 253 253
comp 953030..953248 CDS 73 translation initiation factor IF-1
comp 1047224..1047883 CDS 206 206 220 206 FtsH protease modulator YccA
comp 1048090..1048177 tca 426 426
1048604..1049722 CDS 373 hydrogenase 1 small subunit
1183656..1184018 CDS 463 463 121 hp
1184482..1184558 aga 278 278 278
> comp 1184837..1185786 CDS 317 Pseudo, IS4 family transposase
1213982..1214809 CDS 165 165 276 165 DUF4942 domain-containing protein
comp 1214975..1215062 tcc 233 233
1215296..1216234 CDS 313 glyoxylate/hydroxypyruvate reductase GhrA
1216817..1217098 CDS 165 165 94 165 DUF4942 domain-containing protein
comp 1217264..1217351 tcc 234 234
1217586..1218524 CDS 313 glyoxylate/hydroxypyruvate reductase GhrA
1457038..1458129 CDS 16 16 364 16 acyl-CoA desaturase
comp 1458146..1458277 ncRNA 46 44 RtT sRNA
comp 1458324..1458408 tac + 33 33
comp 1458442..1458526 tac 2 tac 159 159
comp 1458686..1459528 CDS 281 formyltetrahydrofolate deformylase
comp 1829066..1830322 CDS 307 307 419 hp
1830630..1830706 gtc + 4 4
1830711..1830787 gtc 2 gtc 6 6 6
< 1830794..1831177 CDS @4 128 Pseudo, multidrug efflux MATE transporter MdtK
comp 1831218..1832474 CDS 307 307 419 hp
1832782..1832858 gtc + 4 4
1832863..1832939 gtc 2 gtc 8 8 8
< 1832948..1833280 CDS 111 Pseudo, MATE family efflux transporter
comp 1833321..1834577 CDS 307 307 419 hp
1834885..1834961 gtc + 4 4
1834966..1835042 gtc 2 gtc 108 108 108
1835151..1835456 CDS 102 monooxygenase
comp 2115794..2116459 CDS 195 195 222 UPF0149 family protein YecA
comp 2116655..2116741 tta 12 12
comp 2116754..2116827 tgc 53 53
comp 2116881..2116956 ggc 151 151 151
comp 2117108..2117656 CDS 183 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
comp 2191451..2192287 CDS 278 278 279 hp
comp 2192566..2192655 tcg 93 93 93
2192749..2193546 CDS 100 100 266 100 DgsA anti-repressor MtfA
2193647..2193722 aac 161 161
2193884..2195146 CDS 421 tyrosine-type recombinase/integrase
2232607..2233323 CDS 453 453 239 YebC/PmpR family DNA-binding transcriptional regulator
comp 2233777..2233852 acc 326 326 326
2234179..2235096 CDS 306 nitrogen assimilation transcriptional regulator
2235198..2236148 CDS 37 37 317 HTH-type transcriptional regulator Cbl
comp 2236186..2236261 aac 4 4 4
2236266..2237909 CDS 100 100 548 100 toxic metabolite efflux MATE transporter YeeO
2238010..2238085 aac 161 161
2238247..2239518 CDS 424 tyrosine-type recombinase/integrase
2546968..2548728 CDS 74 74 587 74 cardiolipin transport protein PbgA
2548803..2548879 ccc 101 101
comp 2548981..2549136 CDS 52 autotransporter outer membrane beta-barrel domain-containing protein
2717780..2718712 CDS 75 75 311 75 formate/nitrite transporter family protein
2718788..2718862 agg 437 437
comp 2719300..2719830 CDS 177 OmpH family outer membrane protein
comp 2768744..2770933 CDS 206 206 730 206 sensor domain-containing phosphodiesterase
comp 2771140..2771215 gcc + 39 39
comp 2771255..2771330 gcc 2 gcc 220 220
2771551..2771910 CDS 120 putative DNA-binding transcriptional regulator
comp 2772355..2773770 CDS 258 258 472 glutamate--tRNA ligase
2774029..2774104 gta + 43 43
2774148..2774223 gta 3 gta 46 46
2774270..2774345 gta 4 4
2774350..2774425 aaa 110 110 110
comp 2774536..2775420 CDS 295 LysR family transcriptional regulator
comp 2959205..2960503 CDS 323 323 433 323 alpha-ketoglutarate permease
comp 2960827..2960942 5s 83 116
comp 2961026..2965477 23s 184 4452
comp 2965662..2965737 gaa 431
comp 2966169..2967720 16s 441 441 1552
comp 2968162..2970735 CDS 858 ATP-dependent chaperone ClpB
comp 3027207..3027773 CDS 280 280 189 280 fructose-1-phosphate/6-phosphogluconate phosphatase
comp 3028054..3028130 cgt + 63 63
comp 3028194..3028270 cgt 5 cgt 62 62
comp 3028333..3028409 cgt 62 62
comp 3028472..3028548 cgt 64 64
comp 3028613..3028689 cgt 3 3
comp 3028693..3028785 agc 315 315
comp 3029101..3029286 CDS 62 carbon storage regulator CsrA
comp 3157337..3158434 CDS 208 208 366 208 murein transglycosylase A
3158643..3158719 atgf + 33 33
3158753..3158829 atgf 3 atgf 33 33
3158863..3158939 atgf 635 635
3159575..3160075 CDS 167 type VI secretion system contractile sheath small subunit
3230172..3231401 CDS 316 316 410 HAAAP family serine/threonine permease
comp 3231718..3231791 ggg 78 78 78
comp 3231870..3232625 CDS 252 peptidoglycan DD-metalloendopeptidase family protein
3341048..3341755 CDS 105 105 236 105 DUF554 domain-containing protein
3341861..3341936 ttc 197 197
3342134..3343399 CDS 422 integrase arm-type DNA-binding domain-containing protein
comp 3569308..3569814 CDS 124 124 169 G/U mismatch-specific DNA glycosylase
3569939..3570014 atgi 53 53 53
comp 3570068..3570832 CDS 255 NADPH-dependent ferric chelate reductase
comp 3670227..3670679 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3670886..3670962 atgf 347 347
> 3671310..3672155 CDS 282 Pseudo, argininosuccinate synthase
comp 3673935..3674387 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3674594..3674670 atgf 347 347
> 3675018..3675869 CDS 284 Pseudo, argininosuccinate synthase
comp 3677794..3678246 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3678453..3678529 atgf 347 347
> 3678877..3679722 CDS 282 Pseudo, argininosuccinate synthase
comp 3681532..3681984 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3682191..3682267 atgf 347 347
3682615..3683958 CDS 448 argininosuccinate synthase
comp 3683966..3685591 CDS 456 456 542 phosphoethanolamine transferase
comp 3686048..3686134 ctc 14 14 14
comp 3686149..3686481 CDS 111 preprotein translocase subunit SecG
3784553..3785311 CDS 62 62 253 62 amino acid ABC transporter ATP-binding protein
comp 3785374..3785489 5s @3 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360 1360
3789989..3790543 CDS 185 gamma carbonic anhydrase family protein
comp 4078635..4080242 CDS 743 743 536 dipeptide ABC transporter substrate-binding protein DppA
comp 4080986..4081062 ccg 91 91 91
comp 4081154..4082845 CDS 564 kdo(2)-lipid A phosphoethanolamine 7-transferase
comp 4205966..4207348 CDS 292 292 461 292 glycoside-pentoside-hexuronide family transporter
4207641..4207735 tga 300 300
> 4208036..4208857 CDS 274 Pseudo, DUF4102 domain-containing protein
comp 4338643..4339335 CDS 479 479 231 FadR family transcriptional regulator
4339815..4341342 16s 73 1528
4341416..4341491 gaa 184
4341676..4344286 23s 83 2611
4344370..4344485 5s 53 116
4344539..4344615 gac 8
4344624..4344699 tgg 95 95 95
comp 4344795..4345634 CDS 280 HTH-type transcriptional regulator HdfR
4377681..4379066 CDS 102 102 462 102 amino acid permease
4379169..4379245 cgg 58 58
4379304..4379379 cac 20 20
4379400..4379486 ctg 42 42
4379529..4379605 cca 146 146
4379752..4380987 CDS 412 anaerobic sulfatase maturase
4460971..4461516 CDS 377 377 182 menaquinone-dependent protoporphyrinogen IX dehydrogenase
4461894..4463631 16s 56 1738
4463688..4463764 atc 42 42
4463807..4463882 gca 165
4464048..4467338 23s 83 3291
4467422..4467537 5s 104 104 116 104
comp 4467642..4468169 CDS 176 molybdopterin-guanine dinucleotide biosynthesis protein B
4605577..4606434 CDS 374 374 286 glutamate racemase
4606809..4608362 16s 363 1554
4608726..4608801 gaa 1112
4609914..4610029 5s 136 136 116 136
4610166..4611194 CDS 343 UDP-N-acetylenolpyruvoylglucosamine reductase
comp 4612185..4613135 CDS 361 361 317 type I pantothenate kinase
4613497..4613572 aca 8 8
4613581..4613665 tac 116 116
4613782..4613856 gga 6 6
4613863..4613938 acc 114 114 114
4614053..4615237 CDS 395 elongation factor Tu
comp 4642984..4644573 CDS 616 616 530 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
4645190..4646378 16s’ @1 83 83 1189 83
4646462..4648150 CDS 436 436 563 bifunctional isocitrate dehydrogenase kinase/phosphatase
4648587..4648662 gaa 185
4648848..4651319 23s 83 2472
4651403..4651518 5s 76 76 116 76
4651595..4651978 CDS 128 hypothetical protein
< comp 4834504..4834961 CDS 197 197 153 pseudo, integrase
comp 4835159..4835234 ttc 106 106 106
comp 4835341..4835916 CDS 192 transcriptional regulator
4864628..4865173 CDS 210 210 182 210 oligoribonuclease
4865384..4865459 ggc + 36 36
4865496..4865571 ggc 3 ggc 35 35
4865607..4865682 ggc 233 233
4865916..4865969 CDS 18 hp
comp 4974178..4975197 CDS 195 195 340 NADPH-dependent aldehyde reductase Ahr
4975393..4975477 ttg 39 39 39
<> comp 4975517..4976055 CDS 180 pseudo, IS630 family transposase
5042527..5042763 CDS 38 38 79 38 DUF1435 domain-containing protein
comp 5042802..5042888 ctg + 34 34
comp 5042923..5043009 ctg 3 ctg 28 28
comp 5043038..5043124 ctg 290 290
comp 5043415..5044446 CDS 344 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
comp 5079375..5079581 CDS 117 117 69 117 AlpA family transcriptional regulator
5079699..5081218 16s 73 1520
5081292..5081368 gaa 12 12
5081381..5081454 gca 366 366
5081821..5082018 CDS 524 524 66 hypothetical protein
comp 5082543..5082754 CDS 71 hypothetical protein
comp 5090325..5090876 CDS 1808 1808 184 MarR family transcriptional regulator
comp 5092685..5092760 gaa 588 588 588
< comp 5093349..5093474 CDS 592 592 42 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
5094067..5094142 gaa + 1472 1472
5095615..5095691 atc 3 gaa 42 42
5095734..5095809 atc 2 atc 1130 1130
5096940..5097015 gaa 1145 1145
5098161..5098236 gaa 185
5098422..5100893 23s 83 2472
5100977..5101092 5s 76 76 116 76
5101169..5101552 CDS 63 63 128 hypothetical protein
comp 5101616..5102059 CDS 148 acetyltransferase
5124754..5125197 CDS 63 63 148 acetyltransferase
comp 5125261..5125644 CDS 76 76 128 hypothetical protein
comp 5125721..5125836 5s 83 116
comp 5125920..5128366 23s’ @2 -10 -10 2447 -10
< 5128357..5128479 CDS 41 pilus assembly protein
comp 5252659..5253870 CDS 300 300 404 tyrosine-type recombinase/integrase
comp 5254171..5254249 tga 292 292 292
> 5254542..5255171 CDS 210 pseudo, glycoside-pentoside-hexuronide family transporter
> comp 5305902..5306228 CDS 0 0 109 0 pseudo, hp
comp 5306229..5306302 atc 1096 1096
5307399..5308450 CDS 351 pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
comp 5321144..5321869 CDS 206 206 242 206 pseudo, histidine kinase
comp 5322076..5322151 gcc + 39 39
comp 5322191..5322266 gcc 3 gcc 39 39
comp 5322306..5322381 gcc 220 220
5322602..5322961 CDS 120 putative DNA-binding transcriptional regulator
comp 5323406..5324821 CDS 258 258 472 glutamate--tRNA ligase
5325080..5325155 gta + 44 44
5325200..5325275 gta 2 gta 0 0 0
< 5325276..5325389 CDS 38 pseudo, putative DNA-binding transcriptional regulator
> 5375524..5376270 CDS 891 891 249 891 pseudo, AI-2E family transporter
5377162..5377237 gaa 1047 1047
comp 5378285..5379589 CDS 435 isocitrate lyase
comp > 5341397..5341492 CDS -2 -2 32 -2 ABC transporter ATP-binding protein
comp 5341491..5344303 23s 174 2813
comp 5344478..5344553 gca 42 42
comp 5344596..5344672 atc 56
comp 5344729..5346282 16s 1063 1554
comp 5347346..5347421 gca 42 42
comp 5347464..5347540 atc 56
comp 5347597..5349150 16s 365 365 1554
comp 5349516..5350088 CDS 187 187 191 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
> 5350276..5350914 CDS 213 methionine ABC transporter ATP-binding protein MetN
> comp 5359583..5360512 CDS 120 120 310 tyrosine-type recombinase/integrase
comp 5360633..5360708 gca 42
comp 5360751..5360827 atc 56
comp 5360884..5362138 16s’ 1 1 1255 1
< comp 5362140..5363543 CDS 468 IS66 family transposase
5425965..5426201 CDS 38 38 79 38 DUF1435 domain-containing protein
comp 5426240..5426325 ctg + 26 26 a disparu le 20.12.19
comp 5426352..5426438 ctg 3 ctg 28 28
comp 5426467..5426553 ctg 63 63
< comp 5426617..5427150 CDS 178 pseudo, IS630-like element IS630 family transposase
> 5433568..5433687 CDS 39 39 40 39 pseudo, nicotinamide-nucleotide amidase
comp 5433727..5433814 tcc 253 253
comp 5434068..5434286 CDS 73 translation initiation factor IF-1

ecoN cumuls[modifier | modifier le wikicode]

cumuls. Escherichia coli Nissle 1917
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa gammes cdsa 300
avec rRNA opérons 12 1 0 1 5 1 5 100 16 1 0
16 23 5s 0 20 13 2 50 11 40 10 200 34 30 1
16 atc gca 2 40 17 100 17 80 7 300 29 60 6
16 gaa 235 2 60 9 4 150 16 120 16 400 18 90 8
max a 5 80 4 200 15 160 3 500 18 120 8
a doubles 1 100 0 250 14 200 4 600 8 150 7
spéciaux 8 120 1 300 14 240 9 700 0 180 11
total aas 27 140 0 350 12 280 2 800 2 210 11
sans opérons 50 160 0 400 7 320 2 900 1 240 6
1 aa 32 180 0 450 4 360 3 1000 0 270 9
max a 7 200 0 500 4 400 0 1100 0 300 12
a doubles 15 0 11 2 0 0
total aas 94 44 6 130 63 126 79
total aas 121
remarques 4
avec jaune moyenne 33 32 253 142 272 172
variance 23 15 258 145 162 79
sans jaune moyenne 31 178 127 260
variance 19 109 91 142

ecoN blocs[modifier | modifier le wikicode]

  • Lien tableur: ecoN blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - Protéines en vert, sont hypothétiques ou typées, gc anhydrase. Voir les noms longs.
ecoNb Escherichia coli Nissle 1917, ecoN blocs
ecoNb1 Escherichia coli Nissle 1917, ecoN blocs
gène interca pbs cdsa protéine
cds 365 191 D-glycero
16s 73 1520
gaa 12
gca 174
23s 83 2588
5s 54 116
gac 162
cds 268 gluDkgB
cds 323 433 glutarate pm
5s 83 116
23s 184 4452
gaa 431
16s 441 1552
cds 858 ClpB dep
cds 616 530 AICAR2
16s’ 83 1189
cds 436 563 kinase isocit
gaa 185
23s 83 2472
5s 76 116
cds 128 hp-128
cds 62 253 pu-ABC
5s 39 116
acc 14
5s 777 116
acc 14
5s 1834 116
gaa 1360
cds 185 gc anhydrase
cds 377 182 porphyrine M
16s 56 1738
atc 42
gca 165
23s 83 3291
5s 104 116
cds 176 Mlb pB
cds 479 231 FadR tr
16s 73 1528
gaa 184
23s 83 2611
5s 53 116
gac 8
tgg 95
cds 280 HdfR HTH
ecoNb2 Escherichia coli Nissle 1917, ecoN blocs
gène interca pbs cdsa protéine
cds 374 286 Glu race
16s 363 1554
gaa 1112
5s 136 116
cds 343 UDP-N
cds 117 69 tr AlpA
16s 73 1520
gaa 12
gca 366
cds 524 66 hp-66
cds 71 hp-71
cds -2 32 ABC 32
23s 174 2813
gca 42
atc 56
16s 1063 1554
gca 42
atc 56
16s 365 1554
cds 187 191 D-glycero
cds 213 ABC MetN
cds 120 310 Tyr recb 310
gca 42
atc 56
16s’ 1 1255
cds 468 IS66
cds 63 148 transferase
cds 76 128 hp-128
5s 83 116
23s’ -10 2447
cds 41 pilus
cds 1808 184 MarR
gaa 588
cds 592 42 sn-glycerol
gaa 1472
atc 42
atc 1130
gaa 1145
gaa 185
23s 83 2472
5s 76 116
cds 63 128 hp-128
cds 148 transferase
ecoNb3 ecoN rRNAs
rRNAs pbs
16s
1189
1255
1520
1520
1528
1552
1554
1554
1554
1738
23s
2447
2472
2472
2588
2611
2813
3291
4452
5s
116 x 11

ecoN remarques[modifier | modifier le wikicode]

  • Remarques: ecoN opérons
    Beaucoup de blocs à rRNAs incomplets, 7 sur 12. Parmi les 5 complets 1 est semi-complet puisqu’il manque le 5s peu important. Les 5 blocs complets sont conformes au typage des gamma, avec y atcgca gaagca gaa et avec z sans gactgg gac.
    1. @1
      - Deux 16s aux extrémités non conformes, 16s’, adresses 4645190..4646378 et 5360884..5362138 .
      - Il n’y a pas de 16s° ou de 23s° courts, apparemment ils n’ont pas laissé de traces.
      - C’est ce qui expliquerait les 7 blocs incomplets et le nombre élevé de 32 des clusters sans rRNAs et à 1 seul tRNA.
    2. @2
      - Un 23s aux extrémités non comforme, 23s’, adresse 5125920..5128366 .
      - Même remarque que pour les 16s’, mais en plus je peux attribuer le grand nombre de petits cds aux remaniements qu’ont du subir ces blocs incomplets, voir ecoN blocs.
        5128357..5128479  -10 cp 23s'
        5341397..5341492  atcgca -2
        5360884..5362138  16s’ 1
    3. @3
      - Les 5s se comportent en typage gamma même pour ceux qui sont dans un bloc incomplet. Parmi ces derniers la plupart n’ont pas de z mais dans le cluster comportant 3 5s, adresse 3785374..3785489 , on peut distinguer avec des intercalaires faibles un 5s-acc-5s et un 5s-acc, où les 5s du début appartiendraient à un bloc complet.
    4. @4
      - Parmi les 6 clusters sans rRNA et à 2 tRNAs tous sont doubles et 3 sont identiques même en intercalaires, les 3 gtc. Les 3 autres sont gta tac et gcc.
      - Parmi les 6 clusters sans rRNA et à 3 tRNAs 5 sont des triples dont 2 à cgt ont même 2 intercalaires identiques, adresses. Les tRNAs de ces triplets sont atgf ggc gcc et 2 fois cgt. Le 6ème cluster à 3 tRNAs n’ a pas de doubles.
  • Séquences des doubles:
aas	clusters	doubles	séquences					
1	32		-					
2	6		6	2 tac	2 gtc*3  2 gcc	2 gta	
3	6		5	3 atgf	3 ctg*2  3 ggc	3 gcc	
4	3		1	3 gta				
5	0						
6	1		1	5 cgt				
7	2		2	5 aaa 2 gta    2 cag 2 atgj 2 caa

ecoN eco[modifier | modifier le wikicode]

ecoN eco tableaux[modifier | modifier le wikicode]

  • Lien tableur: ecoN eco tableaux
  • Légende: eco 435, la recherche de isocitrate, voir noms longs, se trouve à l'adresse 4217109..4218413 chez eco.
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - Colonne cdsa
    . en clair la longueur de la protéine en aas
    . en orange 1542, longueur des rRNAs en pbs.
    - Colonne cds, les noms courts des cds
    . en clair
    . en vert D glycero, protéine identique entre eco et ecoN, à peu près en longueur et par le nom.
    . en bleu YdiA, protéine complètement différente en nom et/ou en longueur, entre ecoN et eco
    . en turquoise hp-419, protéine identique par la longueur mais différente par le nom, entre ecoN et eco
    . en gris clair D glycero, dans le tableau E13, protéine transposée par complement (colonne sens) entre ecoN et eco alors qu'il y a transposition des intercalaires (colonne interca), 365.
    . en gris foncé ABC 32, dans le tableau E13, protéine non transposée par complement (colonne sens) entre ecoN et eco alors qu'il n'y a pas transposition des intercalaires (colonne interca), 174.
    . en vert très foncé, dans le tableau E13, Tyr recb 404,protéine existant dans ecoN mais non trouvée dans eco.
  • Notes: Les dates de prélèvements des blocs de eco sont ceux de eco opérons du 10.3.19 alors que les cds de eco ont été prélevés le 19.12.19, qu'on voit dans le tableur ecoN eco tableaux. Pour ecoN la date de prélèvement est celle de ecoN opérons.
E1. Comparaison eco ecoN
E11. Clusters eco
cluster sens gènes interca cdsa cds
eco1 222833..223408 cds 362 192 D-glycero
223771..225312 16s 68 1542
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93 2904
228756..228875 5s 52 120
228928..229004 gac 162
229167..229970 cds 268 metDkgB
eco2 236067..236798 cds 132 244 DNAIIIe
236931..237007 gac 327
237335..238120 cds 262 lipo YafT
eco3 261503..262756 cds 114 418 glu5dH
262871..262946 acg 203
comp 263150..263212 cds 21 YdiA
262898..297205 phage 11436 pp CP4-6
eco4 comp 563848..564480 cds 242 211 put FimZ
564723..564799 aga 15
comp 564815..565978 cds 388 put DLP12
564755..586056 phage 7101 pp DLP12
eco5 695101..696276 cds 31 392 octaprenyl
comp 696308..696378 rpr 51 71 rpt71
comp 696430..696504 cag 37
comp 696542..696616 cag 47
comp 696664..696740 atg 15
comp 696756..696830 caa 34
comp 696865..696939 caa 23
comp 696963..697047 cta 9
comp 697057..697133 atg 379
comp 697513..699177 cds 555 Asn B
eco6 779598..780389 cds 164 264 cell CpoB
780554..780629 aaa 135
780765..780840 gta 2
780843..780918 aaa 149
781068..781143 gta 3
781147..781222 aaa 146
781369..781444 aaa 132
781577..781652 aaa 432
782085..783128 cds 348 quino
eco7 923264..925540 cds 343 759 ATP ClpA
comp 925884..925971 tcc 253
comp 926225..926443 cds 73 tif IF-1
eco8 comp 1030759..1031418 cds 206 220 FtsH
comp 1031625..1031712 tca 426
1032139..1033257 cds 373 Hnase1
eco9
*****aga*****
eco10 1095843..1096829 cds 735 329 un-YcdU
comp 1097565..1097652 tcc 233
1097886..1098824 cds 313 glyoxylate A
eco11
*****tcc*****
eco12 1286709..1286984 cds 81 92 p-un-YchS
comp 1287066..1287236 ncRNA -150 171 RttR sRNA
comp 1287087..1287176 cds 67 30 tpr
comp 1287244..1287328 tac 209
comp 1287538..1287622 tac 159
comp 1287782..1288624 cds 281 fTHF
eco13
***** gtc *****
gtc
eco14 ***** gtc *****
gtc
eco15 comp 1744871..1746127 cds 307 419 adhes YdhQ
1746435..1746511 gtc 4
1746516..1746592 gtc 107
1746700..1747005 cds 102 pu-YdhR
eco16 comp 1990954..1991619 cds 195 222 UPF0149 YecA
comp 1991815..1991901 tta 12
comp 1991914..1991987 tgc 54
comp 1992042..1992117 ggc 151
comp 1992269..1992817 cds 183 glycerolP
eco17 2042368..2042898 cds 569 177 pu-cytochrom
comp 2043468..2043557 tcg 93
2043651..2044448 cds 100 266 Mtf
2044549..2044624 aac 313
2044938..2052014 cds 2359 Inv-adhesin
eco18 2056858..2057574 cds 452 239 pu-tr-YeeN
comp 2058027..2058102 aac 100
comp 2058203..2059846 cds 4 548 exporter
2059851..2059926 aac 37
comp 2059964..2060914 cds 101 317 tact Cbl
comp 2061016..2061933 cds 326 306 tr-Nac
2062260..2062335 aac 55
comp 2062391..2063323 cds 311 ErfK
eco19 2284376..2286136 cds 74 587 pu-cardiolip
2286211..2286287 ccc 102
comp 2286390..2288914 cds 842 adhes YejO
eco20 2465301..2466233 cds 75 311 YfdC
2466309..2466383 agg 161
2466545..2467702 cds 386 KpLE1
2466369..2476583 phage 3405 pp CPS-53
eco21 comp 2515643..2517832 cds 208 730 pu-sensor
comp 2518041..2518116 gcc 39
comp 2518156..2518231 gcc 235
2518467..2518811 cds 115 pu- YfeC
eco22 comp 2519257..2520672 cds 258 472 Glu ligase
2520931..2521006 gta 44
2521051..2521126 gta 46
2521173..2521248 gta 4
2521253..2521328 aaa 210
2521539..2521567 rpr 25 29 rpt-29
comp 2521593..2522477 cds 295 XapR
eco23 comp 2724448..2725746 cds 322 433 glutarate sm
comp 2726069..2726188 5s 92 120
comp 2726281..2729184 23s 184 2904
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s 442 1542
comp 2731600..2734173 cds 858 ClpB
eco24 comp 2784529..2785011 cds 750 161 DUF5507
comp 2785762..2785837 atgi 559
2786397..2788649 cds 751 pu-unYgaQ
eco25 comp 2816937..2817503 cds 280 189 fructose
comp 2817784..2817860 cgt 198
comp 2818059..2818135 cgt 62
comp 2818198..2818274 cgt 198
comp 2818473..2818549 cgt 3
comp 2818553..2818645 agc 315
comp 2818961..2819146 cds 62 Csr
eco26 comp 2946081..2947178 cds 208 366 murein lytic
2947387..2947463 atgf 33
2947497..2947573 atgf 33
2947607..2947683 atgf 73
comp 2947757..2949010 cds 418 Ala C
eco27 comp 2998034..2998828 cds 155 265 YgeQ
comp 2998984..2999057 ggg 78
comp 2999136..2999891 cds 252 pu-LysM
eco28 3109553..3110260 cds 105 236 DUF554
3110366..3110441 ttc 148
comp 3110590..3111126 cds 179 pu-ssM
eco29 comp 3214967..3215473 cds 124 169 G/U station
3215598..3215673 atgi 53
comp 3215727..3216491 cds 255 ferric
eco30
eco31
eco32
eco33 comp 3317554..3318006 cds 206 151 RimP
comp 3318213..3318289 atgf 347
3318637..3319980 cds 448 Arg-suc
eco34 comp 3319988..3321613 cds 458 542 pu-hydrolase
comp 3322072..3322158 ctc 14
comp 322173..3322505 cds 111 SecG-t
eco35 3422436..3423194 cds 228 253 pu-YhdZ
comp 3423423..3423542 5s 37 120
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92 120
comp 3423880..3426783 23s 174 2904
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 1542
3429236..3429790 cds 185 protein YrdA
eco36 comp 3706098..3707705 cds 567 536 dip ABC
comp 3708273..3708306 rpr 16 34 rpt-34
3708323..3708358 rpr 257 36 rpt-36
comp 3708616..3708692 ccg 91
comp 3708784..3710475 cds 564 kdo2
eco37 comp 3834547..3835929 cds 292 461 pu-YicJ
3836222..3836316 tga 108
3836425..3836556 pseudo 396 132 p-yicT
3836953..3838137 cds 395 pu-arabi
eco38 comp 3940635..3941327 cds 480 231 pu-tr YieP
3941808..3943349 16s 85 1542
3943435..3943510 gaa 193
3943704..3946607 23s 92 2904
3946700..3946819 5s 52 120
3946872..3946948 gac 8
3946957..3947032 tgg 95
comp 3947128..3947967 cds 280 HdfR
eco39 3980887..3982272 cds 102 462 pu-YifK
3982375..3982451 cgg 57
3982509..3982585 cac 20
3982606..3982692 ctg 42
3982735..3982811 cca 146
3982958..3984193 cds 412 pu-AslB
eco40 4034608..4035153 cds 377 182 porphyrine O
4035531..4037072 16s 68 1542
4037141..4037217 atc 42
4037260..4037335 gca 183
4037519..4040423 23s 93 2905
4040517..4040636 5s 228 120
4040865..4040900 rpr 5 36 rpt-36
comp 4040906..4041433 cds 176 Mlb adapt
eco41 4165428..4166285 cds 373 286 Glu race
4166659..4168200 16s 171 1542
4168372..4168447 gaa 193
4168641..4171544 23s 92 2904
4171637..4171756 5s 300 120
4172057..4173085 cds 343 UDP-N
eco42 comp 4174076..4175026 cds 361 317 B5 kinase
4175388..4175463 aca 8
4175472..4175556 tac 116
4175673..4175747 gga 6
4175754..4175829 acc 114
4175944..4177128 cds 229 395 tufb
4177358..4177741 cds 128 SecE
eco43 comp 4205943..4207532 cds 614 530 AICAR1
4208147..4209688 16s 85 1542
4209774..4209849 gaa 193
4210043..4212946 23s 93 2904
4213040..4213159 5s 74 120
4213234..4213617 cds 128 stress
eco44 comp 4360396..4361934 cds 256 513 CadC
comp 4362191..4362353 pseudo 197 163 yjdQ
comp 4362551..4362626 ttc 106
comp 4362733..4363308 cds 192 pu-tr YjdC
eco45 4391604..4392149 cds 210 182 oligo-rnase
4392360..4392435 ggc 36
4392472..4392547 ggc 35
4392583..4392658 ggc 233
4392892..4392945 cds 18 un-YjeV
eco46 comp 4495190..4496209 cds 195 340 NADPH- Ah
4496405..4496489 ttg 260
4496750..4497940 cds 397 pu-KpLE2
4496675..4497940 phage 422 pp PR-Y
eco47 4605804..4606040 cds 38 79 protein YjjZ
comp 4606079..4606165 ctg 34
comp 4606200..4606286 ctg 28
comp 4606315..4606401 ctg 157
4606559..4606594 rpr 22 36 rpt 36
comp 4606617..4606650 rpr 18 34 rpt 34
comp 4606669..4607700 cds 344 G1207
E12. Clusters ecoN alignés sur les clusters de eco
cluster sens gènes interca cdsa cds
ecoN1 231864..232436 CDS 365 191 D-glycero
232802..234321 16s 73 1520
234395..234471 gaa 12
234484..234557 gca 174
234732..237319 23s 83 2588
237403..237518 5s 54 116
237573..237649 gac 162
237812..238615 CDS 268 gluDkgB
ecoN2 244934..245665 CDS 132 244 DNAIIIe
245798..245874 gac 120
comp 245995..246852 CDS 286 DUF4942
ecoN3 367329..368582 CDS 114 418 glu5dH
368697..368772 acg 154
368927..369265 CDS 113 DUF4102
ecoN4 comp 631149..632015 CDS 270 289 cyclo FolD
632286..632362 aga 15
comp 632378..632997 CDS 207 Tyr recb 207
ecoN5 733188..734363 CDS 153 392 octaprenyl
comp 734517..734591 cag 37
comp 734629..734703 cag 48
comp 734752..734828 atgj 15
comp 734844..734918 caa 34
comp 734953..735027 caa 23
comp 735051..735135 cta 10
comp 735146..735222 atgj 380
comp 735603..737267 CDS 555 Asn B
ecoN6 807377..808169 CDS 164 264 p-cell CpoB
808334..808409 aaa 35
808445..808520 gta 2
808523..808598 aaa 51
808650..808725 gta 3
808729..808804 aaa 48
808853..808928 aaa 33
808962..809037 aaa 277
809315..810358 CDS 348 quino NadA
ecoN7 950069..952345 CDS 343 759 ATP ClpA
comp 952689..952776 tcc 253
comp 953030..953248 CDS 73 tif IF-1
ecoN8 comp 1047224..1047883 CDS 206 220 FtsH YccA
comp 1048090..1048177 tca 426
1048604..1049722 CDS 373 Hnase1
ecoN9 1183656..1184018 CDS 463 121 hp-121
1184482..1184558 aga 278
> comp 1184837..1185786 CDS 317 p-IS4
ecoN10 1213982..1214809 CDS 165 276 DUF4942
comp 1214975..1215062 tcc 233
1215296..1216234 CDS 313 glyoxyl GhrA
ecoN11 1216817..1217098 CDS 165 94 DUF4942
comp 1217264..1217351 tcc 234
1217586..1218524 CDS 313 glyoxyl GhrA
ecoN12 1457038..1458129 CDS 16 364 acyl-CoA
comp 1458146..1458277 ncRNA 46 44 RtT sRNA
comp 1458324..1458408 tac 33
comp 1458442..1458526 tac 159
comp 1458686..1459528 CDS 281 fTHF
ecoN13 comp 1829066..1830322 CDS 307 419 hp-419
1830630..1830706 gtc 4
1830711..1830787 gtc 6
< 1830794..1831177 CDS 128 p-MdtK
ecoN14 comp 1831218..1832474 CDS 307 419 hp-419
1832782..1832858 gtc 4
1832863..1832939 gtc 8
< 1832948..1833280 CDS 111 p-MATE
ecoN15 comp 1833321..1834577 CDS 307 419 hp-419
1834885..1834961 gtc 4
1834966..1835042 gtc 108
1835151..1835456 CDS 102 mono-O2
ecoN16 comp 2115794..2116459 CDS 195 222 UPF0149 YecA
comp 2116655..2116741 tta 12
comp 2116754..2116827 tgc 53
comp 2116881..2116956 ggc 151
comp 2117108..2117656 CDS 183 CDP-diacyl
ecoN17 comp 2191451..2192287 CDS 278 279 hp-279
comp 2192566..2192655 tcg 93
2192749..2193546 CDS 100 266 MtfA
2193647..2193722 aac 161
2193884..2195146 CDS 421 Tyr recb-421
ecoN18 2232607..2233323 CDS 453 239 tr-YebC
comp 2233777..2233852 acc 326
2234179..2235096 CDS 101 306 tr-nitrogen
2235198..2236148 CDS 37 317 tr-Cbl
comp 2236186..2236261 aac 4
2236266..2237909 CDS 100 548 trp-YeeO
2238010..2238085 aac 161
2238247..2239518 CDS 424 Tyr recb 424
ecoN19 2546968..2548728 CDS 74 587 cardiolipine
2548803..2548879 ccc 101
comp 2548981..2549136 CDS 52 barrel
ecoN20 2717780..2718712 CDS 75 311 nitrite
2718788..2718862 agg 437
comp 2719300..2719830 CDS 177 OmpH
ecoN21 comp 2768744..2770933 CDS 206 730 sensor
comp 2771140..2771215 gcc 39
comp 2771255..2771330 gcc 220
2771551..2771910 CDS 120 pu-tr 120
ecoN22 comp 2772355..2773770 CDS 258 472 Glu ligase
2774029..2774104 gta 43
2774148..2774223 gta 46
2774270..2774345 gta 4
2774350..2774425 aaa 110
comp 2774536..2775420 CDS 295 LysR
ecoN23 comp 2959205..2960503 CDS 323 433 glutarate pm
comp 2960827..2960942 5s 83 116
comp 2961026..2965477 23s 184 4452
comp 2965662..2965737 gaa 431
comp 2966169..2967720 16s 441 1552
comp 2968162..2970735 CDS 858 ClpB dep
ecoN24
****atgi*****
ecoN25
comp 3027207..3027773 CDS 280 189 fructose 6
comp 3028054..3028130 cgt 63
comp 3028194..3028270 cgt 62
comp 3028333..3028409 cgt 62
comp 3028472..3028548 cgt 64
comp 3028613..3028689 cgt 3
comp 3028693..3028785 agc 315
comp 3029101..3029286 CDS 62 CsrA
ecoN26 comp 3157337..3158434 CDS 208 366 murein
3158643..3158719 atgf 33
3158753..3158829 atgf 33
3158863..3158939 atgf 635
3159575..3160075 CDS 167 sscs VI
ecoN27 3230172..3231401 CDS 316 410 HAAAP
comp 3231718..3231791 ggg 78
comp 3231870..3232625 CDS 252 glycan DD
ecoN28 3341048..3341755 CDS 105 236 DUF554
3341861..3341936 ttc 197
3342134..3343399 CDS 422 arm-type
ecoN29 comp 3569308..3569814 CDS 124 169 G/U
3569939..3570014 atgi 53
comp 3570068..3570832 CDS 255 ferric
ecoN30 comp 3670227..3670679 CDS 206 151 RimP
comp 3670886..3670962 atgf 347
> 3671310..3672155 CDS 282 p-Arg-sc 282
ecoN31 comp 3673935..3674387 CDS 206 151 RimP
comp 3674594..3674670 atgf 347
> 3675018..3675869 CDS 284 p-Arg-sc 284
ecoN32 comp 3677794..3678246 CDS 206 151 RimP
comp 3678453..3678529 atgf 347
> 3678877..3679722 CDS 282 p-Arg-sc 282
ecoN33 comp 3681532..3681984 CDS 206 151 RimP
comp 3682191..3682267 atgf 347
3682615..3683958 CDS 448 Arg-suc
ecoN34 comp 3683966..3685591 CDS 456 542 Pet
comp 3686048..3686134 ctc 14
comp 3686149..3686481 CDS 111 SecG-p
ecoN35 3784553..3785311 CDS 62 253 pu-ABC
comp 3785374..3785489 5s 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360
3789989..3790543 CDS 185 gc anhydrase
ecoN36 comp 4078635..4080242 CDS 743 536 DppA
comp 4080986..4081062 ccg 91
comp 4081154..4082845 CDS 564 kdo2
ecoN37 comp 4205966..4207348 CDS 292 461 glycoside-p5
4207641..4207735 tga 300
> 4208036..4208857 CDS 274 p-DUF4102
ecoN38 comp 4338643..4339335 CDS 479 231 FadR tr
4339815..4341342 16s 73 1528
4341416..4341491 gaa 184
4341676..4344286 23s 83 2611
4344370..4344485 5s 53 116
4344539..4344615 gac 8
4344624..4344699 tgg 95
comp 4344795..4345634 CDS 280 HdfR HTH
ecoN39 4377681..4379066 CDS 102 462 aa permease
4379169..4379245 cgg 58
4379304..4379379 cac 20
4379400..4379486 ctg 42
4379529..4379605 cca 146
4379752..4380987 CDS 412 ans maturase
ecoN40 4460971..4461516 CDS 377 182 porphyrine M
4461894..4463631 16s 56 1738
4463688..4463764 atc 42
4463807..4463882 gca 165
4464048..4467338 23s 83 3291
4467422..4467537 5s 104 116
comp 4467642..4468169 CDS 176 Mlb pB
ecoN41 4605577..4606434 CDS 374 286 Glu race
4606809..4608362 16s 363 1554
4608726..4608801 gaa 1112
4609914..4610029 5s 136 116
4610166..4611194 CDS 343 UDP-N
ecoN42 comp 4612185..4613135 CDS 361 317 B5 kinase I
4613497..4613572 aca 8
4613581..4613665 tac 116
4613782..4613856 gga 6
4613863..4613938 acc 114
4614053..4615237 CDS 395 tuf
ecoN43 comp 4642984..4644573 CDS 616 530 AICAR2
4645190..4646378 16s’ 83 1189
4646462..4648150 CDS 436 563 kinase isocit
4648587..4648662 gaa 185
4648848..4651319 23s 83 2472
4651403..4651518 5s 76 116
4651595..4651978 CDS 128 hp-128
ecoN44
< comp 4834504..4834961 CDS 197 153 pu-integrase
comp 4835159..4835234 ttc 106
comp 4835341..4835916 CDS 192 tr 192
ecoN45 4864628..4865173 CDS 210 182 oligo-rnase
4865384..4865459 ggc 36
4865496..4865571 ggc 35
4865607..4865682 ggc 233
4865916..4865969 CDS 18 hp-18
ecoN46 comp 4974178..4975197 CDS 195 340 NADPH- Ahr
4975393..4975477 ttg 39
<> comp 4975517..4976055 CDS 180 p-IS630
ecoN47 5042527..5042763 CDS 38 79 DUF1435
comp 5042802..5042888 ctg 34
comp 5042923..5043009 ctg 28
comp 5043038..5043124 ctg 290
comp 5043415..5044446 CDS 344 G1207 RsmC
E13. Clusters ecoN au-delà de eco
ecoN suite sens gènes interca cdsa cds
EcoN 48 comp 5079375..5079581 CDS 117 69 tr AlpA
ok 5079699..5081218 16s 73 1520
5081292..5081368 gaa 12
5081381..5081454 gca 366
5081821..5082018 CDS 524 66 hp-66
comp 5082543..5082754 CDS 71 hp-71
eco1 222833..223408 cds 362 192 D-glycero
223771..225312 16s 68 1542
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93 2904
228756..228875 5s 52 120
228928..229004 gac 162
229167..229970 cds 268 metDkgB
EcoN 56 comp > 5341397..5341492 CDS -2 32 ABC 32
ok comp 5341491..5344303 23s 174 2813
comp 5344478..5344553 gca 42
comp 5344596..5344672 atc 56
comp 5344729..5346282 16s 1063 1554
comp 5347346..5347421 gca 42
comp 5347464..5347540 atc 56
comp 5347597..5349150 16s 365 1554
comp 5349516..5350088 CDS 187 191 D-glycero
> 5350276..5350914 CDS 213 ABC MetN
eco35 eco 3422436..3423194 cds 228 253 pu-YhdZ
comp 3423423..3423542 5s 37 120
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92 120
comp 3423880..3426783 23s 174 2904
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 1542
3429236..3429790 cds 185 protein YrdA
ecoN35 3784553..3785311 CDS 62 253 pu-ABC
comp 3785374..3785489 5s 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360
3789989..3790543 CDS 185 gc anhydrase
EcoN 59 > 5433568..5433687 CDS 39 40 p-Nam
ok comp 5433727..5433814 tcc 253
comp 5434068..5434286 CDS 73 tif IF-1
ecoN
EcoN 53 comp 5321144..5321869 CDS 206 242 p-His kinase
ok comp 5322076..5322151 gcc 39
comp 5322191..5322266 gcc 39
comp 5322306..5322381 gcc 220
5322602..5322961 CDS 120 pu-tr 120
ecoN
EcoN 54 comp 5323406..5324821 CDS 258 472 Glu ligase
ok 5325080..5325155 gta 44
5325200..5325275 gta 0
< 5325276..5325389 CDS 38 p-pu-tr 38
EcoN 51 comp 5252659..5253870 CDS 300 404 Tyr recb 404
ok comp 5254171..5254249 tga 292
> 5254542..5255171 CDS 210 p-glycoside
EcoN 52 > comp 5305902..5306228 CDS 0 109 p-hp
comp 5306229..5306302 atc 1096
ecoN ? 5307399..5308450 CDS 351 p-Ada
EcoN 57 > comp 5359583..5360512 CDS 120 310 Tyr recb 310
comp 5360633..5360708 gca 42
ecoN40 comp 5360751..5360827 atc 56
comp 5360884..5362138 16s’ 1 1255
< comp 5362140..5363543 CDS 468 IS66
EcoN 55 > 5375524..5376270 CDS 891 249 p-AI-2E
5377162..5377237 gaa 1047 eco 435
ecoN ? comp 5378285..5379589 CDS 435 isocitrate
EcoN 49 comp 5090325..5090876 CDS 1808 184 MarR
comp 5092685..5092760 gaa 588
ecoN ? < comp 5093349..5093474 CDS 592 42 sn-glycerol
5094067..5094142 gaa 1472
5095615..5095691 atc 42
5095734..5095809 atc 1130
5096940..5097015 gaa 1145
ok ecoN43 5098161..5098236 gaa 185
5098422..5100893 23s 83 2472
5100977..5101092 5s 76 116
5101169..5101552 CDS 63 128 hp-128
comp 5101616..5102059 CDS 148 transferase
EcoN 50 5124754..5125197 CDS 63 148 transferase
comp 5125261..5125644 CDS 76 128 hp-128
ecoN40 comp 5125721..5125836 5s 83 116
comp 5125920..5128366 23s’ -10 2447
< 5128357..5128479 CDS 41 pilus
EcoN 58 5425965..5426201 CDS 38 79 DUF1435
ok comp 5426240..5426325 ctg 26
comp 5426352..5426438 ctg 28
comp 5426467..5426553 ctg 63
< comp 5426617..5427150 CDS 178 p-IS630

ecoN eco noms cds[modifier | modifier le wikicode]

ecoN eco. Liste des noms longs et courts, et des fonctions
fonction Noms courts Noms longs
tr-regulator XapR DNA-binding transcriptional activator XapR
permease aa permease amino acid permease
ABC bind ABC 32 ABC transporter ATP-binding protein
ABC bind ABC MetN methionine ABC transporter ATP-binding protein MetN
desaturase acyl-CoA acyl-CoA desaturase
adhesin adhes YdhQ adhesin-like autotransporter YdhQ
adhesin adhes YejO adhesin-like autotransporter YejO, gene fragment 2 of yejO, misc_feature
hydrolase AICAR1 bifunctional AICAR transformylase/IMP cyclohydrolase
hydrolase AICAR2 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
amidase Ala C N-acetylmuramoyl-L-alanine amidase C
maturase ans maturase anaerobic sulfatase maturase
synthetase Arg-suc argininosuccinate synthetase
integrase arm-type integrase arm-type DNA-binding domain-containing protein
synthetase Asn B asparagine synthetase B
protease b ATP ClpA ATP-dependent Clp protease ATP-binding subunit ClpA
kinase B5 kinase pantothenate kinase
kinase B5 kinase I type I pantothenate kinase
transporter barrel autotransporter outer membrane beta-barrel domain-containing protein
tr-regulator CadC DNA-binding transcriptional activator CadC
cardiolipin cardiolipine cardiolipin transport protein PbgA
transferase CDP-diacyl CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
division cell CpoB cell division coordinator CpoB
chaperone ClpB ClpB chaperone
chaperone ClpB dep ATP-dependent chaperone ClpB
storage Csr carbon storage regulator
storage CsrA carbon storage regulator CsrA
hydrolase cyclo FolD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
phosphatase D-glycero D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase
ABC bind dip ABC dipeptide ABC transporter periplasmic binding protein
polymerase DNAIIIe DNA polymerase III subunit epsilon
ABC bind DppA dipeptide ABC transporter substrate-binding protein DppA
DUF DUF1435 DUF1435 domain-containing protein
DUF DUF4102 DUF4102 domain-containing protein
DUF DUF4942 DUF4942 domain-containing protein
DUF DUF5507 DUF5507 domain-containing protein YpjC
DUF DUF554 DUF554 domain-containing protein
DUF DUF554 Yqg DUF554 domain-containing protein YqgA
peptidase ErfK L,D-transpeptidase ErfK
exporter exporter FMN/FAD exporter
tr-regulator FadR tr FadR family transcriptional regulator
reductase ferric NADPH-dependent ferric chelate reductase
phosphatase fructose fructose-1-phosphatase
phosphatase fructose 6 fructose-1-phosphate/6-phosphogluconate phosphatase
deformylase fTHF formyltetrahydrofolate deformylase
protase FtsH modulator of FtsH protease
protease FtsH YccA FtsH protease modulator YccA
glycosylase G/U G/U mismatch-specific DNA glycosylase
glycosylase G/U station stationary phase mismatch/uracil DNA glycosylase
transferase G1207 16S rRNA m(2)G1207 methyltransferase
transferase G1207 RsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
anhydrase gc anhydrase gamma carbonic anhydrase family protein
ligase Glu ligase glutamate--tRNA ligase
racemase Glu race glutamate racemase
dehydrogenase glu5dH glutamate-5-semialdehyde dehydrogenase
reductase gluDkgB 2,5-didehydrogluconate reductase DkgB
permease glutarate pm alpha-ketoglutarate permease
symporter glutarate sm alpha-ketoglutarate:H(+) symporter
peptidase glycan DD peptidoglycan DD-metalloendopeptidase family protein
synthetase glycerolP phosphatidylglycerophosphate synthase
transporter glycoside-p5 glycoside-pentoside-hexuronide family transporter
reductase glyoxyl A glyoxylate/hydroxypyruvate reductase A
reductase glyoxyl GhrA glyoxylate/hydroxypyruvate reductase GhrA
permease HAAAP HAAAP family serine/threonine permease
tr-regulator HdfR DNA-binding transcriptional dual regulator HdfR
tr-regulator HdfR HTH HTH-type transcriptional regulator HdfR
hydrogenase Hnase1 hydrogenase 1 small subunit
hp hp-121 hp-121
hp hp-128 hypothetical protein
hp hp-18 hp-18
adhesin Inv-adhesin inverse autotransporter adhesin
transposase IS66 IS66 family transposase
lyase isocitrate isocitrate lyase
transferase kdo2 kdo(2)-lipid A phosphoethanolamine 7-transferase
kinase/Pase kinase isocit bifunctional isocitrate dehydrogenase kinase/phosphatase
prophage KpLE1 CPS-53 (KpLE1) prophage; prophage CPS-53 integrase
lipoprotein lipo YafT lipoprotein YafT
tr-regulator LysR LysR family transcriptional regulator
tr-regulator MarR MarR family transcriptional regulator
reductase metDkgB methylglyoxal reductase DkgB
GDP Mlb adapt molybdopterin-guanine dinucleotide biosynthesis adaptor protein
GDP Mlb pB molybdopterin-guanine dinucleotide biosynthesis protein B
oxygenase mono-O2 monooxygenase
titration Mtf Mlc titration factor
tr-regulator MtfA DgsA anti-repressor MtfA
glycosylase murein murein transglycosylase A
glycosylase murein lytic membrane-bound lytic murein transglycosylase A
reductase NADPH- Ah aldehyde reductase, NADPH-dependent
reductase NADPH- Ahr NADPH-dependent aldehyde reductase Ahr
transporter nitrite formate/nitrite transporter family protein
hydroxylase octaprenyl 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
rnase oligo-rnase oligoribonuclease
protein OmpH OmpH family outer membrane protein
transferase p-Ada pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
transporter p-AI-2E pseudo, AI-2E family transporter
synthetase p-Arg-sc 282 Pseudo, argininosuccinate synthase
synthetase p-Arg-sc 284 Pseudo, argininosuccinate synthase
division p-cell CpoB Pseudo, cell division protein CpoB
DUF p-DUF4102 Pseudo, DUF4102 domain-containing protein
transporter p-glycoside pseudo, glycoside-pentoside-hexuronide family transporter
kinase p-His kinase pseudo, histidine kinase
hp p-hp pseudo, hp 109
integrase p-integrase pseudo, integrase
transposase p-IS4 Pseudo, IS4 family transposase
transposase p-IS630 pseudo, IS630 family transposase
transporter p-MATE Pseudo, MATE family efflux transporter
transporter p-MdtK Pseudo, multidrug efflux MATE transporter MdtK
amidase p-Nam pseudo, nicotinamide-nucleotide amidase
tr-regulator p-pu-tr 38 pseudo, putative DNA-binding transcriptional regulator
protein p-un-YchS putative uncharacterized protein YchS
gene p-yicT p-yicT
transferase Pet phosphoethanolamine transferase
protein pilus pilus assembly protein
dehydrogenase porphyrine M menaquinone-dependent protoporphyrinogen IX dehydrogenase
oxidase porphyrine O protoporphyrinogen oxidase
prophage pp CP4-6 note="cryptic prophage CP4-6" misc_feature
prophage pp CPS-53 cryptic prophage CPS-53, misc_feature
prophage pp DLP12 note="cryptic prophage DLP12" misc_feature
prophage pp PR-Y cryptic prophage PR-Y
protein protein YjjZ protein YjjZ
protein protein YrdA protein YrdA
tr-regulator pu- YfeC putative DNA-binding transcriptional regulator YfeC
ABC bind pu-ABC amino acid ABC transporter ATP-binding protein
exporter pu-arabi putative arabinose exporter
sulfatase pu-AslB putative anaerobic sulfatase maturation enzyme AslB
cardiolipin pu-cardiolip putative cardiolipin transport protein
cytochrome pu-cytochrom putative cytochrome
hydrolase pu-hydrolase putative hydrolase, inner membrane
integrase pu-KpLE2 KpLE2 phage-like element; putative integrase
peptidase pu-LysM LysM domain-containing putative peptidase lipoprotein YgeR
GMP pu-sensor putative c-di-GMP phosphodiesterase PdeA
protein Pu-ssM putative type II secretion system M-type protein
tr-regulator pu-tr 120 putative DNA-binding transcriptional regulator
tr-regulator pu-tr YieP putative transcriptional regulator YieP
tr-regulator pu-tr YjdC putative DNA-binding transcriptional regulator YjdC
tr-regulator pu-tr-YeeN putative transcriptional regulator YeeN
protein pu-unYgaQ putative uncharacterized protein YgaQ
oxygenase pu-YdhR putative monooxygenase YdhR
ABC bind pu-YhdZ putative ABC transporter ATP-binding subunit YhdZ
transporter pu-YicJ putative xyloside transporter YicJ
transporter pu-YifK putative transporter YifK
prophage put DLP12 DLP12 prophage; putative integrase
tr-regulator put FimZ putative LuxR family transcriptional regulator FimZ
synthetase quino quinolinate synthase
synthetase quino NadA quinolinate synthase NadA
ribosome RimP ribosome maturation factor RimP
rpt rpt-29 rpt-29
rpt rpt-34 rpt_type=other
rpt rpt-36 rpt_type=other
rpt rpt71 rpt_type=other 71
sRNA RttR sRNA small RNA RttR
translocase SecE Sec translocon subunit SecE
translocase SecG-p preprotein translocase subunit SecG
translocase SecG-t Sec translocon subunit SecG
esterase sensor sensor domain-containing phosphodiesterase
ABC bind sn-glycerol sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
protein sscs VI type VI secretion system contractile sheath small subunit
protein stress stress response protein
tr-regulator tact Cbl DNA-binding transcriptional activator Cbl
translation tif IF-1 translation initiation factor IF-1
protein tpr protamine-like protein
tr-regulator tr 192 transcriptional regulator
tr-regulator tr AlpA AlpA family transcriptional regulator
tr-regulator tr-Cbl HTH-type transcriptional regulator Cbl
tr-regulator tr-Nac DNA-binding transcriptional dual regulator Nac
tr-regulator tr-nitrogen nitrogen assimilation transcriptional regulator
tr-regulator tr-YebC YebC/PmpR family DNA-binding transcriptional regulator
transferase transferase acetyltransferase
transporter trp-YeeO toxic metabolite efflux MATE transporter YeeO
translation tuf elongation factor Tu
translation tufb tufb, translation elongation factor Tu 2
integrase Tyr recb 207 tyrosine-type recombinase/integrase
integrase Tyr recb 404 tyrosine-type recombinase/integrase
integrase Tyr recb 421 tyrosine-type recombinase/integrase
integrase Tyr recb 424 tyrosine-type recombinase/integrase
reductase UDP-N UDP-N-acetylenolpyruvoylglucosamine reductase
protein un-YcdU uncharacterized protein YcdU
protein un-YjeV uncharacterized protein YjeV
protein UPF0149 YecA UPF0149 family protein YecA
protein YdiA YdiA family protein
protein YfdC inner membrane protein YfdC
protein YgeQ protein YgeQ
gene yjdQ gene="yjdQ"
DUF DUF1435 DUF1435 domain-containing protein
transposase p-IS630 pseudo, IS630-like element IS630 family transposase

Vibrio campbellii[modifier | modifier le wikicode]

vha opérons[modifier | modifier le wikicode]

vha1. Vibrio campbellii ATCC BAA-1116
45.4%GC 26.7.19 Paris 121 doubles interca cds aa avec aa cdsa cdsd
Chromosome I
comp 1..1384 16s @1 103 103
comp 1488..1604 cds 102507 39
104112..105239 cds 529 529 376 529
comp 105769..105845 atg + 158 158
comp 106004..106079 ggc 7 ggc 35 35
comp 106115..106190 ggc 5 atg 35 35
comp 106226..106301 ggc 18 18
comp 106320..106396 atg 39 39
comp 106436..106511 ggc 90 90
comp 106602..106678 atg 39 39
comp 106718..106793 ggc 18 18
comp 106812..106888 atg 39 39
comp 106928..107003 ggc 18 18
comp 107022..107098 atg 39 39
comp 107138..107213 ggc 156 156 156
comp 107370..107915 cds 81764 182
189680..190715 cds 101 101 345 101
comp 190817..190933 5s 107
comp 191041..193955 23s 290
comp 194246..194321 gca 43 43
comp 194365..194441 atc 97
comp 194539..196096 16s @2 371
comp 196468..196584 5s 77
comp 196662..199576 23s 290
comp 199867..199942 gca 43 43
comp 199986..200062 atc 97
comp 200160..201717 16s 853 853 853
comp 202571..204706 cds 29595 712
comp 234302..235486 cds 101 101 395 101
comp 235588..235663 acc 13 13
comp 235677..235751 gga 35 35
comp 235787..235871 tac 52 52
comp 235924..235999 aca 206 206
236206..237129 cds 4144 308
comp 241274..242467 cds 546 546 398 546
comp 243014..243090 tgg 68 68
comp 243159..243235 gac 32
comp 243268..243384 5s 117
comp 243502..246404 23s 310
comp 246715..246790 gta 30 30
comp 246821..246896 aaa 2 2
comp 246899..246974 gaa 122
comp 247097..248654 16s 554 554 554
249209..249664 cds 60596 152
310261..311296 cds 121 121 345 121
comp 311418..311508 tca 91
comp 311600..311716 5s 108
comp 311825..314739 23s 289
comp 315029..315104 gca 43 43
comp 315148..315224 atc 56
comp 315281..316842 16s 471 471 471
comp 317314..318027 cds 40242 238
358270..359305 cds 147 147 345
comp 359453..359529 gac 31
comp 359561..359677 5s 108
comp 359786..362700 23s 310
comp 363011..363086 gta 30 30
comp 363117..363192 aaa 2 2
comp 363195..363270 gaa 82
comp 363353..364914 16s 83 83 83
comp 364998..365133 cds 84252 45
449386..449521 cds 83 83 45 83
449605..451162 16s 122
451285..451360 gaa 2 2
451363..451438 aaa 9 9
451448..451523 gca 37 37
451561..451636 gta 51 51 51
comp 451688..451873 cds 16 16 62 16
451890..454804 23s 77
454882..454998 5s 32
455031..455107 gac 162 162
comp 455270..455533 cds 11718 88
comp 467252..467665 cds 361 361 138
468027..468103 cgg 35 35
468139..468214 cac 76 76
468291..468367 cca 46 46
468414..468489 cac 64 64
468554..468630 cca 194 194 194
comp 468825..469550 cds 365688 242
comp 835239..835550 cds 138 138 104 138
comp 835689..835764 atg 145 145
comp 835910..837772 cds 182191 621
1019964..1020128 cds 119 119 55
1020248..1021805 16s 129
1021935..1022010 gcc 41 41
1022052..1022127 gaa 55 55 55
comp 1022183..1022368 cds 16 16 62 16
1022385..1025299 23s 111
1025411..1025527 5s 31
1025559..1025635 gac 35 35
1025671..1025747 tgg 3 3 3
comp 1025751..1025933 cds 225465 61
1251399..1252574 cds 158 158 392
comp 1252733..1252817 cta + 54 54
comp 1252872..1252946 caa 5 cta 46 46
comp 1252993..1253077 cta 3 atg 21 21
comp 1253099..1253183 cta 2 caa 18 18
comp 1253202..1253278 atg 23 23
comp 1253302..1253386 cta 70 70
comp 1253457..1253533 atg 79 79
comp 1253613..1253687 caa 31 31
comp 1253719..1253803 cta 39 39
comp 1253843..1253919 atg 26 26 26
comp 1253946..1254157 cds 14564 71
comp 1268722..1268862 cds 260 260 47
1269123..1269199 cca 243 243 243
comp 1269443..1269628 cds 16361 62
1285990..1286571 cds 88 88 194
comp 1286660..1286736 agg 68 68 68
comp 1286805..1287938 cds 116753 378
comp 1404692..1405552 cds 204 204 287 204
1405757..1405833 aga 244 244
1406078..1407685 cds 49950 536
1457636..1458508 cds 407 407 291
comp 1458916..1459000 tac + 100 100
comp 1459101..1459185 tac 4 tac 100 100
comp 1459286..1459370 tac @7 100 100
comp 1459471..1459555 tac 282 282 282
1459838..1460935 cds 170368 366
1631304..1631753 cds 144 144 150 144
1631898..1631985 tcc 312 312
1632298..1632684 cds 550413 129
2183098..2183436 cds 179 179 113
2183616..2183692 gtc + 46 46
2183739..2183815 gtc 2 gtc 149 149 149
2183965..2185344 cds 578546 460
comp 2763891..2766782 cds 763 763 964 763
comp 2767546..2767621 ggc + 11 11
comp 2767633..2767719 tta 2 ggc 78 78
comp 2767798..2767873 ggc 37 37
comp 2767911..2767984 tgc 400 400 400
comp 2768385..2768942 cds 82481 186
2851424..2851855 cds 62 62 144 62
2851918..2851992 gga 333 333
2852326..2852970 cds 133282 215
comp 2986253..2986402 cds 1 1 50 1
2986404..2986479 aac 372 372
2986852..2989149 cds 60873 766
3050023..3051831 cds 139 139 603 139
3051971..3052061 tca 321 321
3052383..3053693 cds 384243 437
comp 3437937..3438392 cds 233 233 152
comp 3438626..3438702 atg 56 56
comp 3438759..3438842 ctc 18 18 18
comp 3438861..3439199 cds 113972 113
comp 3553172..3554167 cds 189 189 332 189
comp 3554357..3554433 cgt + 59 59
comp 3554493..3554569 cgt 7 cgt 57 57
comp 3554627..3554703 cgt 2 agc 57 57
comp 3554761..3554837 cgt 57 57
comp 3554895..3554971 cgt 57 57
comp 3555029..3555105 cgt 85 85
comp 3555191..3555282 agc 29 29
comp 3555312..3555388 cgt 31 31
comp 3555420..3555511 agc 243 243
comp 3555755..3555952 cds 83212 66
3639165..3640295 cds 108 108 377 108
3640404..3640479 ttc + 51 51
3640531..3640606 aca 3 ttc 7 7
3640614..3640689 ttc 2 aca 43 43
3640733..3640808 aac 2 aac 69 69
3640878..3640953 aca 10 10
3640964..3641039 ttc 42 42
3641082..3641158 aac 292 292
3641451..3643076 cds 233 233 542
3643310..3643385 ttc 51 51
3643437..3643512 aca + 21 21
3643534..3643609 aac 2 aca 39 39
3643649..3643724 aca 2 aac 15 15
3643740..3643815 aac 156 156 156
comp 3643972..3645405 cds 561 561 478 561
comp 3645967..3646043 gac 31
comp 3646075..3646191 5s 57
comp 3646249..3646324 acc 100
comp 3646425..3646541 5s 111
comp 3646653..3649567 23s -13 -13 -13
comp 3649555..3649797 cds @3 35 35 81 35
comp 3649833..3649908 gca 43 43
comp 3649952..3650028 atc 97
comp 3650126..3651683 16s 557 557 557
comp 3652241..3653491 cds 9514 417
comp 3663006..3663598 cds 181 181 198
comp 3663780..3663864 ttg 177 177 177
comp 3664042..3664707 cds 93515 222
3758223..3759258 cds 578 578 345 578
comp 3759837..3759913 gac 68
comp 3759982..3760098 5s 111
comp 3760210..3763124 23s 290
comp 3763415..3763490 gca 43 43
comp 3763534..3763610 atc 97
comp 3763708..3765265 16s 86
comp 3765351 16s début
Chromosome II
comp 673782..674186 cds 358 358 135
comp 674545..674635 tca 329 329 329
674965..675645 cds 205537 227
881183..882640 cds 244 244 486 244
882885..882958 tgc 302 302
883261..883725 cds 1229 155
884955..886649 cds 245 245 565 245
886895..886981 tta 97 97
887079..887154 ggc 5 5
887160..887233 tgc 317 317
887551..889074 cds 465 508
comp 889540..890328 cds 386 386 263
890715..890801 tta + 53 53
890855..890928 tgc 2 tgc 181 181
891110..891183 tgc 366 366 366
891550..891891 cds 443950 114
1335842..1336042 cds 17 17 17
1336060..1336134 gga 272 272
comp 1336407..1337222 cds 505333 272
1842556..1842741 cds -36 -36 62 -36
1842706..1842789 ctc 29 29 29
1842819..1843430 cds 77699 204
1921130..1921561 cds 62 62 144 62
1921624..1921698 gga 337 337
comp 1922036..1922209 cds 15660 58
comp 1937870..1939129 cds 84 84 420
comp 1939214..1939304 tca 90
comp 1939395..1939511 5s 77
comp 1939589..1942503 23s 306
comp 1942810..1942885 gta 35 35
comp 1942921..1942996 gca 24 24
comp 1943021..1943096 aaa 2 2
comp 1943099..1943174 gaa 114
comp 1943289..1944850 16s 83 83 83
comp 1944934..1945071 cds 46

vha cumuls[modifier | modifier le wikicode]

cumuls. Vibrio campbellii ATCC BAA-1116
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 11 1 0 0 1 3 1 1 100 17
16 aas 23 5s 3 20 10 5 50 8 20 5 200 17
16 atc gca 4 40 17 6 100 10 40 3 300 10
16 cds 23 5s 3 60 16 6 150 12 60 2 400 13
max a 5 80 6 1 200 9 80 3 500 6
a doubles 0 100 6 0 250 9 100 3 600 4
spéciaux 1 120 0 0 300 4 120 3 700 2
total aas 37 140 0 0 350 7 140 3 800 2
sans opérons 27 160 1 0 400 6 160 4 900 0
1 aa 14 180 0 0 450 1 180 1 1000 1
max a 12 200 1 0 500 1 200 2 1100 0
a doubles 10 0 0 8 8 0
total aas 84 57 18 78 38 72
total aas 121
remarques 3
avec jaune moyenne 30 266
variance 19 199
sans jaune moyenne 46 183 86 240
variance 25 114 59 178

vha blocs[modifier | modifier le wikicode]

vha1. Vibrio campbellii ATCC BAA-1116, blocs à rRNA.
cds 103
cds 853 cds 471 16s 86
16s 97 16s 56 16s 97
atc 43 atc 43 atc 43
gca 290 gca 289 gca 290
23s 77 23s 108 23s 111
5s 371 5s 91 5s 68
16s 97 tca gac
atc 43
gca 290
23s 107
5s 101
cds
cds 554 cds 83 cds 119 cds 557
16s 122 16s 82 16s 129 16s 97
gaa 2 gaa 2 gcc 41 atc 43
aaa 30 aaa 30 gaa 55 gca 35
gta 310 gta 310 cds 16 cds -13
23s 117 23s 108 23s 111 23s 111
5s 32 5s 31 5s 31 5s 100
gac gac gac acc 57
5s 31
gac
cds 83 cds 83
16s 114 16s 122
gaa 2 gaa 2
aaa 24 aaa 9
gca 35 gca 37
gta 306 gta 51
23s 77 cds 16
5s 90 23s 77
tca 5s 32
gac

vha remarques[modifier | modifier le wikicode]

  • A faire, en comparaison avec vpb

Aeromonas media WS[modifier | modifier le wikicode]

amed opérons[modifier | modifier le wikicode]

amed1. Aeromonas media WS
61.2%GC 25.7.19 Paris 126 doubles interca cds aa avec aa cdsa cdsd
6590..7159 cds 3 190
comp 7163..8359 cds 512 512 399
8872..10421 16s 66
10488..10564 atc 10 10
10575..10650 gca 231
10882..13800 23s 98
13899..14013 5s 386 386 386
14400..14717 cds 102422 106
117140..117850 cds 47 47 237 47
117898..117973 ttc 52 52
118026..118101 aca 3 3
118105..118180 ttc 45 45
118226..118301 aac 252 252
118554..119573 cds 50489 340
comp 170063..170329 cds 103 103 89 103
comp 170433..170518 ctg + 71 71
comp 170590..170675 ctg 5 ctg 46 46
comp 170722..170807 ctg 46 46
comp 170854..170939 ctg 51 51
comp 170991..171076 ctg 116 116
comp 171193..172653 cds 146173 487
318827..320692 cds 190 190 622 190
320883..320959 atgi 244 244
comp 321204..323780 cds 62601 859
386382..386732 cds 514 514 117
387247..388802 16s 268
389071..389146 gaa 245
389392..392312 23s 104
392417..392531 5s 268 268 268
comp 392800..394413 cds 81847 538
476261..476482 cds 64 64 74 64
comp 476547..476622 aac 5 5
comp 476628..476703 ttc 622 622
477326..477547 cds 22721 74
500269..500814 cds 177 177 182 177
500992..501067 ggc + 24 24
501092..501167 ggc 6 ggc 29 29
501197..501272 ggc 38 38
501311..501386 ggc 25 25
501412..501487 ggc 23 23
501511..501586 ggc 363 363
comp 501950..502159 cds 4810 70
506970..507110 cds 236 236 47 236
507347..507422 gcc + 28 28
507451..507526 gcc 5 gcc 66 66
507593..507668 gcc 58 58
507727..507802 gcc 40 40
507843..507918 gcc 471 471
508390..508473 riboswitch @1 134002 28
642476..642802 cds 9 9 109 9
642812..642896 ctc 91 91
642988..643064 atgf 166 166
643231..643689 cds 128528 153
772218..774050 cds 195 195 611 195
comp 774246..774329 cta + 8 8
comp 774338..774414 atg 3 atg 38 38
comp 774453..774527 caa 4 caa 47 47
comp 774575..774649 caa 17 17
comp 774667..774743 atg 35 35
comp 774779..774853 caa 47 47
comp 774901..774975 caa 13 13
comp 774989..775065 atg 235 235
comp 775301..776392 cds 3148 364
comp 779541..780557 cds 104 104 339 104
comp 780662..780736 caa -21 -21 -21
comp 780716..781612 cds 373301 299
comp 1154914..1155384 cds 131 131 157 131
comp 1155516..1155592 ccc 226 226
comp 1155819..1157162 cds 67691 448
comp 1224854..1226290 cds 301 301 479
comp 1226592..1226667 aac 2 2
comp 1226670..1226744 gga 164 164 164
comp 1226909..1227181 cds 13604 91
comp 1240786..1241733 cds 350 350 316
comp 1242084..1242156 aac + 2 2
comp 1242159..1242234 aac 2 aac 49 49 49
1242284..1242496 cds 294 71
1242791..1244527 cds 181 181 579 181
1244709..1244796 tcc 407 407
1245204..1246064 cds 161293 287
comp 1407358..1408338 cds 410 410 327
comp 1408749..1408836 tcc 177 177 177
comp 1409014..1409631 cds 34595 206
1444227..1444688 cds 146 146 154
1444835..1444922 tcc 127 127 127
1445050..1446834 cds 14349 595
comp 1461184..1462401 cds 163 163 406 163
comp 1462565..1462640 cac 124 124
comp 1462765..1462838 aga 240 240
comp 1463079..1464389 cds 61984 437
comp 1526374..1527606 cds 151 151 411 151
comp 1527758..1527833 cac 123 123
comp 1527957..1528033 aga 36 36
comp 1528070..1528146 cca 203 203
1528350..1529207 cds 60230 286
1589438..1589644 cds 138 138 69
comp 1589783..1589858 aac 132 132 132
1589991..1592003 cds 57434 671
1649438..1651867 cds 104 104 810 104
comp 1651972..1652048 gtc + 36 36
comp 1652085..1652161 gtc 5 gtc 26 26
comp 1652188..1652264 gtc 15 15
comp 1652280..1652356 gtc 11 11
comp 1652368..1652444 gtc 170 170
comp 1652615..1653994 cds 277443 460
comp 1931438..1932934 cds 145 145 499 145
comp 1933080..1933156 atgf + 110 110
comp 1933267..1933343 atgf 9 atgf 102 102
comp 1933446..1933522 atgf @2 101 101
comp 1933624..1933700 atgf 101 101
comp 1933802..1933877 atgf 103 103
comp 1933981..1934057 atgf 102 102
comp 1934160..1934236 atgf 102 102
comp 1934339..1934415 atgf 92 92
comp 1934508..1934584 atgf 268 268
comp 1934853..1935572 cds 490897 240
comp 2426470..2427675 cds 350 350 402
comp 2428026..2428112 tta 40 40
comp 2428153..2428226 tgc 35 35
comp 2428262..2428337 ggc 181 181 181
comp 2428519..2429073 cds 117921 185
comp 2546995..2547534 cds 271 271 180 271
2547806..2547882 ccc 1103 1103
2548986..2550593 cds 107760 536
2658354..2659094 cds 87 87 247 87
2659182..2659257 acg 108 108
< comp 2659366..2659705 cds 198821 113
comp 2858527..2859036 cds 126 126 170
2859163..2859247 tac + 30 30
2859278..2859362 tac 2 tac 121 121 121
comp 2859484..2863335 cds 115303 1284
2978639..2979358 cds 119 119 240 119
comp 2979478..2979552 gga 104 104
comp 2979657..2979730 ggg 201 201
2979932..2981701 cds 41492 590
3023194..3023487 cds 75 75 98 75
comp 3023563..3023636 tgc 57 57
comp 3023694..3023769 ggc 248 248
3024018..3027455 cds 17375 1146
3044831..3045361 cds 133 133 177 133
comp 3045495..3045584 tcg 380 380
3045965..3046882 cds 221147 306
comp 3268030..3268398 cds 318 318 123
comp 3268717..3268804 tca 198 198 198
3269003..3269752 cds 20717 250
3290470..3291624 cds 50 50 385 50
3291675..3291751 agg 126 126
comp 3291878..3292804 cds 41865 309
3334670..3335758 cds 230 230 363
3335989..3336073 tac + 32 32
3336106..3336190 tac 3 tac 45 45
3336236..3336320 tac 135 135 135
3336456..3336731 cds 169091 92
comp 3505823..3506272 cds 275 275 150 275
comp 3506548..3506662 5s 101
comp 3506764..3509682 23s 229
comp 3509912..3509987 gaa 218
comp 3510206..3511760 16s 592 592
3512353..3515220 cds 161083 956
comp 3676304..3677323 cds 113 113 340
comp 3677437..3677521 ttg 49 49 49
3677571..3678182 cds 9862 204
3688045..3688872 cds 369 369 276
comp 3689242..3689318 cgt + 25 25
comp 3689344..3689420 cgt 5 cgt 25 25
comp 3689446..3689522 cgt 26 26
comp 3689549..3689625 cgt 98 98
comp 3689724..3689800 cgt 4 4
comp 3689805..3689897 agc 213 213 213
comp 3690111..3690299 cds 196546 63
3886846..3887601 cds 302 302 252 302
comp 3887904..3887980 gac 98
comp 3888079..3888193 5s 105
comp 3888299..3891217 23s 231
comp 3891449..3891524 gca 10 10
comp 3891535..3891611 atc 66
comp 3891678..3893232 16s 420 420
comp 3893653..3894195 cds 18750 181
comp 3912946..3913317 cds 60 60 124
comp 3913378..3913454 tgg 52 52 52
comp 3913507..3914691 cds @3 171 171 395 171
comp 3914863..3914937 gga 38 38
comp 3914976..3915060 tac 263 263
3915324..3916262 cds 45900 313
comp 3962163..3963533 cds 306 306 457
comp 3963840..3963916 tgg 202 202 202
3964119..3964703 cds 59641 195
comp 4024345..4026816 cds 658 658 824
comp 4027475..4027551 ccg 140 140 140
comp 4027692..4028417 cds 80995 242
4109413..4111986 cds 99 99 858
comp 4112086..4112200 5s 101
comp 4112302..4115220 23s 231
comp 4115452..4115527 gaa 192
comp 4115720..4117273 16s 94 94 94
comp 4117368..4117547 cds 32227 60
comp 4149775..4150248 cds 204 204 158 204
comp 4150453..4150529 cca 58 58
comp 4150588..4150673 ctg 20 20
comp 4150694..4150769 cac 49 49
comp 4150819..4150895 cgg 258 258
4151154..4151744 cds 74862 197
4226607..4227725 cds 428 428 373
4228154..4229708 16s 192
4229901..4229976 gaa 229
4230206..4233124 23s 104
4233229..4233343 5s 106
4233450..4233525 acc 23
4233549..4233663 5s 164 164 164
4233828..4234793 cds 119351 322
comp 4354145..4355686 cds 622 622 514
4356309..4357863 16s 268
4358132..4358207 gaa 230
4358438..4361364 23s 102
4361467..4361581 5s 106
4361688..4361763 acc 233 233 233
4361997..4363241 cds 71363 415
4434605..4435198 cds 465 465 198
4435664..4437217 16s 219
4437437..4437512 gaa 229
4437742..4440657 23s 103
4440761..4440875 5s 98
4440974..4441050 gac 167 167 167
4441218..4442054 cds 39919 279
comp 4481974..4482513 cds 477 477 180
4482991..4484545 16s 513
4485059..4485549 23s° 37
comp 4485587..4486115 23s° 229
comp 4486345..4486419 gaa 218
comp 4486638..4488193 16s 94 94 94
comp 4488288..4488509 cds 72132 74
comp 4560642..4561676 cds 192 192 345
comp 4561869..4561944 gta + 18 18
comp 4561963..4562038 aaa 7 gta 34 34
comp 4562073..4562148 gta 5 aaa 18 18
comp 4562167..4562242 aaa 2 aag 23 23
comp 4562266..4562341 gta 18 18
comp 4562360..4562435 aaa 23 23
comp 4562459..4562534 gta 18 18
comp 4562553..4562628 aaa 34 34
comp 4562663..4562738 gta 22 22
comp 4562761..4562836 aag 46 46
comp 4562883..4562958 gta 22 22
comp 4562981..4563056 aag 46 46
comp 4563103..4563178 gta 32 32
comp 4563211..4563286 aaa 174 174 174
comp 4563461..4564276 cds 70895 272
comp 4635172..4636173 cds 275 275 334 275
comp 4636449..4636525 gac 95
comp 4636621..4636735 5s 101
comp 4636837..4639756 23s 231
comp 4639988..4640063 gca 10 10
comp 4640074..4640150 atc 66
comp 4640217..4641771 16s 512 512
4642284..4643480 cds 3 399
comp 4643484..4644053 cds 190

amed cumuls[modifier | modifier le wikicode]

cumuls. Aeromonas media WS
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 10 1 0 - 1 1 40 1 100 14
16 gaa 23 5s 6 20 15 50 5 60 5 200 21
16 atc gca 3 40 27 100 8 80 2 300 15
16 23 5s 0 60 14 150 19 100 3 400 18
max a 3 80 2 200 17 120 4 500 11
a doubles 0 100 3 250 13 140 7 600 6
spéciaux 1 120 8 300 8 160 2 700 3
total aas 17 140 2 350 6 180 8 800 0
sans opérons 38 160 0 400 4 200 5 900 4
1 aa 16 180 0 450 4 220 3 1000 1
max a 14 200 0 500 3 240 2 1100 0
a doubles 12 0 8 6 2
total aas 109 71 0 96 48 95
total aas 126
remarques 3
avec jaune moyenne 49 156
variance 34 77
sans jaune moyenne 214 274
variance 122 157

amed blocs[modifier | modifier le wikicode]

A1. Aeromonas media WS, blocs à rRNA.
cds 512 cds 302 cds 275
16s 66 gac 98 gac 95
atc 10 5s 105 5s 101
gca 231 23s 231 23s 231
23s 98 gca 10 gca 10
5s 386 atc 66 atc 66
16s 420 16s 512
cds 514 275 99
16s 268 101 101
gaa 245 229 231
23s 104 218 192
5s 268 592 94
cds 428 cds 622 cds 465
16s 192 16s 268 16s 219
gaa 229 gaa 230 gaa 229
23s 104 23s 102 23s 103
5s 106 5s 106 5s 98
acc 23 acc 233 gac 167
5s 164

amed remarques[modifier | modifier le wikicode]

  • A faire