Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/gamma

Une page de Wikiversité.
Aller à la navigation Aller à la recherche
gamma
Image logo représentative de la faculté
Annexe 1
Recherche : Les clusters de gènes tRNA et rRNA chez les procaryotes
Précédent :Sommaire
Suivant :alpha
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Annexe : gamma
Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/gamma
», n'a pu être restituée correctement ci-dessus.



Shewanella[modifier | modifier le wikicode]

spl opérons[modifier | modifier le wikicode]

S1. Shewanella pealeana
39.1%GC 30.6.19 Paris  147  doubles interca
45136..46685 16s @1 339
47025..49946 23s 112
50059..50174 5s
51490..53039 16s 339
53379..56298 23s 114
56413..56528 5s
182271..183820 16s @2 71
183892..183968 atc 65
184034..184109 gca 364
184474..187395 23s 112
187508..187623 5s 100
187724..187800 gac
191614..191689 aca 8
191698..191782 tac 35
191818..191891 gga
235182..236731 16s 374
237106..240025 23s 114
240140..240255 5s
243631..245180 16s 338
245519..248440 23s 113
248554..248669 5s 68
248738..248813 acc 17
248831..248946 5s
416766..416842 cgg 39
416882..416957 cac 41
416999..417075 cca + 58
417134..417210 cca 2 cca
493711..495260 16s 339
495600..498519 23s 114
498634..498749 5s
641376..641466 tca @3 1172
642639..642729 tca
645847..647396 16s 71
647468..647544 atc 65
647610..647685 gca 329
648015..650937 23s 156
651094..651209 5s
728115..728199 ttg
comp 1168942..1169018 atgi
comp 1339706..1339781 aca + 52
comp 1339834..1339909 ttc 2 ttc 539
comp 1340449..1340524 aca 2 aca 52
comp 1340577..1340652 ttc
comp 1342467..1342542 aca 52
comp 1342595..1342670 ttc
1456724..1456815 agc 21
1456837..1456913 cgt + 30
1456944..1457020 cgt 7 cgt 32
1457053..1457129 cgt 3 agc 30
1457160..1457236 cgt 33
1457270..1457346 cgt 9
1457356..1457447 agc 76
1457524..1457600 cgt 35
1457636..1457712 cgt 9
1457722..1457813 agc
comp 1627363..1627438 agg
comp 1770483..1770558 gta + 37
comp 1770596..1770671 gta 11 gta 37
comp 1770709..1770784 gta 37
comp 1770822..1770897 gta 37
comp 1770935..1771010 gta 37
comp 1771048..1771123 gta 37
comp 1771161..1771236 gta 37
comp 1771274..1771349 gta 37
comp 1771387..1771462 gta 37
comp 1771500..1771575 gta 39
comp 1771615..1771690 gta
1773910..1773985 gcc + 80
1774066..1774141 gaa 13 gaa 102
1774244..1774319 gaa 2 gcc 102
1774422..1774497 gaa 102
1774600..1774675 gaa 102
1774778..1774853 gaa 102
1774956..1775031 gaa 102
1775134..1775209 gaa 102
1775312..1775387 gaa 253
1775641..1775716 gaa 102
1775819..1775894 gaa 102
1775997..1776072 gaa 102
1776175..1776250 gaa 102
1776353..1776428 gaa 47
1776476..1776551 gcc
2081297..2082846 16s 338
2083185..2086104 23s 114
2086219..2086334 5s
comp 2143274..2143350 ccc
comp 2366164..2366240 atgf + 40
comp 2366281..2366357 atgf 4 atgf 40
comp 2366398..2366474 atgf 40
comp 2366515..2366591 atgf
2376218..2376308 tca
2379767..2379842 ggc 13
2379856..2379929 tgc 85
2380015..2380100 tta
2550857..2550932 ggc 13
2550946..2551019 tgc + 95
2551115..2551200 tta 3 tgc 634
2551835..2551908 tgc 3 tta 95
2552004..2552089 tta 479
2552569..2552642 tgc 132
2552775..2552860 tta
2558019..2558109 tca
comp 2717566..2717655 tcc
comp 2759730..2759806 atgf + 189
comp 2759996..2760072 atgf 4 atgf 45
comp 2760118..2760194 gtc 2 gtc 2
comp 2760197..2760273 atgf 35
comp 2760309..2760385 gtc 13
comp 2760399..2760475 atgf
2858823..2858907 tac + 30
2858938..2859022 tac 5 tac 85
2859108..2859192 tac 107
2859300..2859384 tac 107
2859492..2859576 tac
2866268..2866343 aac + 45
2866389..2866464 aac 7aac 41
2866506..2866581 aac 26
2866608..2866683 aac 32
2866716..2866791 aac 33
2866825..2866900 aac 40
2866941..2867016 aac
comp 2929429..2929505 gac + 97
comp 2929603..2929679 gac 4 gac 97
comp 2929777..2929853 gac 83
comp 2929937..2930013 gac
comp 3120289..3120364 aaa + 58
comp 3120423..3120498 aaa 12 aaa 58
comp 3120557..3120632 aaa 58
comp 3120691..3120766 aaa 59
comp 3120826..3120901 aaa 57
comp 3120959..3121034 aaa 58
comp 3121093..3121168 aaa 58
comp 3121227..3121302 aaa 59
comp 3121362..3121437 aaa 58
comp 3121496..3121571 aaa 59
comp 3121631..3121706 aaa 59
comp 3121766..3121841 aaa
comp 3269860..3269935 cac 8
comp 3269944..3270020 aga 63
comp 3270084..3270160 cca
comp 3757983..3758059 atgf
comp 3758163..3758249 ctc
comp 3835257..3835331 caa + 51
comp 3835383..3835467 cta 5 caa 131
comp 3835599..3835673 caa 5 cta 20
comp 3835694..3835778 cta 3 atg 96
comp 3835875..3835949 caa 49
comp 3835999..3836083 cta 211
comp 3836295..3836371 atg 5
comp 3836377..3836451 caa 47
comp 3836499..3836583 cta 55
comp 3836639..3836715 atg 5
comp 3836721..3836795 caa 47
comp 3836843..3836927 cta 55
comp 3836983..3837059 atg
comp 3862885..3862961 tgg + 167
comp 3863129..3863205 tgg 2 tgg
comp 3867049..3867164 5s 114
comp 3867279..3870198 23s 338
comp 3870537..3872086 16s
3882154..3882229 ttc
comp 4331488..4331563 ggc + 130
comp 4331694..4331769 ggc 6 ggc 47
comp 4331817..4331892 ggc 162
comp 4332055..4332130 ggc 16
comp 4332147..4332222 ggc 48
comp 4332271..4332346 ggc
comp 4616881..4616996 5s 112
comp 4617109..4620030 23s 364
comp 4620395..4620470 gca 65
comp 4620536..4620612 atc 71
comp 4620684..4622233 16s
comp 5129770..5129846 gac 100
comp 5129947..5130062 5s 115
comp 5130178..5133097 23s 339
comp 5133437..5134986 16s

spl cumuls[modifier | modifier le wikicode]

  • Lien tableur: spl cumuls
  • Note:
    - Moyenne et variance pour les intercalaires entre aas sans rRNAs inférieurs à 81, respectivement 39 et 14.
cumuls. Shewanella pealeana
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 11 1 0 1 1 100
16 23 5s 0 6 20 12 50 20 200
16 atc gca 3 40 27 100 40 300
16 23 5s a 2 60 28 150 60 400
max a 3 80 3 200 80 500
a doubles 0 100 8 250 100 600
spéciaux 0 120 13 300 120 700
total aas 9 140 3 350 140 800
sans opérons 29 160 0 400 160 900
1 aa 8 180 2 450 180 1000
max a 15 200 1 500 200 1100
a doubles 15 6
total aas 133 103 0 0 0 0
total aas 142
remarques 3
avec jaune moyenne 88
variance 143
sans jaune moyenne 58
variance 35

spl blocs[modifier | modifier le wikicode]

S1. Shewanella pealeana, blocs à rRNA.
16s 339 339 374 339 338 338
23s 112 114 114 114 114 114
5s
16s 71 71 71 16s 338 16s 339
atc 65 65 65 23s 113 23s 115
gca 364 329 364 5s 68 5s 100
23s 112 156 112 acc 17 gac
5s 100 5s
gac

spl remarques[modifier | modifier le wikicode]

  • Remarques :
    1. @1   8 blocs 16-23-5s. Ils ont tous les mêmes intercalaires, 338 113 68.
        - 6 blocs sont solo avec un dont l'intercalaire 16s-23s fait 11% de plus que le reste, 36/338.
        - 2 blocs avec 1 aa dont un possède en plus un 5s, gac et acc-5s.
    2. @2   Les 2 blocs 16-atc-gca ont les mêmes intercalaires, 71 65 364 112. L’intercalaire 23s-5s est le même que les 6 autres blocs.
        - Les 2 blocs n'ont que 5 aas, soit pour les 8 opérons à rRNA 7 aas au total. Ce qui est quasiment nul.
    3. @3   Les intercalaires élevés ne touchent que 3 opérons sans rRNAs
				
	-		anciens	-		nouveaux	-
	intercalires	n aas	doubles		nv doubles	nv opérons
	1172		2	2			0	2
	539		4	2,2			0	2
	634, 479	6	3,3			0	3
					
	résultats	ancien 	nouveau		
	total opérons	29	33		
	1 aa		8	10		
	max aa		15	15		
	doubles		15	12		
  • Séquences des doubles : Les intercalaires excessives ne changent pas fondamentalement le spectre des doubles et leurs séquences. Ainsi les répétitions suivantes sont caractéristiques de ce génome.
    - opéron à 13 gaa avec 11 intercalalires identiques de 102 bases, soit 11 répétitions d’une séquence de 180 bases environ, longueur de gaa+102.
    - Les répétitions de séquences sont nombreuses. La plus longue est celle de l’opéron à 5 cta 5 caa 3 atg. Ce sont 5 séquences caa-cta avec un intercalaire de 50 interrompues par 2 atg et 2 intercalaires de 100 bases environ.
    - Les 2 autres opérons à séquences répétées sont, 4atgf 2gtc (2*(2atgf-gtc)) et 6 ggc (avec 2 ggc-ggc séparées par des intercalaires longs).
    - Répétitions du même codon avec son intercalaire comme pour le cas de l'opéron à 15 codons,
				
	codon	répétition	intercalaire		
	gaa	13		102		
	gta	11		37		
	tac	5		100		
	aac	7		35		
	gac	4		97		
	aaa	12		58		
	atgf	4		40		

spl distribution[modifier | modifier le wikicode]

  • Lien tableur: spl distribution
  • Notes:
    - gta11 tca2 cca2 tac5 aac7 gac4 aaa12 gaa13 atgf4+2 cgt5+2 ggc8 tgg2
    - tca: tca2, 2 1aa
    - gac: 2 5s, gac4
    - Séquences:
    (aca ttc)2
    (tgc tta)3
    (atf gtc)2
    (caa cta atgj)3 ou (caa cta)5
Gm1 spl, Shewanella pealeana. gama
g1    t1       
atgi 1 tct tat atgf 9
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 4 tcc 1 tac 6 tgc 4
atc 3 acc 1 aac 7 agc 3
ctc 1 ccc 1 cac 2 cgt 7
gtc 2 gcc 2 gac 6 ggc 8
tta 4 tca 4 taa tga
ata aca 4 aaa 12 aga 1
cta 5 cca 3 caa 5 cga
gta 11 gca 3 gaa 13 gga 1
ttg 1 tcg tag tgg 2
atgj 3 acg aag agg 1
ctg ccg cag cgg 1
gtg gcg gag ggg
gama >1aa =1aa -5s +5s -16s +16s total
spl 125 8 3 6 140

spl intercalaires entre cds[modifier | modifier le wikicode]

  • Lien NCBI [3]
  • Note: Pour les génomes des annexes j'ai relevé les intercalaires entre tRNAs et entre ceux-ci et les cds qui leur sont adjacents. L'exemple est celui de rru du clade alpha. L'idée de départ de ces prélèvements est la recherche d'opérons formés de tRNA et de protéine comme dans le cas d'E.coli: l'intercalaire entre le tRNA et la protéine devrait être faible. Voir l'exemple d'eco (remarque @3) avec tac-tac-tpr et aca-tac-gga-acc-tufB.

spl les fréquences[modifier | modifier le wikicode]

  • Lien tableur: spl intercalaires entre cds
  • Légende:   long, longueur en pbs,   intercal pour intercalaire
    - fréquence-1 1 5 6 f, respectivement fréquence des intercalaires négatives à l'unité, positives à l'unité, par blocs de 5, par blocs de 10 jusqu'à 600 pbs et f pour finales. Ces fréquences servent à faire les diagrammes. La fréquence fréquencez est l'étendue à 1200 de la fréquence6 pour certains grands génomes.
    - cumul,% colonne à la droite de frequence6, reprend les fréquences par plages et leurs pourcentages indiqués déjà dans la 1ère partie du tableau.
    - La couleur cyan des fréquences fréquence-1 et 1 sert à montrer leur périodicité ternaire.
    - intercaln intercalx, pour les intercalaires négatifs minimaux et intercalaires positifs maximaux.
    - colonne ADN pour la longueur totale du génome en pbs et intercals pour le total en pbs des intercalaires entre cds uniquement, d'après la méthode des prélèvements de NCBI du 24.9.20.
spl Les fréquences des intercalaires entre cds
spl intercalaires total % intercalaires moyenne ecartype plage ADN intercal frequence5 intercal fréquencez
négatif 426 10.1 négatif -7 10 -1 à -98 5 174 581 -1 426 610 5
zéro 18 0.4 intercals 0 18 620 10
1 à 200 2448 58.1 0 à 200 82 58 730 981 5 168 630 7
201 à 370 776 18.4 201 à 370 274 48 14.1% 10 124 640 6
371 à 600 378 9.0 371 à 600 462 62 15 138 650 6
601 à max 167 4.0 601 à 1028 849 331 20 74 660 6
total 4213 <201 68.6 total 4213 173 207 -98 à 3180 25 69 670 7
adresse intercalx intercal fréquence1 intercal fréquence6 cumul,% intercal fréquence-1 30 64 680 6
3787762 3180 -1 426 -70 2 0 18 35 68 690 3
2676990 2727 0 18 -60 0 -1 126 40 47 700 5
4795292 1942 1 46 -50 4 -2 2 45 49 710 6
3628609 1722 2 53 -40 2 -3 0 50 42 720 6
1384243 1674 3 30 -30 5 min à -1 -4 141 55 52 730 2
5168395 1593 4 22 -20 16 426 -5 0 60 67 740 7
1692692 1489 5 17 -10 70 10.1% -6 0 65 56 750 4
4989087 1401 6 15 0 345 -7 10 70 66 760 1
5017524 1331 7 16 10 292 -8 48 75 77 770 3
1530827 1329 8 30 20 212 -9 0 80 91 780 3
4000859 1318 9 30 30 133 -10 8 85 67 790 4
1999942 1254 10 33 40 115 1 à 100 -11 28 90 78 800 4
1605218 1225 11 29 50 91 1561 -12 0 95 65 810 2
897237 1221 12 36 60 119 37.1% -13 5 100 81 820 3
1570703 1178 13 23 70 122 -14 15 105 41 830 1
4927424 1166 14 30 80 168 -15 1 110 61 840 3
1817514 1161 15 20 90 145 -16 3 115 52 850 2
3532660 1157 16 10 100 146 -17 9 120 75 860 1
1716642 1154 17 16 110 102 -18 0 125 64 870 4
1413389 1150 18 22 120 127 -19 1 130 64 880 2
2276940 1141 19 15 130 128 -20 7 135 37 890 3
600202 1140 20 11 140 82 -21 0 140 45 900 1
1996502 1103 21 14 150 78 -22 0 145 45 910 2
3325479 1046 22 13 160 82 -23 4 150 33 920 2
223647 1016 23 13 170 80 1 à 200 -24 0 155 43 930 1
3589524 1016 24 23 180 89 2448 -25 0 160 39 940 3
967539 1009 25 6 190 67 58.1% -26 2 165 42 950 3
4112640 1007 26 9 200 70 -27 0 170 38 960 3
4903734 975 27 23 210 61 -28 1 175 45 970 1
3472661 968 28 9 220 64 -29 2 180 44 980 1
750412 959 29 12 230 58 -30 0 185 34 990 0
2804938 959 30 11 240 59 -31 0 190 33 1000 0
2670476 957 31 20 250 48 -32 3 195 35 1010 2
2620635 946 32 13 260 52 434 200 35 1020 2
2967190 944 33 11 270 54 reste 10 205 33 1030 0
4243039 944 34 14 280 47 0 à 200 total 444 210 28 1040 0
2002234 937 35 10 290 56 2466 215 23 1050 1
3578230 936 36 7 300 44 intercal frequencef 220 41 1060 0
4121391 933 37 10 310 36 600 4046 225 35 1070 0
1500535 926 38 15 320 35 650 34 230 23 1080 0
4952031 915 39 8 330 29 700 27 235 32 1090 0
2490814 912 40 7 340 36 201 à 370 750 25 240 27 1100 0
2028503 909 reste 3017 350 30 776 800 15 245 25 1110 1
4150415 904 total 4213 360 30 18.4% 850 11 250 23 1120 0
2127775 897 370 37 900 11 255 26 1130 0
1003095 887 380 19 950 11 260 26 1140 1
2921392 885 390 24 1000 5 265 31 1150 2
2262088 884 400 19 1050 5 270 23 1160 2
2877064 877 410 32 1100 0 275 24 1170 2
4984821 874 420 31 1150 4 280 23 1180 1
4474909 866 430 24 1200 5 285 30 1190 0
1417740 865 440 20 1250 2 290 26 1200 0
4759907 862 450 20 1300 1 295 19 reste 14
3297697 861 460 20 1350 3 300 25 total 167
470 19 1400 0 305 20
480 12 1450 1 310 16
adresse intercaln décalage long 490 12 1500 1 315 20
4734113 -98 shift2 629 500 19 1550 0 320 15
4557422 -77 shift2 764 510 13 1600 1 325 15
2893452 -56 shift2 1688 520 14 1650 0 330 14
4567483 -53 shift2 4142 530 12 1700 1 335 17
5067715 -53 shift2 2369 540 12 371 à 600 1750 1 340 19
4015714 -52 comp 550 9 378 1800 0 345 15
1735201 -43 560 11 9.0% 1850 0 350 15
1578876 -41 570 15 1900 0 355 15
164778 -38 580 7 601 à max 1950 1 360 15
5173629 -34 590 7 167 165 365 19
73781 -32 600 7 4.0% 370 18
2497076 -32 reste 167 reste 2 reste 545
2892533 -32 total 4213 total 4213 total 4213

spl autres intercalaires[modifier | modifier le wikicode]

  • Lien tableur: spl autres intercalaires
  • Légende:  
    - comp, le gène est sur le brin complement
    - deb, fin sont respectivement dans le sens des adresses croissantes, le cds avant le 1er tRNA et le cds après le dernier tRNA du bloc.
    - misc_f, pour misc_feature
    - regul, pour regulatory
spl Les autres intercalaires.
spl1 adresses1
deb-fin gènes adresses intercal sens
deb CDS 43968 614 comp
rRNA 45140 349
rRNA 47032 132
rRNA 50059 1319
rRNA 51494 349
rRNA 53386 132
rRNA 56413 339
fin CDS 56868 comp
deb CDS 146328 -16 comp
regul 146483 188 comp
fin CDS 146933
deb CDS 181132 687 comp
rRNA 182275 74
tRNA 183892 65
tRNA 184034 371
rRNA 184481 132
rRNA 187508 100
tRNA 187724 606
fin CDS 188407
deb CDS 190429 234 comp
tRNA 191614 8
tRNA 191698 35
tRNA 191818 195
fin CDS 192087
deb CDS 233942 647
rRNA 235186 384
rRNA 237113 132
rRNA 240140 454
deb CDS 240710 1908 comp
rRNA 243635 348
rRNA 245526 133
rRNA 248554 68
tRNA 248738 17
rRNA 248831 703
fin CDS 249650
deb CDS 282426 135
ncRNA 283404 313
fin CDS 284069 comp
deb CDS 413908 236 comp
tRNA 416766 39
tRNA 416882 41
tRNA 416999 58
tRNA 417134 320
fin CDS 417531 comp
deb CDS 492003 1178 comp
rRNA 493715 349
rRNA 495607 132
rRNA 498634 768
fin CDS 499518 comp
deb CDS 550745 -23
tRNA 552630 286 comp
fin CDS 553011
deb CDS 640018 155
tRNA 641376 1172
tRNA 642639 789
deb CDS 643519 988
rRNA 645851 74
tRNA 647468 65
tRNA 647610 336
rRNA 648022 177
rRNA 651094 727
fin CDS 651937
deb CDS 727650 330 comp
tRNA 728115 695
fin CDS 728895
deb CDS 878528 406
regul 879639 204
fin CDS 879989
deb CDS 1166653 117
tRNA 1168942 220 comp
fin CDS 1169239 comp
deb CDS 1284512 -193
misc_f 1284538 121 comp
fin CDS 1284778 comp
spl2 adresses2
deb-fin gènes adresses intercal sens
deb CDS 1337892 500
tRNA 1339706 52 comp
tRNA 1339834 539 comp
tRNA 1340449 52 comp
tRNA 1340577 545 comp
deb CDS 1341198 34
tRNA 1342467 52 comp
tRNA 1342595 441 comp
fin CDS 1343112 comp
deb CDS 1455613 913
tRNA 1456724 21
tRNA 1456837 30
tRNA 1456944 32
tRNA 1457053 30
tRNA 1457160 33
tRNA 1457270 9
tRNA 1457356 76
tRNA 1457524 35
tRNA 1457636 9
tRNA 1457722 1058
fin CDS 1458872
deb CDS 1564741 165 comp
tmRNA 1566139 110 comp
fin CDS 1566605 comp
deb CDS 1625951 581 comp
tRNA 1627363 176 comp
fin CDS 1627615 comp
deb CDS 1769998 257 comp
tRNA 1770483 37
tRNA 1770596 37
tRNA 1770709 37
tRNA 1770822 37
tRNA 1770935 37
tRNA 1771048 37
tRNA 1771161 37
tRNA 1771274 37
tRNA 1771387 37
tRNA 1771500 39
tRNA 1771615 705
deb CDS 1772396 104
tRNA 1773910 80
tRNA 1774066 102
tRNA 1774244 102
tRNA 1774422 102
tRNA 1774600 102
tRNA 1774778 102
tRNA 1774956 102
tRNA 1775134 102
tRNA 1775312 253
tRNA 1775641 102
tRNA 1775819 102
tRNA 1775997 102
tRNA 1776175 102
tRNA 1776353 47
tRNA 1776476 977
fin CDS 1777529 comp
deb CDS 1928606 113 comp
misc_f 1930303 474 comp
fin CDS 1930887
deb CDS 2079870 876
rRNA 2081301 348
rRNA 2083192 132
rRNA 2086219 304
fin CDS 2086639 comp
deb CDS 2142913 136
tRNA 2143274 134 comp
fin CDS 2143485 comp
deb CDS 2225993 125
regul 2226508 52
fin CDS 2226691
deb CDS 2365103 455 comp
tRNA 2366164 40 comp
tRNA 2366281 40 comp
tRNA 2366398 40 comp
tRNA 2366515 383 comp
fin CDS 2366975
deb CDS 2374251 254 comp
tRNA 2376218 216
fin CDS 2376525
spl3 adresses3
deb-fin gènes adresses intercal sens
deb CDS 2379066 152
tRNA 2379767 13
tRNA 2379856 85
tRNA 2380015 530
fin CDS 2380631
deb CDS 2548825 595
tRNA 2550857 13
tRNA 2550946 95
tRNA 2551115 634
tRNA 2551835 95
tRNA 2552004 479
tRNA 2552569 132
tRNA 2552775 545
fin CDS 2553406 comp
deb CDS 2556685 89
tRNA 2558019 184
fin CDS 2558294 comp
deb CDS 2716829 98
tRNA 2717566 178
fin CDS 2717834 comp
deb CDS 2758794 192 comp
tRNA 2759262 128 comp
tRNA 2759496 128 comp
tRNA 2759730 189 comp
tRNA 2759996 45 comp
tRNA 2760118 2 comp
tRNA 2760197 35 comp
tRNA 2760309 13 comp
tRNA 2760399 353 comp
fin CDS 2760829 comp
deb CDS 2858049 291 comp
tRNA 2858823 30
tRNA 2858938 85
tRNA 2859108 107
tRNA 2859300 107
tRNA 2859492 315
fin CDS 2859892
deb CDS 2863253 1011 comp
tRNA 2866268 45
tRNA 2866389 41
tRNA 2866506 26
tRNA 2866608 32
tRNA 2866716 33
tRNA 2866825 40
tRNA 2866941 187
fin CDS 2867204
deb CDS 2904901 188 comp
regul 2907051 230 comp
fin CDS 2907380 comp
deb CDS 2926979 572 comp
tRNA 2929429 97 comp
tRNA 2929603 97 comp
tRNA 2929777 83 comp
tRNA 2929937 124 comp
fin CDS 2930138 comp
deb CDS 3118298 830 comp
tRNA 3120289 58 comp
tRNA 3120423 58 comp
tRNA 3120557 58 comp
tRNA 3120691 59 comp
tRNA 3120826 57 comp
tRNA 3120959 58 comp
tRNA 3121093 58 comp
tRNA 3121227 59 comp
tRNA 3121362 58 comp
tRNA 3121496 59 comp
tRNA 3121631 59 comp
tRNA 3121766 193 comp
fin CDS 3122035 comp
deb CDS 3243130 634
ncRNA 3244382 176 comp
fin CDS 3244655 comp
deb CDS 3268300 255 comp
tRNA 3269860 8 comp
tRNA 3269944 63 comp
tRNA 3270084 465 comp
fin CDS 3270626
spl4 adresses4
deb-fin gènes adresses intercal sens
deb CDS 3757370 157 comp
tRNA 3757983 103 comp
tRNA 3758163 114 comp
fin CDS 3758364 comp
deb CDS 3834636 162 comp
tRNA 3835257 51 comp
tRNA 3835383 131 comp
tRNA 3835599 20 comp
tRNA 3835694 96 comp
tRNA 3835875 49 comp
tRNA 3835999 211 comp
tRNA 3836295 5 comp
tRNA 3836377 47 comp
tRNA 3836499 55 comp
tRNA 3836639 5 comp
tRNA 3836721 47 comp
tRNA 3836843 55 comp
tRNA 3836983 495 comp
fin CDS 3837555 comp
deb CDS 3862357 180 comp
tRNA 3862885 167 comp
tRNA 3863129 160 comp
fin CDS 3863366 comp
deb CDS 3865578 454
rRNA 3867049 132 comp
rRNA 3867297 348 comp
rRNA 3870540 807 comp
fin CDS 3872890
deb CDS 3879732 289 comp
tRNA 3882154 187
fin CDS 3882417 comp
deb CDS 3930329 122 comp
regul 3932305 233 comp
fin CDS 3932761 comp
deb CDS 4051244 82
ncRNA 4051647 251
fin CDS 4052080 comp
deb CDS 4130284 211 comp
regul 4131260 506 comp
fin CDS 4131919 comp
deb CDS 4146436 183
regul 4146892 94
fin CDS 4147086
deb CDS 4330369 663 comp
tRNA 4331488 20 comp
tRNA 4331584 13 comp
tRNA 4331694 47 comp
tRNA 4331817 47 comp
tRNA 4331940 15 comp
tRNA 4332055 16 comp
tRNA 4332147 48 comp
tRNA 4332271 113 comp
fin CDS 4332460 comp
deb CDS 4446808 66 comp
regul 4449058 441 comp
fin CDS 4449582
deb CDS 4452358 212 comp
regul 4453881 104
fin CDS 4454085
deb CDS 4615072 798
rRNA 4616881 132 comp
rRNA 4617129 371 comp
tRNA 4620395 65 comp
tRNA 4620536 74 comp
rRNA 4620687 206 comp
fin CDS 4622436 comp
deb CDS 5003438 -13 comp
regul 5004406 257 comp
fin CDS 5004800
deb CDS 5129088 427 comp
tRNA 5129770 100 comp
rRNA 5129947 133 comp
rRNA 5130196 349 comp
rRNA 5133440 611 comp
fin CDS 5135594 comp

spl intercalaires tRNA[modifier | modifier le wikicode]

  • Lien tableur: spl intercalaires tRNA
  • Légende:
    - comp', l'intercalaire est entre un gène comp (sur le complément) et un gène sur le brin direct. Continu les 2 gènes sont sur le même brin.
    - deb, fin sont les intercalaires des cds du tableau précédent, autres intercalaires: respectivement dans le sens des adresses croissantes, le cds avant le 1er tRNA et le cds après le dernier tRNA du bloc.
  • Cumuls comp'+continu du tableau
	deb	fin	total
<201	13	12	25
total	31	31	62
taux	42%	39%	40%
spl intercalaires tRNA
spl intercalaires entre tRNAs
aa1 aa2 aa3
234 455 830
8 40*3 58*3
35 152 59
236 13 57
39 85 58*2
41 595 59
58 13 58
155 95 59*2
1172 634 255
500 95 8
52 479 63
539 132 157
52 192 103
34 128*2 162
52 189 51
913 45 131
21 2 20
30 35 96
32 13 49
30 291 211
33 30 5
9 85 47
76 107*2 55
35 1011 5
9 45 47
257 41 55
37*9 26 180
39 32 167
104 33 663
80 40 20
102*7 572 13
253 97*2 47*2
102*4 83 15
47 16
48
spl les relevés deb-fin
comp’ deb comp’ fin
606
comp’ 234 195
comp’ 236 comp’ 320
comp’ -23 comp’ 286
155 789
comp’ 330 695
comp’ 117 220
comp’ 500 comp’ 545
comp’ 34 441
913 1058
581 176
comp’ 257 705
104 comp’ 977
comp’ 136 134
455 comp’ 383
comp’ 254 216
152 530
89 comp’ 184
98 178
595 comp’ 545
192 353
comp’ 291 315
comp’ 1011 187
572 124
830 193
255 comp’ 465
157 114
162 495
180 160
comp’ 289 comp’ 187
663 113
427
spl intercalaires inférieures à 201 pbs
deb fin continu cumuls
89 113
98 114 deb
104 124 <201 9
152 134 total 18
155 160 taux 50%
157 176
162 187 fin
180 193 <201 9
192 195 total 21
255 216 taux 43%
427 220
455 315 total
572 353 <201 18
581 441 total 39
595 495 taux 46%
663 530
830 606
913 695
- 705
- 789
- 1058 comp’ cumuls
-23 178 deb
34 184 <201 4
117 187 total 13
136 286 taux 31%
234 320 fin
236 383 <201 3
254 465 total 10
257 545 taux 30%
289 545
291 977 total
330 - <201 7
500 - total 23
1011 - taux 30%

spl intercalaires rRNA[modifier | modifier le wikicode]

  • Voir la présentation des blocs à rRNA dans le chapitre spl blocs de l'étude préliminaire. A comparer avec le tableau spl autres intercalaires.
  • Remarque: Quand le 16s n'est pas précédé de tRNAs l'intercalaire cds-16s est élevé, pour le 4ème bloc il est de 647 pbs. L'intercalaire cds-bloc de l'autre côté du bloc est beaucoup plus faible, 454 pbs. Cette orientation est quasiment générale chez tous les génomes que j'ai étudié ici. Je l'ai notée dans les chapitres génome-bloc de chaque génome. Un seul bloc de spl sur 11, l'avant dernier (adresse 4 620 687), est orienté dans l'autre sens, avec cds-16s de 206 pbs et 5s-cds de 798 pbs.
  • Note: J'ai supposé souvent que les blocs à tRNA sans rRNA sont aussi orientés de l'intercalaire le plus grand au plus petit. Dans spl cumuls et de même pour les autres génomes, j'ai noté cette orientation dans la colonne cdsd, pour cds dirigé. Je n'ai conservé pour les calculs que le plus petit intercalaire des 2 cds bordant le bloc. L'idée était que cette orientation provoquait la création du cds en fin de bloc. Ces cds sont souvent de petites protéines et souvent hypothétiques. Aussi je présente ci-dessous la transformation deb-fin qui est imposée par l'adressage en intercalaire plus grand et plus petit.
deb	fin		tri	grand	petit		deb	fin		tri	grand	petit
234	195		3	286	-23		152	530		22	1011	187
236	320		8	441	34		89	184		29	289	187
-23	286		17	184	89		98	178		20	353	192
155	789		18	178	98		595	545		24	830	193
330	695		12	977	104		192	353		1	234	195
117	220		30	663	113		291	315		15	254	216
500	545		26	157	114		1011	187		2	320	236
34	441		6	220	117		572	124		25	465	255
913	1058		23	572	124		830	193		11	705	257
581	176		13	136	134		255	465		21	315	291
257	705		16	530	152		157	114		5	695	330
104	977		4	789	155		162	495		14	455	383
136	134		28	180	160		180	160		7	545	500
455	383		27	495	162		289	187		19	595	545
254	216		10	581	176		663	113		9	1058	913

Vibrio parahaemolyticus[modifier | modifier le wikicode]

vpb opérons[modifier | modifier le wikicode]

  • Liens: gtRNAdb [4], NCBI chr1 [5], NCBI chr2 [6], génome []
  • Lien tableur: vpb opérons
  • Légende:
    - cds1 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF
    - cds2 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF
    - cds3 180 MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS
vpb1. Vibrio parahaemolyticus BB22OP
45.3%GC 6.7.19 Paris  126  doubles interca
chr1
33614..35175 16s @4 80
35256..35331 gaa 2
35334..35409 aaa 30
35440..35515 gta 55
comp 35571..35768 cds1 59
35828..38743 23s 73
38817..38932 5s
49997..50073 cgg 32
50106..50181 cac + 72
50254..50330 cca 2 cac 49
50380..50455 cac 2 cca 24
50480..50556 cca
comp 400045..400120 atgi
577971..579532 16s 88
579621..579696 gcc 12
579709..579784 gaa 258
580043..582958 23s 73
583032..583147 5s 30
583178..583254 gac 35
583290..583366 tgg
comp 769649..769733 cta + 29
comp 769763..769847 cta 10 cta 47
comp 769895..769971 atg 4 atg 24
comp 769996..770080 cta 5 caa 52
comp 770133..770207 caa 29
comp 770237..770321 cta 53
comp 770375..770451 atg 24
comp 770476..770560 cta 52
comp 770613..770687 caa 29
comp 770717..770801 cta 54
comp 770856..770930 caa 29
comp 770960..771044 cta 35
comp 771080..771154 caa 48
comp 771203..771287 cta 31
comp 771319..771403 cta 77
comp 771481..771557 atg 77
comp 771635..771709 caa 31
comp 771741..771825 cta 40
comp 771866..771942 atg
786939..787015 cca
comp 802315..802391 agg
910219..910295 aga
comp 982089..982173 tac + 81
comp 982255..982339 tac 4 tac 81
comp 982421..982505 tac 81
comp 982587..982671 tac
1124715..1124802 tcc
1418321..1418397 gtc + 32
1418430..1418506 gtc 2gtc
comp 1988127..1988202 ggc + 10
comp 1988213..1988299 tta 2 ggc 76
comp 1988376..1988451 ggc 20
comp 1988472..1988545 tgc
2164082..2164157 aac
2193593..2193683 tca
comp 2547884..2547960 atgf 56
comp 2548017..2548100 ctc
2652092..2652168 cgt + 56
comp 2652225..2652301 cgt 9 cgt 57
comp 2652359..2652435 cgt 2 agc 57
comp 2652493..2652569 cgt 57
comp 2652627..2652703 cgt 57
comp 2652761..2652837 cgt 56
comp 2652894..2652970 cgt 210
comp 2653181..2653257 cgt 31
comp 2653289..2653380 agc @5 320
comp 2653701..2653777 cgt 31
comp 2653809..2653900 agc
2735697..2735772 ttc + 64
2735837..2735912 aca 3 ttc 7
2735920..2735995 ttc 2 aca 70
2736066..2736141 aac 2 aac 71
2736213..2736288 aca 7
2736296..2736371 ttc 43
2736415..2736490 aac
2738623..2738698 ttc 51
2738750..2738825 aca + 21
2738847..2738922 aac 2 aca 39
2738962..2739037 aca 2 aac 15
2739053..2739128 aac
comp 2741263..2741339 gac 31
comp 2741371..2741487 5s 57
comp 2741545..2741620 acc 100
comp 2741721..2741836 5s 73
comp 2741910..2744825 23s 257
comp 2745083..2745158 gca 41
comp 2745200..2745276 atc 56
comp 2745333..2746894 16s
comp 2755928..2756012 ttg
comp 2847646..2847722 tgg 68
comp 2847791..2847867 gac 30
comp 2847898..2848013 5s 73
comp 2848087..2851002 23s 258
comp 2851261..2851336 gaa 80
comp 2851417..2852978 16s
comp 2987485..2987561 atgf + 56
comp 2987618..2987693 ggc 5 atgf 18
comp 2987712..2987788 atgf 8 ggc 35
comp 2987824..2987899 ggc 50
comp 2987950..2988025 ggc 49
comp 2988075..2988150 ggc 49
comp 2988200..2988275 ggc 30
comp 2988306..2988382 atgf 55
comp 2988438..2988513 ggc 30
comp 2988544..2988620 atgf 39
comp 2988660..2988735 ggc 19
comp 2988755..2988831 atgf 35
comp 2988867..2988942 ggc
comp 3060924..3061000 tgg 68
comp 3061069..3061145 gac 30
comp 3061176..3061291 5s 73
comp 3061365..3064280 23s 257
comp 3064538..3064613 gta 14
comp 3064628..3064703 gca 32
comp 3064736..3064811 aaa 2
comp 3064814..3064889 gaa 80
comp 3064970..3066531 16s @3 319
comp 3066851..3066966 5s 73
comp 3067040..3069955 23s 261
comp 3070217..3071778 16s
comp 3105094..3105169 acc 13
comp 3105183..3105257 gga 35
comp 3105293..3105377 tac 36
comp 3105414..3105489 aca
comp 3111073..3111149 gac 30
comp 3111180..3111295 5s 73
comp 3111369..3114284 23s 261
comp 3114546..3116107 16s @1 317
comp 3116425..3116540 5s 73
comp 3116614..3119529 23s 261
comp 3119791..3121352 16s
comp 3175944..3176034 tca 69
comp 3176104..3176219 5s 73
comp 3176293..3179211 23s 257
comp 3179469..3179544 gca 41
comp 3179586..3179662 atc 56
comp 3179719..3181280 16s @2
comp 3217187..3217263 gac 30
comp 3217294..3217409 5s 73
comp 3217483..3220398 23s 59
3220458..3220655 cds2 55
comp 3220711..3220786 gta 30
comp 3220817..3220892 aaa 2
comp 3220895..3220970 gaa 80
comp 3221051..3222612 16s
chr2
132908..134469 16s 80
134550..134625 gaa 2
134628..134703 aaa 16
134720..134795 gca 14
134810..134885 gta 54
comp 134940..135122 cds3 19
135142..138059 23s 73
138133..138248 5s 69
138318..138408 tca
comp 192886..192969 ctc
comp 591931..592021 tca
comp 1009457..1009530 tgc 73
comp 1009604..1009690 tta
comp 1021568..1021641 tgc 73
comp 1021715..1021801 tta
comp 1029973..1030048 ggc 3
comp 1030052..1030125 tgc
1125193..1125267 gga

vpb cumuls[modifier | modifier le wikicode]

cumuls. Vibrio parahaemolyticus BB22OP
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 9 1 0 0 1 1 100
16 23 5s 0 0 20 9 8 50 20 200
16 atc gca 2 40 24 4 100 40 300
16 23 5s a 1 60 21 2 150 60 400
max a 6 80 9 2 200 80 500
a doubles 0 100 3 0 250 100 600
spéciaux 6 120 0 0 300 120 700
total aas 33 140 0 0 350 140 800
sans opérons 25 160 0 0 400 160 900
1 aa 11 180 0 0 450 180 1000
max a 19 200 0 0 500 200 1100
a doubles 8 1 0
total aas 93 67 16 0 0 0
total aas 126
remarques 5
avec jaune moyenne 46 26
variance 29 22
sans jaune moyenne 43
variance 17

vpb blocs[modifier | modifier le wikicode]

vpb1. Vibrio parahaemolyticus BB22OP, blocs à rRNA.
16s 80 16s 80 16s 80
gaa 2 gaa 2 gaa 2
aaa 30 aaa 30 aaa 16
gta 55 gta 55 gca 14
cds 198 59 cds 198 59 gta 54
23s 73 23s 73 cds 180 19
5s 5s 30 23s 73
gac 5s 69
tca
16s 56 16s 56 16s 88 16s 80
atc 41 atc 41 gcc 12 gaa 258
gca 257 gca 257 gaa 258 23s 73
23s 73 23s 73 23s 73 5s 30
5s 100 5s 69 5s 30 gac
acc 57 tca gac
5s 31
gac
16s 261 16s 261
23s 73 23s 73
5s 319 5s 317
16s 80 16s 261
gaa 2 23s 73
aaa 32 5s 30
gca 14 gac
gta 257
23s 73
5s 30
gac

vpb remarques[modifier | modifier le wikicode]

  • Remarques : 2 chromosomes circulaires. EFTU et beaucoup de doubles.
    1. @1 Blocs 16-23-5s, il y en a 3 dont 2 sont sur un opéron avec 1 aa. Le 4ème appartient à un opéron spécial.
        - Les 3 ont les mêmes Intercalaires, 73 261. L’intercalaire 23-5s se retrouve dans tout les autres opérons.
        - Les 2 blocs accolés sont séparés du reste par de grands intercalaires, 320 bases.
    2. @2 Les opérons 16-atc-gca sont au nombre de 2 avec 3 aas en plus.
        - 4 de leurs intercalaires, 73 257 41 56, sont identiques et le 5ème est du même ordre de grandeur, 100 69.
        - Un opéron est clasisque et a un aa en plus, le 2ème a la séquence 5s-aa-5s-aa donc 2 aa en +.
    3. @3 Les opérons analogues aux 16-atc-gca sont au nombre de 3 et ont 2 intercalaires en commun avec eux, 257 73 correspondant à aa-23s-5s.
        - Un opéron 16-gcc-gaa-23s-5s avec 2 aas entre les 2 rRNAs. Il a 4 aas.
        - Un opéron 16-gaa-23s-5s avec 1 aa entre les 2 rRNAs. Il a 3 aas.
        - Un opéron 16-gaa-3aas-23s-5s avec 4 aas entre les 2 rRNAs. Il a 6 aas.
    4. @4 Les opérons analogues aux 16-atc-gca avec une protéine sont au nombre de 3 et ont l’intercalaire 73 du 23s-5s comme tous les autres opérons.
      - Différence importante avec lam qui a des opérons analogues, la protéine est dans le brin complémentaire du brin des RNAs. Alors que dans lam protéine et RNAs sont sur le même brin.
      - La séquence est 16s-gaa-aaa-xxx-gta-protéine-23s-5s et les 3 opérons ont en commun les 4 mêmes intercalaires, 16s-80-aaa-2-xxx-gta-55-protéine-23s-73-5s.
      - Deux opérons, sans xxx, sont identiques en aas, intercalaires et protéines mais un a un aa en plus après 5s. Ils ont respectivement 3 et 4 aas.
      - Un opéron a une protéine plus petite, 180 aas au lieu de 198, avec xxx=gca entre les rRNAs plus 1 au-delà du 5s, soit 5 aas au total.
      - Note du 4.10.20: contrôle des cds au 10.2.20 du NCBI, 0 cds.
    5. @5 L’opéron 9cgt 2agc a une intercalaire élevée, 320 bases.
  • Séquences des doubles : beaucoup de doubles et de séquences répétées comme cbn.
      - 8 opérons sur 14 à 2aas et plus sont remarquables :
	opéron			n*séquence
	cgg+4			2*2
	10 cta 5caa 4atg	3*4
	4 tac			4*1
	2 gtc			2*1
	9 cgt 2agc		8*1
	ttc+6			2*3
	ttc+4			2*2
	8 ggc 5atgf		5*2

vpb distribution[modifier | modifier le wikicode]

  • Lien tableur: vpb distribution
  • Notes:
    - gtc2 cta2+2 tac4 cgt8 ggc4
    - acc: 5s + >1aa
    - tca: 2 5s + 2 1aa
    - Séquences:
    (cac cca)2
    (cgt agc)2
    ttc (aca aac)2
    ttc (aca ttc aac)2
    cta (cta atgj cta caa)2 (cta caa)2 cta (cta atgj) caa (cta atgj)
    (atgf ggc)2 ggc3 (atgf ggc)3
Gm2 vpb, Vibrio parahaemolyticus BB22OP. gama
g1    t1       
atgi 1 tct tat atgf 6
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 4 tcc 1 tac 5 tgc 4
atc 2 acc 2 aac 5 agc 2
ctc 2 ccc cac 2 cgt 9
gtc 2 gcc 1 gac 6 ggc 11
tta 3 tca 4 taa tga
ata aca 5 aaa 4 aga 1
cta 10 cca 3 caa 5 cga
gta 4 gca 4 gaa 6 gga 2
ttg 1 tcg tag tgg 3
atgj 4 acg aag agg 1
ctg ccg cag cgg 1
gtg gcg gag ggg
gama >1aa =1aa -5s +5s -16s +16s total
vpb 82 11 12 21 126

Escherichia albertii[modifier | modifier le wikicode]

eal opérons[modifier | modifier le wikicode]

eal1. Escherichia albertii
49.6%GC 10.3.19 Paris  89  doubles interca
219063..219144 tac + 212
219357..219438 tac 2 tac
413135..413219 tcc
462888..462972 tca
comp 489120..489191 gga 6
comp 489198..489270 aca
615149..615233 tcc
comp 756823..756895 aaa + 5
comp 756901..756973 gta 3 aaa 48
comp 757022..757094 aaa 2 gta 5
comp 757100..757172 gta 48
comp 757221..757293 aaa
834529..834602 atgj + 10
834613..834694 cta 2atgj 26
834721..834792 caa 2caa 37
834830..834901 caa 2 cag 18
834920..834993 atgj 51
835045..835116 cag 35
835152..835223 cag
comp 968958..969031 aga
comp 1192416..1192488 acg
comp 1269526..1269599 gac
comp 1277040..1277113 gac 52
comp 1277166..1277285 5s @1 169
comp 1277455..1280377 23s 186
comp 1280564..1280636 gca 45
comp 1280682..1280755 atc 70
comp 1280826..1282367 16s
1567231..1567314 ctg + 31
1567346..1567429 ctg 3 ctg 35
1567465..1567548 ctg
comp 1657309..1657390 ttg
comp 1765401..1765473 ggc + 159
comp 1765633..1765705 ggc 2 ggc
1795516..1795588 ttc
comp 2006002..2006121 5s 169
comp 2006291..2009214 23s 186
comp 2009401..2009473 gca 45
comp 2009519..2009592 atc 70
comp 2009663..2011202 16s
comp 2042057..2043241 tuf1 CDS 1185pb 117
comp 2043359..2043431 acc 9
comp 2043441..2043512 gga 119
comp 2043632..2043713 tac 11
comp 2043725..2043797 aca @3
comp 2047429..2047548 5s 169
comp 2047718..2050648 23s 186
comp 2050835..2050907 gca 45
comp 2050953..2051026 atc 68
comp 2051095..2052636 16s
comp 2208305..2208424 5s @2 169
comp 2208594..2211517 23s 198
comp 2211716..2211788 gaa 85
comp 2211874..2213418 16s
comp 2267554..2267627 cca 43
comp 2267671..2267754 ctg 23
comp 2267778..2267850 cac 61
comp 2267912..2267985 cgg
comp 2305358..2305430 tgg 11
comp 2305442..2305515 gac 52
comp 2305568..2305687 5s 169
comp 2305857..2308779 23s 198
comp 2308978..2309050 gaa 85
comp 2309136..2310676 16s
comp 2426158..2426248 tga
2556305..2556378 ccg
2810766..2812307 16s 85
2812393..2812465 gaa 198
2812664..2815586 23s 169
2815756..2815875 5s 151
2816027..2816099 acc 40
2816140..2816259 5s
2911129..2911212 ctc
2913088..2913161 atgf
comp 3010332..3010404 atgi
comp 3177717..3177789 ttc
3301617..3301687 ggg
comp 3366868..3366941 atgf + 37
comp 3366979..3367052 atgf 3 atgf 37
comp 3367090..3367163 atgf
3469914..3470003 agc 6
3470010..3470083 cgt + 201
3470285..3470358 cgt 3 cgt 200
3470559..3470632 cgt
3505321..3505393 atgi
3563056..3564598 16s 85
3564684..3564756 gaa 198
3564955..3567876 23s 169
3568046..3568165 5s
comp 3779750..3779822 aaa 7
comp 3779830..3779902 gta + 47
comp 3779950..3780022 gta 2 gta
3782718..3782790 gcc + 42
3782833..3782905 gcc 2 gcc
comp 3810369..3810440 agg
comp 3993500..3993573 ccc
comp 4232176..4232248 aac
4233996..4234068 aac
comp 4242952..4243024 aac
comp 4248342..4248414 aac
4249406..4249492 tcg
4256696..4256768 atgi 100
4256869..4256942 aga
4317980..4318052 ggc 56
4318109..4318179 tgc 14
4318194..4318277 tta
comp 4556753..4556826 gtc + 7
comp 4556834..4556907 gtc 2 gtc

eal cumuls[modifier | modifier le wikicode]

cumuls. Escherichia albertii
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 7 1 0 - 1 1 100
16 23 5s 0 0 20 11 50 20 200
16 atc gca 3 40 8 100 40 300
16 23 5s a 0 60 7 150 60 400
max a 3 80 1 200 80 500
a doubles 0 100 1 250 100 600
spéciaux 4 120 1 300 120 700
total aas 13 140 0 350 140 800
sans opérons 38 160 1 400 160 900
1 aa 23 180 0 450 180 1000
max a 7 200 1 500 200 1100
a doubles 10 2
total aas 71 33 0 0 0 0
total aas 84
remarques 3
avec jaune moyenne 53
variance 59
sans jaune moyenne
variance

eal blocs[modifier | modifier le wikicode]

eal1. Escherichia albertii, blocs à rRNA.
16s 70 70 68
atc 45 45 45
gca 186 186 186
23s 169 169 169
5s 52
gac
16s 85 85 85
gaa 198 198 198
23s 169 169 169
5s 52
gac
16s 85
gaa 198
23s 169
5s 151
acc 40
5s

eal remarques[modifier | modifier le wikicode]

  • Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles.
  1. @1 Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.
    - Les intercalaires sont les mêmes pour les 3 opérons, 70 45 186 169.
    - Un seul opéron a un aa en plus.
  2. @2 4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s.
    - Les intercalaires sont les mêmes pour les 4 opérons, 85 198 169.
    - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.
    - Les aas suplémentaires sont absents pour 2 opérons et sont 2 pour un autre.
    - Le 4ème opéron a 1 aa et 1 5s en supplément.
  3. @3 2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB
  • Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.
    - 5 opérons à 2 aas répétés
    - 3 opérons à 3 aas répétés
    - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.
    - Un opéron à 5 aas a une séquence répétée, aaa + 2*2.
    - 5 opérons sans répétitions
		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca
  • Notes :

eal distribution[modifier | modifier le wikicode]

  • Lien tableur: eal distribution
  • Notes:
    - gtc2 gta2 ctg3 gcc2 tac2 caa2 cag2 atgf3 cgt3 ggc2
    - atgi: 2 1aa + 1 >1aa
    - gac: 1aa + 2 5s
    - Séquences:
    aaa (gta aaa)2
Gm3 eal, Escherichia albertii. gama
g1    t1       
atgi 3 tct tat atgf 4
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 2 tcc 2 tac 3 tgc 1
atc 3 acc 2 aac 4 agc 1
ctc 1 ccc 1 cac 1 cgt 3
gtc 2 gcc 2 gac 3 ggc 3
tta 1 tca 1 taa tga 1
ata aca 2 aaa 4 aga 2
cta 1 cca 1 caa 2 cga
gta 4 gca 3 gaa 4 gga 2
ttg 1 tcg 1 tag tgg 1
atgj 2 acg 1 aag agg 1
ctg 4 ccg 1 cag 2 cgg 1
gtg gcg gag ggg 1
gama >1aa =1aa -5s +5s -16s +16s total
eal 48 23 4 10 85

Escherichia coli[modifier | modifier le wikicode]

eco opérons[modifier | modifier le wikicode]

eco1. Escherichia coli str. K-12 substr. MG1655
50.6%GC 10.3.19 Paris  89  doubles interca EcoCyc adIP
223771..225312 16s 68 opéron
225381..225457 atc 42 ileV [11]
225500..225575 gca 183 « 
225759..228662 23s 93 « 
228756..228875 5s @1 52 « 
228928..229004 gac aspU [12]
236931..237007 gac
262871..262946 acg
564723..564799 aga
comp 696430..696504 cag + 37 opéron
comp 696542..696616 cag 2 cag 47 glnT [13]
comp 696664..696740 atg 2 atg 15 « 
comp 696756..696830 caa 2 caa 34 « 
comp 696865..696939 caa 23 « 
comp 696963..697047 cta 9 « 
comp 697057..697133 atg
780554..780629 aaa + 135 lysT [14]
780765..780840 gta 5 aaa 2 opéron
780843..780918 aaa 2 gta 149 « 
781068..781143 gta 3 valZ [15]
781147..781222 aaa 146 opéron
781369..781444 aaa 132 lysZ [16]
781577..781652 aaa lysQ [17]
EcoCyc [18]
comp 925884..925971 tcc InfA-serW [19]
comp 1031625..1031712 tca
comp 1097565..1097652 tcc
comp 1287087..1287176 tpr cds 90pb 67 tpr
comp 1287244..1287328 tac + 209 opéron
comp 1287538..1287622 tac 2 tac tyrT [20]
1746435..1746511 gtc + 4 valV [21]
1746516..1746592 gtc 2 gtc opéron
«RNA 67pb
comp 1991815..1991901 tta 12 leuZ [22]
comp 1991914..1991987 tgc 54 « 
comp 1992042..1992117 ggc opéron
comp 2043468..2043557 tcg
2044549..2044624 aac
comp 2058027..2058102 aac
2059851..2059926 aac
2062260..2062335 aac
2286211..2286287 ccc
2466309..2466383 agg
comp 2518041..2518116 gcc + 39 alaX [23]
comp 2518156..2518231 gcc 2 gcc opéron
2520931..2521006 gta + 44 valU [24]
2521051..2521126 gta 3gta 46 opéron
2521173..2521248 gta 4 « 
2521253..2521328 aaa « 
comp 2726069..2726188 5s @2 92 opéron
comp 2726281..2729184 23s 184
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s
comp 2785762..2785837 atgi
comp 2817784..2817860 cgt + 198 « 
comp 2818059..2818135 cgt 4 cgt 62 « 
comp 2818198..2818274 cgt 198 « 
comp 2818473..2818549 cgt 3 opéron
comp 2818553..2818645 agc serV [25]
2947387..2947463 atgf + 33 opéron
2947497..2947573 atgf 3 atgf 33 metW [26]
2947607..2947683 atgf « 
comp 2998984..2999057 ggg
3110366..3110441 ttc
3215598..3215673 atgi
comp 3318213..3318289 atgf
comp 3322072..3322158 ctc
comp 3423423..3423542 5s 37 « 
comp 3423580..3423655 acc 12 « 
comp 3423668..3423787 5s 92 « 
comp 3423880..3426783 23s 174 « 
comp 3426958..3427033 gca 42 « 
comp 3427076..3427152 atc 68 ileU [27]
comp 3427221..3428762 16s opéron
comp 3708616..3708692 ccg
3836222..3836316 tga
ecoliwiki [28]
3941808..3943349 16s 85 gltU [29]
3943435..3943510 gaa 193 opéron
3943704..3946607 23s 92 « 
3946700..3946819 5s 52 « 
3946872..3946948 gac 8 aspT [30]
3946957..3947032 tgg trpT [31]
3982375..3982451 cgg 57 argX [32]
3982509..3982585 cac 20 opéron
3982606..3982692 ctg 42 « 
3982735..3982811 cca « 
4035531..4037072 16s 68 opéron
4037141..4037217 atc 42 ileT [33]
4037260..4037335 gca 183 « 
4037519..4040423 23s 93 « 
4040517..4040636 5s « 
4166659..4168200 16s 171 opéron
4168372..4168447 gaa 193
4168641..4171544 23s 92
4171637..4171756 5s
4175388..4175463 aca @3 8 thrU [34]
4175472..4175556 tac 116 opéron
4175673..4175747 gga 6 « 
4175754..4175829 acc 114 « 
4175944..4177128 tufb cds 1185 pb « 
4208147..4209688 16s 85 opéron
4209774..4209849 gaa 193
4210043..4212946 23s 93
4213040..4213159 5s
comp 4362551..4362626 ttc
4392360..4392435 ggc + 36 opéron
4392472..4392547 ggc 3 ggc 35 glyX [35]
4392583..4392658 ggc « 
4496405..4496489 ttg
comp 4606079..4606165 ctg + 34 opéron
comp 4606200..4606286 ctg 3 ctg 28 leuV [36]
comp 4606315..4606401 ctg « 

eco cds[modifier | modifier le wikicode]

  • Liens: gtRNAdb [37], NCBI [38], génome [orgn]
  • Lien tableur: eco cds
  • Légende
    - protéines1: metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp
    - protéine2: secG
    - évidence faible1, avec un pseudo.
eco2. les CDS eco pour opérons
cluster 6.8.19 Paris interca cdsa promoteur terminateur notes
222833..223408 cds 362 192 sigma FIS
223771..225312 16s 68
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93
228756..228875 5s 52
228928..229004 gac 162 Terminateur + sigma
229167..229970 cds 268
comp 2724448..2725746 cds 322 433 rien début opéron rien
comp 2726069..2726188 5s 92
comp 2726281..2729184 23s 184
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s 442 sigma FIS
comp 2731600..2734173 cds 858
3422436..3423194 cds 228 253 Terminateur fin opéron rien
comp 3423423..3423542 5s 37
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92
comp 3423880..3426783 23s 174
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 sigma FIS
3429236..3429790 cds 185
comp 3940635..3941327 cds 480 231 sigma FIS
3941808..3943349 16s 85
3943435..3943510 gaa 193
3943704..3946607 23s 92
3946700..3946819 5s 52
3946872..3946948 gac 8
3946957..3947032 tgg 95 Terminateur fin opéron rien
comp 3947128..3947967 cds 280
4034608..4035153 cds 377 182 Sigma Lrp-leu
4035531..4037072 16s 68
4037141..4037217 atc 42
4037260..4037335 gca 183
4037519..4040423 23s 93
4040517..4040636 5s 228
4040865..4040900 rprg 5 pas de Term fin opéron rien
comp 4040906..4041433 cds 176
4165428..4166285 cds 373 286 Sigma Lrp-leu
4166659..4168200 16s 171
4168372..4168447 gaa 193
4168641..4171544 23s 92
4171637..4171756 5s 300 Terminateur début opéron rien
4172057..4173085 cds 343
comp 4205943..4207532 cds 614 530 sigma FIS
4208147..4209688 16s 85
4209774..4209849 gaa 193
4210043..4212946 23s 93
4213040..4213159 5s 74 Terminateur début opéron rien
4213234..4213617 cds 128
695101..696276 cds 31 392
comp 696308..696378 rprg 51 Terminateur fin opéron rien
comp 696430..696504 cag 37
comp 696542..696616 cag 47
comp 696664..696740 atg 15
comp 696756..696830 caa 34
comp 696865..696939 caa 23
comp 696963..697047 cta 9
comp 697057..697133 atg 379 sigma FIS fin opéron rien
comp 697513..699177 cds 555
779598..780389 cds 164 264 sigma FIS fin opéron rien
780554..780629 aaa 135
780765..780840 gta 2
780843..780918 aaa 149
781068..781143 gta 3
781147..781222 aaa 146
781369..781444 aaa 132
781577..781652 aaa 432 Terminateur début opéron NadR pas sigma
782085..783128 cds 348
1286709..1286984 cds 81 92 Terminateur
comp 1287066..1287236 ncRNA -150
comp 1287087..1287176 tpr 67 30
comp 1287244..1287328 tac 209
comp 1287538..1287622 tac 159 sigma FIS
comp 1287782..1288624 cds 281
solitaire promoteur terminateur interc avant interc après protéines lien
236931..237007 gac sigma FIS Term 1 133 328 [39]
262871..262946 acg sigma FIS rien 115 204 [40]
564723..564799 aga sigma FIS rien 243 16 [41]
comp 925884..925971 InfA-tcc sigma FIS Term 1 344 254 [42]
comp 1031625..1031712 tca sigma FIS Term 2 207 427 [43]
comp 1097565..1097652 tcc sigma FIS Term 4 736 234 [44]
comp 2043468..2043557 tcg sigma - Term 1 570 94 [45]
2044549..2044624 aac sigma - Term 1 101 314 [46]
comp 2058027..2058102 aac sigma - Term 1 453 101 [47]
2059851..2059926 aac sigma - Term 1 5 38 [48]
2062260..2062335 aac sigma NtrC rien 327 56 [49]
2286211..2286287 ccc sigma FIS Term 1 75 103 [50]
2466309..2466383 agg sigma - Term 1 76 162 [51]
comp 2785762..2785837 atgi rien rien 410 -37 évidence faible1 [52]
comp 2998984..2999057 ggg sigma FIS rien 156 79 évidence faible [53]
3110366..3110441 ttc sigma FIS Term 1 106 149 [54]
3215598..3215673 atgi sigma - Term 1 125 54 [55]
comp 3318213..3318289 atgf sigma FIS Term 2 207 348 protéines1 [56]
comp 3322072..3322158 ctc sigma - Term 1 459 15 protéine2 [57]
comp 3708616..3708692 ccg sigma FIS Term 2 911 92 [58]
3836222..3836316 tga sigma - rien 293 109 [59]
comp 4362551..4362626 ttc sigma FIS Term 1 198 107 [60]
4496405..4496489 ttg sigma FIS Term 1 196 261 [61]

eco cumuls[modifier | modifier le wikicode]

cumuls. Escherichia coli
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 7 1 0 - 1 1 100
16 23 5s 0 0 20 11 50 20 200
16 atc gca 3 40 10 100 40 300
16 23 5s a 0 60 6 150 60 400
max a 3 80 1 200 80 500
a doubles 0 100 0 250 100 600
spéciaux 4 120 1 300 120 700
total aas 14 140 2 350 140 800
sans opérons 36 160 2 400 160 900
1 aa 23 180 0 450 180 1000
max a 7 200 2 500 200 1100
a doubles 10 1
total aas 72 36 0 0 0 0
total aas 86
remarques 3
avec jaune moyenne 57
variance 60
sans jaune moyenne
variance

eco blocs[modifier | modifier le wikicode]

eco1. Escherichia coli, blocs à rRNA.
16s 68 16s 68 68
atc 42 atc 42 42
gca 174 gca 183 183
23s 92 23s 93 93
5s 12 5s 52
acc 37 gac
5s
16s 85 171 171 85
gaa 193 184 193 193
23s 92 92 92 93
5s 52
gac

eco remarques[modifier | modifier le wikicode]

  • Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles. Comme eal.
    1. @1  Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.
      - Les intercalaires sont les mêmes pour les 3 opérons, 68 42 183 93.
      - Cependant les 3 1ers intercalaires diminuent de 3 bases chacun et le 4ème est divisé par 2.
      - Par rapport à eal un opéron sans aa de plus, s'est transformé avec 1 aa et 1 5s en plus. Son intercalaire gca-23s a diminué de 5 % par rapport aux 2 autres, 9/183.
    2. @2  4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s, comme eal.
      - Les intercalaires sont les mêmes pour 2 opérons sans aa supplémentaire, 171 193 92.
      - Pour les 2 autres opérons le 1er intrcalaire est divisé par 2, 85 193 92.
      - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.
      - Par rapport à eal, l'opéron avec 1 aa et 1 5s a perdu ces suppléments. Et l’on a 3 opérons sans et 1 opéron avec 2 aas en supplément.
    3. @3  2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB
  • Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.
    - Il y a 4 remaniements qui consistent tous en une ou 2 répétions de plus des répétitions déjà existantes
    - 2 opérons sans rRNAs et sans doubles ont été perdus de eal à eco.
    - Pour eco il y a toujours 10 opérons avec répétition et 3 sans répétitions:
    - 3 opérons à 2 aas répétés
    - 4 opérons à 3 aas répétés
    - 1 opéron à 4 aas répétés.
    - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.
    - Un opéron à 7 aas a une séquence répétée, 3aaa + 2*2.
		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca
  • Notes :

eco distribution[modifier | modifier le wikicode]

  • Lien tableur: eco distribution
  • Notes:
    - gtc2 gta3 ctg3 gcc2 tac2 aaa3 caa2 cag2 atgf3 cgt4 ggc3
    - gac: 1aa + 2 5s
    - Séquences:
    (aaa gta)2 aaa3
Gm4 eco, Escherichia coli str. K-12 substr. MG1655. gama
g1    t1       
atgi 2 tct tat atgf 4
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 2 tcc 2 tac 3 tgc 1
atc 3 acc 2 aac 4 agc 1
ctc 1 ccc 1 cac 1 cgt 4
gtc 2 gcc 2 gac 3 ggc 4
tta 1 tca 1 taa tga 1
ata aca 1 aaa 6 aga 1
cta 1 cca 1 caa 2 cga
gta 5 gca 3 gaa 4 gga 1
ttg 1 tcg 1 tag tgg 1
atgj 2 acg 1 aag agg 1
ctg 4 ccg 1 cag 2 cgg 1
gtg gcg gag ggg 1
gama >1aa =1aa -5s +5s -16s +16s total
eco 49 23 4 10 86

eco intercalaires entre cds[modifier | modifier le wikicode]

  • Lien NCBI [62] daté du 23-9-2020 pour ces prélèvements.
  • Note: Pour les génomes des annexes j'ai relevé les intercalaires entre tRNAs et entre ceux-ci et les cds qui leur sont adjacents. L'exemple est celui de rru du clade alpha. L'idée de départ de ces prélèvements est la recherche d'opérons formés de tRNA et de protéine comme dans le cas d'E.coli: l'intercalaire entre le tRNA et la protéine devrait être faible. Voir l'exemple d'eco (remarque @3) avec tac-tac-tpr et aca-tac-gga-acc-tufB.

eco les fréquences[modifier | modifier le wikicode]

  • Lien tableur: eco intercalaires entre cds
  • Légende:   long, longueur en pbs,   intercal pour intercalaire
    - fréquence-1 1 5 6 f, respectivement fréquence des intercalaires négatives à l'unité, positives à l'unité, par blocs de 5, par blocs de 10 jusqu'à 600 pbs et f pour finales. Ces fréquences servent à faire les diagrammes. La fréquence fréquencez est l'étendue à 1200 de la fréquence6 pour certains grands génomes.
    - cumul,% colonne à la droite de frequence6, reprend les fréquences par plages et leurs pourcentages indiqués déjà dans la 1ère partie du tableau.
    - La couleur cyan des fréquences fréquence-1 et 1 sert à montrer leur périodicité ternaire.
    - intercaln intercalx, pour les intercalaires négatifs minimaux et intercalaires positifs maximaux.
    - colonne ADN pour la longueur totale du génome en pbs et intercals pour le total en pbs des intercalaires entre cds uniquement, d'après la méthode des prélèvements de NCBI du 23.9.20.
eco Les fréquences des intercalaires entre cds
eco intercalaires total % intercalaires moyenne ecartype plage ADN intercal frequence5
négatif 738 18.3 négatif -9 14 -1 à -89 4 641 652 -1 738
zéro 29 0.7 intercals 0 29
1 à 200 2511 62.4 0 à 200 72 58 421 229 5 203
201 à 370 572 14.2 201 à 370 264 47 9.1% 10 174
371 à 600 142 3.5 371 à 600 440 60 15 176
601 à max 32 0.8 601 à 1028 693 97 20 99
total 4024 <201 81.5 total 4004 103 126 -89 à 950 25 85
adresse intercalx intercal fréquence1 intercal fréquence6 cumul,% intercal fréquence-1 30 67
4538785 1455 -1 738 -70 30 0 29 35 56
2901896 1372 0 29 -60 2 -1 163 40 87
2876581 950 1 47 -50 2 -2 2 45 80
2405703 919 2 57 -40 12 -3 0 50 72
4077449 852 3 54 -30 18 min à -1 -4 303 55 82
767978 846 4 31 -20 45 738 -5 0 60 72
1985139 796 5 14 -10 84 18.3% -6 0 65 66
310746 775 6 16 0 574 -7 15 70 60
1253085 768 7 26 10 377 -8 60 75 57
1102546 754 8 16 20 275 -9 2 80 52
3111266 728 9 58 30 152 -10 6 85 50
2303905 714 10 58 40 143 1 à 100 -11 34 90 49
2455083 680 11 50 50 152 1701 -12 1 95 58
3353121 674 12 42 60 154 42.3% -13 3 100 56
1907448 669 13 23 70 126 -14 20 105 56
2798091 668 14 37 80 109 -15 0 110 64
83622 659 15 24 90 99 -16 3 115 40
2136104 658 16 22 100 114 -17 10 120 51
4325298 657 17 20 110 120 -18 2 125 34
4294481 641 18 19 120 91 -19 5 130 53
1299567 634 19 14 130 87 -20 9 135 41
2404629 630 20 24 140 90 -21 2 140 49
4502103 626 21 18 150 78 -22 3 145 26
582875 620 22 18 160 81 -23 7 150 52
4602088 618 23 14 170 72 1 à 200 -24 2 155 51
3922060 616 24 25 180 62 2511 -25 4 160 30
384059 615 25 10 190 68 62.4% -26 8 165 36
3550080 611 26 15 200 61 -27 1 170 36
1711523 610 27 14 210 72 -28 4 175 34
1292509 604 28 12 220 66 -29 5 180 28
985894 602 29 11 230 40 -30 1 185 36
88028 601 30 15 240 41 0 à 200 -31 1 190 32
4150447 597 31 9 250 41 2540 -32 7 195 31
654583 588 32 10 260 47 712 200 30
1089866 586 33 10 270 27 reste 55 205 39
34 15 280 37 total 767 210 33
35 12 290 38 215 29
36 19 300 26 intercal frequencef 220 37
37 18 310 22 600 3992 225 16
38 13 320 29 610 4 230 24
39 22 330 18 620 5 235 19
40 15 340 18 201 à 370 630 2 240 22
reste 2310 350 11 572 640 1 245 24
total 4024 360 20 14.2% 650 1 250 17
370 19 660 3 255 19
adresse intercaln décalage long 380 23 670 2 260 28
164730 -2400 shift2 135 390 9 680 2 265 15
2731600 -2130 shift2 0 400 18 690 0 270 12
492092 -1295 shift2 0 410 10 700 0 275 23
4577958 -897 1 et 2shift2 0 420 7 710 0 280 14
1179520 -729 shift2 111 430 13 720 1 285 21
3111128 -723 comp 138 440 8 730 1 290 17
3838248 -530 comp 394 450 3 740 0 295 17
10643 -527 comp 187 460 8 750 0 300 9
1639030 -448 shift2 50 470 4 760 1 305 10
3796948 -436 comp 824 480 6 770 1 310 12
578107 -242 shift2 220 490 3 780 1 315 14
508875 -212 shift2 2293 500 4 790 0 320 15
3993739 -210 comp 111 510 1 800 1 325 8
16751 -153 shift2 0 520 5 810 0 330 10
1240260 -129 comp 75 530 3 820 0 335 10
4011076 -113 comp 787 540 3 371 à 600 830 0 340 8
1491922 -110 shift2 40 550 4 142 840 0 345 7
3086145 -102 comp 42 560 3 3.5% 850 1 350 4
3519465 -89 shift2 1150 570 1 860 1 355 13
1529922 -86 comp 397 580 3 601 à max total 28 360 7
2475873 -85 shift2 221 590 2 32 365 13
19811 -82 shift2 422 600 1 0.8% 370 6
257923 -82 shift2 422 reste 32 reste 4 reste 174
279178 -82 shift2 422 total 4024 total 4024 total 4024

eco autres intercalaires[modifier | modifier le wikicode]

  • Lien tableur: eco autres intercalaires
  • Légende:  
    - comp, le gène est sur le brin complement
    - deb, fin sont respectivement dans le sens des adresses croissantes, le cds avant le 1er tRNA et le cds après le dernier tRNA du bloc.
    - misc_f, pour misc_feature
    - regul, pour regulatory
    - mobile, pour mobile_element
    - rep_or, pour rep_origin
    - gene, est dans NCBI, un pseudo gène
eco Les autres intercalaires.
eco1 adresses1
deb-fin gènes adresses intercal sens
deb CDS 14168 88
mobile 15387 -1287
fin CDS 15445
deb CDS 16751 -9
ncRNA 16952 482
fin CDS 17489
deb CDS 18715 175
mobile 19796 -753
fin CDS 19811
deb CDS 74497 35
ncRNA 75516 35
deb CDS 75644 67
ncRNA 77367 -206
fin CDS 77388
deb CDS 188712 205
ncRNA 189712 26
fin CDS 189874
deb CDS 222833 362
rRNA 223771 68
tRNA 225381 42
tRNA 225500 183
rRNA 225759 93
rRNA 228756 52
tRNA 228928 162
fin CDS 229167
deb CDS 236067 132
tRNA 236931 327
fin CDS 237335
deb CDS 238257 9
gene 238746 105
gene 239190 40
fin CDS 239419
deb CDS 247637 223
gene 248358 1
gene 250072 70
fin CDS 250898
deb CDS 252709 305
gene 253467 -32
gene 253702 56
fin CDS 254259
deb CDS 256527 57
misc_f 257829 8
mobile 257908 -753
fin CDS 257923
deb CDS 258345 55
misc_f 258676 38
fin CDS 259045
deb CDS 261503 114
tRNA 262871 -49
misc_f 262898 -34056
gene 263150 115
fin CDS 263328
deb CDS 266110 -1
gene 266553 1
gene 266776 216
fin CDS 267184
deb CDS 269289 23
mobile 270206 -263
misc_f 270278 0
mobile 270541 -1159
deb CDS 270603 7
mobile 271762 -427
misc_f 271764 389
ncRNA 272580 192
deb CDS 272847 -38
mobile 273955 -1049
fin CDS 274101
deb CDS 277756 11
gene 278814 0
mobile 279163 -753
fin CDS 279178
deb CDS 279600 55
gene 279931 -174
mobile 279931 2
gene 280114 -249
mobile 280114 -41
fin CDS 280385
deb CDS 290510 -5
mobile 290634 -753
fin CDS 290649
deb CDS 313141 473
gene 313716 551
gene 314357 -16
mobile 315229 -1193
fin CDS 315291
deb CDS 315587 -4
gene 316450 302
gene 317439 158
fin CDS 317726
deb CDS 380069 1
misc_f 380844 -1
mobile 381260 -1240
fin CDS 381351
deb CDS 381674 11
misc_f 382591 -134
fin CDS 382739
deb CDS 388753 523
misc_f 390251 -117
deb CDS 391592 60
mobile 391709 -1228
fin CDS 391739
deb CDS 392602 68
misc_f 392970 87
fin CDS 394506
deb CDS 408177 147
gene 408609 -4
fin CDS 408947
deb CDS 475982 76
ncRNA 476448 110
fin CDS 476672
deb CDS 506603 121
ncRNA 507204 -2
fin CDS 507286
deb CDS 527581 -1
gene 527949 -20
gene 528640 366
gene 529497 52
fin CDS 529645
deb CDS 563848 242 comp
tRNA 564723 -45
misc_f 564755 -21242
deb CDS 564815 -121
gene 565858 18
gene 566098 14
gene 566376 -4
misc_f 566684 0
mobile 566777 -1193
fin CDS 566842
deb CDS 567138 30
misc_f 568035 67
fin CDS 568315
deb CDS 573956 189
misc_f 574529 4
mobile 574591 -1049
deb CDS 574737 68
misc_f 575786 572
fin CDS 577398
deb CDS 580834 -26
gene 581354 -129
deb CDS 581534 54
gene 582152 68
fin CDS 582875
deb CDS 606265 350
ncRNA 607734 43
deb CDS 607836 18
mobile 608007 -1287
fin CDS 608065
deb CDS 657555 92
gene 658031 128
fin CDS 658947
deb CDS 685929 11
ncRNA 686681 -5
deb CDS 686839 103
mobile 687851 -1049
fin CDS 687997
deb CDS 695101 153
tRNA 696430 37 comp
tRNA 696542 47 comp
tRNA 696664 15 comp
tRNA 696756 34 comp
tRNA 696865 23 comp
tRNA 696963 9 comp
tRNA 697057 379 comp
fin CDS 697513 comp
deb CDS 715412 40
gene 715947 123
gene 716721 75
fin CDS 716946
deb CDS 733776 117
gene 734220 -4
fin CDS 735650
deb CDS 736445 200
gene 736900 130
fin CDS 738092
deb CDS 764180 0
ncRNA 765050 2
fin CDS 765153
deb CDS 779598 164
tRNA 780554 135
tRNA 780765 2
tRNA 780843 149
tRNA 781068 3
tRNA 781147 146
tRNA 781369 132
tRNA 781577 432
fin CDS 782085
deb CDS 851014 127
ncRNA 852725 -196
fin CDS 852869
deb CDS 887423 19
ncRNA 887979 76
fin CDS 888134
deb CDS 923264 343
tRNA 925884 253 comp
fin CDS 926225 comp
deb CDS 1030759 206 comp
tRNA 1031625 426 comp
fin CDS 1032139
deb CDS 1049439 33
mobile 1049778 -713
fin CDS 1049833
deb CDS 1079305 542
gene 1081356 57
fin CDS 1082243
deb CDS 1092876 10
mobile 1094245 -1228
fin CDS 1094275
deb CDS 1095138 106
gene 1095544 -4
deb CDS 1095843 735
tRNA 1097565 233 comp
fin CDS 1097886
deb CDS 1146011 -7
ncRNA 1146589 36
fin CDS 1146794
deb CDS 1195123 -165
misc_f 1196209 -14546
fin CDS 1196867
deb CDS 1203822 9
gene 1204170 -234
deb CDS 1204170 -1137
gene 1204401 11
fin CDS 1205549
eco2 adresses2
deb-fin gènes adresses intercal sens
deb CDS 1205731 -74
gene 1206131 -10
fin CDS 1206913
deb CDS 1208517 -1
gene 1209119 29
fin CDS 1209685
deb CDS 1210346 233
gene 1211413 102
fin CDS 1211680
deb CDS 1218983 399
gene 1219601 56
fin CDS 1222305
deb CDS 1223264 114
gene 1223564 371
fin CDS 1224279
deb CDS 1238879 238
mobile 1240188 -30
fin CDS 1240260
deb CDS 1269168 47
ncRNA 1269323 313
deb CDS 1269703 47
ncRNA 1269858 314
deb CDS 1270238 47
ncRNA 1270393 288
fin CDS 1270749
deb CDS 1286709 81
ncRNA 1287066 -150
deb CDS 1287087 67 comp
tRNA 1287244 209 comp
tRNA 1287538 159 comp
fin CDS 1287782 comp
deb CDS 1293527 281
gene 1294426 -897
mobile 1294426 40
fin CDS 1295446
deb CDS 1298598 253
mobile 1299499 -1127
fin CDS 1299567
deb CDS 1380148 13
gene 1380821 -1
gene 1381789 44
fin CDS 1381947
deb CDS 1394891 121
mobile 1396044 -1127
fin CDS 1396112
deb CDS 1404741 8
ncRNA 1405658 227
fin CDS 1405979
deb CDS 1408050 95
ncRNA 1409129 57
fin CDS 1409308
deb CDS 1411013 -50
misc_f 1411899 -22959
fin CDS 1412000
deb CDS 1413531 -185
ncRNA 1413556 -2
fin CDS 1413733
deb CDS 1422752 32
gene 1423345 -245
fin CDS 1423400
deb CDS 1426454 -94
misc_f 1427389 0
mobile 1427599 -1049
deb CDS 1427746 69
misc_f 1428796 64
fin CDS 1429049
deb CDS 1434293 551
gene 1434958 176
fin CDS 1435185
deb CDS 1435760 227
ncRNA 1437121 28
fin CDS 1437260
deb CDS 1465165 161
misc_f 1465392 0
mobile 1467910 -1320
fin CDS 1467921
deb CDS 1468784 96
misc_f 1469246 0
mobile 1469296 -1159
deb CDS 1469358 9
misc_f 1470519 207
fin CDS 1474221
deb CDS 1488232 41
gene 1489713 188
deb CDS 1490902 9
ncRNA 1491442 170
fin CDS 1491677
deb CDS 1491962 -11
ncRNA 1492119 295
fin CDS 1492470
deb CDS 1502457 35
mobile 1503161 -1691
gene 1503218 67
fin CDS 1503717
deb CDS 1526940 737
gene 1527890 -17
fin CDS 1529922
deb CDS 1530319 81
gene 1530586 176
fin CDS 1531816
deb CDS 1542672 323
gene 1544384 38
fin CDS 1544758
deb CDS 1588853 332
gene 1590334 317
fin CDS 1590854
deb CDS 1592176 222
gene 1592665 530
fin CDS 1598617
deb CDS 1622741 -29
ncRNA 1622817 45
fin CDS 1622960
deb CDS 1631002 -9
misc_f 1632277 -19856
fin CDS 1632890
deb CDS 1648823 340
ncRNA 1649382 174
fin CDS 1649609
deb CDS 1649794 92
gene 1650078 -156
mobile 1650843 -668
gene 1650881 -26
gene 1651512 19
fin CDS 1652728
deb CDS 1744871 307 comp
tRNA 1746435 4
tRNA 1746516 107
fin CDS 1746700
deb CDS 1764018 326
ncRNA 1764713 153
fin CDS 1764934
deb CDS 1769074 185
ncRNA 1770372 137
fin CDS 1770615
deb CDS 1800642 523
gene 1803094 171
fin CDS 1805165
deb CDS 1922313 96
ncRNA 1923066 -234
ncRNA 1923104 157
fin CDS 1923365
deb CDS 1957032 308
ncRNA 1958441 -1
fin CDS 1958520
deb CDS 1973360 -1674
gene 1973360 4
fin CDS 1975329
deb CDS 1977847 305
mobile 1978503 -753
fin CDS 1978518
deb CDS 1990954 128 comp
ncRNA 1991748 0 comp
tRNA 1991815 12 comp
tRNA 1991914 54 comp
tRNA 1992042 151 comp
fin CDS 1992269 comp
deb CDS 1996110 88
ncRNA 1996921 4
fin CDS 1997062
deb CDS 2010600 143
gene 2011223 150
misc_f 2012502 -162
gene 2012502 -81
fin CDS 2012700
deb CDS 2024986 9
ncRNA 2025223 197
fin CDS 2025511
deb CDS 2033119 164
ncRNA 2033649 311
gene 2034051 591
fin CDS 2035835
deb CDS 2042368 569
tRNA 2043468 93 comp
deb CDS 2043651 100
tRNA 2044549 313
deb CDS 2044938 261
gene 2052276 314
fin CDS 2053643
deb CDS 2056858 452
tRNA 2058027 100 comp
deb CDS 2058203 4 comp
tRNA 2059851 37
fin CDS 2059964 comp
deb CDS 2061016 326 comp
tRNA 2062260 55
fin CDS 2062391 comp
deb CDS 2065219 255
misc_f 2066020 -12681
gene 2066068 4
mobile 2066159 -1049
deb CDS 2066305 74
gene 2067360 368
gene 2068261 215
misc_f 2068635 0
mobile 2068941 -1320
fin CDS 2068952
deb CDS 2069815 96
misc_f 2070277 311
gene 2070786 105
ncRNA 2071317 27
fin CDS 2071539
deb CDS 2077940 414
gene 2078549 -103
fin CDS 2078575
deb CDS 2099862 127
misc_f 2101396 4
mobile 2101749 -1049
deb CDS 2101895 68
misc_f 2102944 1
fin CDS 2103391
deb CDS 2152469 182
ncRNA 2153311 -106
deb CDS 2153349 237
ncRNA 2153646 -101
fin CDS 2153681
deb CDS 2165668 84
ncRNA 2167114 -18
misc_f 2167183 -510
deb CDS 2167302 81
gene 2167602 168
fin CDS 2167989
deb CDS 2168712 81
misc_f 2169693 3
mobile 2170171 -1193
fin CDS 2170236
eco3 adresses3
deb-fin gènes adresses intercal sens
deb CDS 2170532 30
misc_f 2171429 105
deb CDS 2171833 47
gene 2172921 3
fin CDS 2174282
deb CDS 2196474 111
gene 2197410 9
fin CDS 2200279
deb CDS 2226509 52
gene 2227323 223
fin CDS 2228982
deb CDS 2284376 74
tRNA 2286211 102
misc_f 2286390 4
mobile 2288919 -1049
deb CDS 2289065 68
misc_f 2290114 319
fin CDS 2290500
deb CDS 2311646 334
ncRNA 2313084 311
fin CDS 2313488
deb CDS 2328148 0
gene 2329798 -67
fin CDS 2334336
deb CDS 2348822 214
gene 2349687 41
fin CDS 2349935
deb CDS 2356904 12
gene 2357816 40
fin CDS 2358042
deb CDS 2451584 19
gene 2452356 81
fin CDS 2455083
deb CDS 2465301 75
tRNA 2466309 -15
misc_f 2466369 -10039
fin CDS 2466545
deb CDS 2470497 159
gene 2470803 -29
deb CDS 2471077 26
gene 2471544 49
fin CDS 2472112
deb CDS 2476310 73
gene 2476584 95
fin CDS 2476694
deb CDS 2513042 28
mobile 2514273 -1287
fin CDS 2514331
deb CDS 2515643 208
tRNA 2518041 39 comp
tRNA 2518156 235 comp
fin CDS 2518467 comp
deb CDS 2519257 258 comp
tRNA 2520931 44
tRNA 2521051 46
tRNA 2521173 4
tRNA 2521253 264
fin CDS 2521593 comp
deb CDS 2557318 11
misc_f 2558691 -6623
fin CDS 2558858
deb CDS 2639301 19
ncRNA 2640595 -1
fin CDS 2640686
deb CDS 2652494 515
ncRNA 2653855 -2
fin CDS 2654157
deb CDS 2689671 58
ncRNA 2691157 315
fin CDS 2691656
deb CDS 2700117 322
ncRNA 2700520 19
fin CDS 2700618
deb CDS 2725925 81
rRNA 2726069 92 comp
rRNA 2726281 184 comp
tRNA 2729369 171 comp
rRNA 2729616 442 comp
fin CDS 2731600 comp
deb CDS 2731600 -21
ncRNA 2734153 7
fin CDS 2734303
deb CDS 2754896 214
ncRNA 2755593 -15
misc_f 2755941 -21813
fin CDS 2756159
deb CDS 2771840 12
gene 2772167 135
deb CDS 2773318 523
gene 2775545 102
fin CDS 2775919
deb CDS 2777453 189
gene 2777972 160
deb CDS 2778146 338
gene 2783065 333
fin CDS 2783638
deb CDS 2784529 750 comp
tRNA 2785762 559 comp
gene 2786397 335
fin CDS 2788985
deb CDS 2807132 191
gene 2808316 123
fin CDS 2809617
deb CDS 2814218 68
ncRNA 2814802 8
fin CDS 2814883
deb CDS 2816937 280 comp
tRNA 2817784 198 comp
tRNA 2818059 62 comp
tRNA 2818198 198 comp
tRNA 2818473 3 comp
tRNA 2818553 315 comp
fin CDS 2818961 comp
deb CDS 2884553 133
ncRNA 2887353 169
fin CDS 2887578
deb CDS 2923784 42
ncRNA 2924156 210
fin CDS 2924735
deb CDS 2941650 128
ncRNA 2942696 16
fin CDS 2942918
deb CDS 2946081 208 comp
tRNA 2947387 33
tRNA 2947497 33
tRNA 2947607 73
fin CDS 2947757 comp
deb CDS 2973855 87
ncRNA 2976102 114
ncRNA 2976304 213
fin CDS 2976599
deb CDS 2989935 193
gene 2990554 224
fin CDS 2991268
deb CDS 2993638 82
gene 2993939 18
gene 2994460 33
gene 2994937 221
gene 2995314 -59
gene 2995962 0
mobile 2996361 -1320
fin CDS 2996372
deb CDS 2997235 88
gene 2997689 45
deb CDS 2998034 155 comp
tRNA 2998984 78 comp
fin CDS 2999136 comp
deb CDS 3055612 41
ncRNA 3055983 75
deb CDS 3056241 61
ncRNA 3056851 -102
fin CDS 3056890
deb CDS 3058666 55
gene 3059381 141
fin CDS 3059753
deb CDS 3109553 105
tRNA 3110366 148
fin CDS 3110590 comp
deb CDS 3129043 -70
mobile 3130146 -1127
fin CDS 3130214
deb CDS 3146450 118
gene 3146856 -95
fin CDS 3147597
deb CDS 3185414 59
misc_f 3186025 0
mobile 3186096 -1240
fin CDS 3186187
deb CDS 3186510 16
misc_f 3187432 15
fin CDS 3189881
deb CDS 3192864 195
ncRNA 3194721 -100
deb CDS 3194766 271
ncRNA 3195097 -100
fin CDS 3195141
deb CDS 3214967 124 comp
tRNA 3215598 53
fin CDS 3215727 comp
deb CDS 3268415 613
ncRNA 3270216 32
fin CDS 3270625
deb CDS 3280217 10
gene 3280701 19
gene 3281122 350
fin CDS 3281976
deb CDS 3309033 14
ncRNA 3311183 16
fin CDS 3311415
deb CDS 3317554 206 comp
tRNA 3318213 347 comp
fin CDS 3318637
deb CDS 3319988 458 comp
tRNA 3322072 14 comp
fin CDS 3322173 comp
deb CDS 3349806 117
ncRNA 3350577 -9
fin CDS 3350689
deb CDS 3362807 -4
misc_f 3365185 0
mobile 3365556 -1049
deb CDS 3365702 72
misc_f 3366755 -4
fin CDS 3366926
deb CDS 3403484 36
gene 3404495 0
gene 3404638 404
fin CDS 3405436
deb CDS 3418390 430
gene 3419042 67
fin CDS 3420134
deb CDS 3422436 228
rRNA 3423423 37
tRNA 3423580 12
rRNA 3423668 92
rRNA 3423880 174
tRNA 3426958 42
tRNA 3427076 68
rRNA 3427221 473
fin CDS 3429236
deb CDS 3558268 -19
gene 3559848 16
fin CDS 3560622
eco4 adresses4
deb-fin gènes adresses intercal sens
deb CDS 3579768 116
ncRNA 3580922 121
fin CDS 3581138
deb CDS 3581863 -4
misc_f 3583038 0
mobile 3583428 -713
fin CDS 3583483
deb CDS 3583677 24
misc_f 3584205 94
fin CDS 3584404
deb CDS 3623399 104
gene 3623887 245
fin CDS 3624378
deb CDS 3630968 261
gene 3632852 382
fin CDS 3634841
deb CDS 3647705 274
ncRNA 3648063 149
ncRNA 3648294 152
fin CDS 3648528
deb CDS 3650237 628
misc_f 3651291 -1
mobile 3652036 -1049
deb CDS 3652182 73
misc_f 3653236 247
fin CDS 3653961
deb CDS 3656995 417
ncRNA 3657985 311
deb CDS 3658366 98
ncRNA 3658992 149
fin CDS 3659232
deb CDS 3663890 245
ncRNA 3664864 16
fin CDS 3664986
deb CDS 3692618 -4
gene 3695233 11
fin CDS 3695997
deb CDS 3699980 48
ncRNA 3700136 363
fin CDS 3700563
deb CDS 3706098 910 comp
tRNA 3708616 91 comp
fin CDS 3708784 comp
deb CDS 3720448 -153
gene 3720448 0
mobile 3720633 -1396
fin CDS 3720680
deb CDS 3721198 26
gene 3722076 222
fin CDS 3722328
deb CDS 3750086 31
gene 3750813 3
gene 3750918 18
fin CDS 3751128
deb CDS 3766337 41
gene 3767221 254
deb CDS 3768177 0
gene 3768639 1
gene 3768892 88
deb CDS 3769345 267
gene 3769948 96
fin CDS 3770243
deb CDS 3807064 67
ncRNA 3808166 301
fin CDS 3808540
deb CDS 3834547 292 comp
tRNA 3836222 108
gene 3836425 396
fin CDS 3836953
deb CDS 3852890 129
ncRNA 3853118 -73
ncRNA 3853118 295
fin CDS 3853553
deb CDS 3860283 -4
gene 3861173 -1
fin CDS 3861349
deb CDS 3923744 110
rep_or 3925744 36
fin CDS 3926012
deb CDS 3940635 480 comp
rRNA 3941808 85
tRNA 3943435 193
rRNA 3943704 92
rRNA 3946700 52
tRNA 3946872 8
tRNA 3946957 95
fin CDS 3947128 comp
deb CDS 3950507 2
gene 3950560 -4
fin CDS 3952201
deb CDS 3959532 198
gene 3960012 216
fin CDS 3960677
deb CDS 3980887 102
tRNA 3982375 57
tRNA 3982509 20
tRNA 3982606 42
tRNA 3982735 146
fin CDS 3982958
deb CDS 3984352 424
ncRNA 3986432 82
fin CDS 3986686
deb CDS 4019624 -252
ncRNA 4019978 -4
fin CDS 4020226
deb CDS 4034608 377
rRNA 4035531 68
tRNA 4037141 42
tRNA 4037260 183
rRNA 4037519 93
rRNA 4040517 269
fin CDS 4040906
deb CDS 4046966 146
ncRNA 4049899 123
deb CDS 4050133 270
ncRNA 4051036 65
fin CDS 4051347
deb CDS 4105820 9
ncRNA 4106330 81
fin CDS 4106469
deb CDS 4156850 54
ncRNA 4158278 95
fin CDS 4158490
deb CDS 4165428 373
rRNA 4166659 171
tRNA 4168372 193
rRNA 4168641 92
rRNA 4171637 300
fin CDS 4172057
deb CDS 4174076 361 comp
tRNA 4175388 8
tRNA 4175472 116
tRNA 4175673 6
tRNA 4175754 114
fin CDS 4175944
deb CDS 4189786 1
ncRNA 4190327 247
fin CDS 4190735
deb CDS 4205943 614
rRNA 4208147 85
tRNA 4209774 193
rRNA 4210043 93
rRNA 4213040 74
fin CDS 4213234
deb CDS 4249554 228
gene 4250703 222
fin CDS 4252506
deb CDS 4262840 56
ncRNA 4263139 -2
fin CDS 4263248
deb CDS 4277469 -8
ncRNA 4277926 412
fin CDS 4278479
deb CDS 4321697 20
gene 4322443 54
fin CDS 4323336
deb CDS 4360396 256
gene 4362191 197
tRNA 4362551 106 comp
fin CDS 4362733 comp
deb CDS 4391604 210
tRNA 4392360 36
tRNA 4392472 35
tRNA 4392583 233
fin CDS 4392892 comp
deb CDS 4426628 271
gene 4427694 -17
fin CDS 4428079
deb CDS 4457959 176
gene 4459488 44
fin CDS 4459900
deb CDS 4495190 195 comp
tRNA 4496405 185
misc_f 4496675 -1191
gene 4496750 240
mobile 4498181 -1240
fin CDS 4498272
deb CDS 4498595 92
gene 4499593 468
deb CDS 4501260 500
mobile 4502090 -1413
fin CDS 4502103
deb CDS 4506448 52
gene 4506626 4
gene 4506861 15
mobile 4507125 -262
misc_f 4507197 7
mobile 4507459 -1214
deb CDS 4507466 62
mobile 4508680 -323
gene 4508684 64
mobile 4509007 -793
misc_f 4509009 -1
misc_f 4509479 10
gene 4509804 556
fin CDS 4510690
deb CDS 4518372 31
mobile 4518472 -713
deb CDS 4518527 -82
gene 4518721 113
fin CDS 4519338
deb CDS 4527549 -4
ncRNA 4527977 44
fin CDS 4528111
deb CDS 4530530 398
gene 4532050 126
fin CDS 4532437
deb CDS 4533796 376
gene 4534430 339
gene 4535015 565
fin CDS 4536597
deb CDS 4567287 478
gene 4568998 243
fin CDS 4570162
deb CDS 4572414 203
gene 4574135 56
fin CDS 4576912
deb CDS 4579499 -6
ncRNA 4579835 156
fin CDS 4580068
deb CDS 4605804 38
tRNA 4606079 34 comp
tRNA 4606200 28 comp
tRNA 4606315 267 comp
fin CDS 4606669 comp

eco intercalaires tRNA[modifier | modifier le wikicode]

  • Lien tableur: eco intercalaires tRNA
  • Légende:
    - comp', l'intercalaire est entre un gène comp (sur le complément) et un gène sur le brin direct. Continu les 2 gènes sont sur le même brin.
    - deb, fin sont les intercalaires des cds du tableau précédent, autres intercalaires: respectivement dans le sens des adresses croissantes, le cds avant le 1er tRNA et le cds après le dernier tRNA du bloc.
  • Cumuls comp'+continu du tableau
	deb	fin	total
<201	16	18	34
total	35	29	64
taux	46%	62%	53%
eco intercalaires tRNA
eco les relevés deb-fin
comp’ entre tRNAs comp’ deb comp’ fin
162
132 327
114
comp’ 242
6 aas 37 47 15 34 23 9 comp’ 153 379
6 aas 135 2 149 3 146 132 164 432
comp’ 343 253
206 comp’ 426
comp’ 735 comp’ 233
209 67 159
4 comp’ 307 107
12 54 128 151
comp’ 569 comp’ 93
100 313
comp’ 452 100
comp’ 4 comp’ 37
comp’ 326 comp’ 55
74
75
39 comp’ 208 235
44 46 4 comp’ 258 comp’ 264
750
4 aas 198 62 198 3 280 315
comp’ 208 comp’ 73
33 33 155 78
105 comp’ 148
comp’ 124 comp’ 53
206 comp’ 347
458 14
910 91
comp’ 292
8 comp’ 95
57 20 42 102 146
8 116 6 comp’ 361 114
106
36 35 210 comp’ 233
comp’ 195
34 28 comp’ 38 267
eco intercalaires inférieures à 201 pbs
deb fin continu cumuls
67 14
74 78
75 91 deb
100 100 <201 11
102 106 total 18
105 107 taux 61%
114 114
128 146 fin
132 151 <201 11
155 159 total 19
164 162 taux 58%
206 235
206 253 total
210 267 <201 22
280 313 total 37
458 315 taux 59%
750 327
910 379
- 432 comp’ cumuls
4 37
38 53
124 55 deb
153 73 <201 5
195 93 total 17
208 95 taux 29%
208 148
242 233 fin
258 264 <201 7
292 347 total 10
307 - taux 70%
326 -
343 - total
361 - <201 12
452 - total 27
569 - taux 44%
735 -

eco intercalaires rRNA[modifier | modifier le wikicode]

  • Voir la présentation des blocs à rRNA dans le chapitre eco blocs de l'étude préliminaire. A comparer avec le tableau eco autres intercalaires.
  • Remarque: Quand le 16s n'est pas précédé de tRNAs l'intercalaire cds-16s est élevé, pour les 6 blocs d'eco on a 362 442 480 377 373 614 pbs. L'intercalaire cds-bloc de l'autre côté du bloc est beaucoup plus faible, respectivement 162 81 95 269 300 74 pbs. Cette orientation est quasiment générale chez tous les génomes que j'ai étudié ici. Je l'ai notée dans les chapitres génome-bloc de chaque génome.
  • Note: J'ai supposé souvent que les blocs à tRNA sans rRNA sont aussi orientés de l'intercalaire le plus grand au plus petit. Dans eco cumuls et de même pour les autres génomes, j'ai noté cette orientation dans la colonne cdsd, pour cds dirigé. Je n'ai conservé pour les calculs que le plus petit intercalaire des 2 cds bordant le bloc. L'idée était que cette orientation provoquait la création du cds en fin de bloc. Ces cds sont souvent de petites protéines et souvent hypothétiques. Aussi je présente ci-dessous la transformation deb-fin qui est imposée par l'adressage en intercalaire plus grand et plus petit.
deb	fin		tri	grand	petit
132	327		23	458	14
153	379		13	4	37
164	432		21	124	53
343	253		14	326	55
206	426		18	208	73
735	233		19	155	78
67	159		24	910	91
307	107		10	569	93
128	151		12	452	100
569	93		8	307	107
100	313		26	361	114
452	100		25	102	146
4	37		20	105	148
326	55		9	128	151
208	235		7	67	159
258	264		6	735	233
280	315		27	210	233
208	73		15	208	235
155	78		4	343	253
105	148		16	258	264
124	53		28	38	267
206	347		11	100	313
458	14		17	280	315
910	91		1	132	327
102	146		22	206	347
361	114		2	153	379
210	233		5	206	426
38	267		3	164	432

362 162

442 81

480 95

377 269

373 300

614 74

Escherichia coli Nissle 1917[modifier | modifier le wikicode]

ecoN opérons[modifier | modifier le wikicode]

  • Liens: gtRNAdb [63], NCBI [64], génome [65]
  • Lien tableur: ecoN opérons
  • Phylogénie: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia.
  • Légende: cdsa: cds aas, cdsd: cds dirigé
G7. Escherichia coli Nissle 1917
50%GC 21.8.19 Paris  123   doubles intercal cds aa avec aa cdsa cdsd protéines
231864..232436 CDS 365 365 191 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
232802..234321 16s 73 1520
234395..234471 gaa 12 12
234484..234557 gca 174
234732..237319 23s 83 2588
237403..237518 5s 54 116
237573..237649 gac 162 162 162
237812..238615 CDS 268 2,5-didehydrogluconate reductase DkgB
244934..245665 CDS 132 132 244 DNA polymerase III subunit epsilon
245798..245874 gac 120 120 120
comp 245995..246852 CDS 286 DUF4942 domain-containing protein
367329..368582 CDS 114 114 418 114 glutamate-5-semialdehyde dehydrogenase
368697..368772 acg 154 154
368927..369265 CDS 113 DUF4102 domain-containing protein
comp 631149..632015 CDS 270 270 289 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
632286..632362 aga 15 15 15
comp 632378..632997 CDS 207 tyrosine-type recombinase/integrase
733188..734363 CDS 153 153 392 153 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
comp 734517..734591 cag + 37 37
comp 734629..734703 cag 2 cag 48 48
comp 734752..734828 atgj 2 atgj 15 15
comp 734844..734918 caa 2 caa 34 34
comp 734953..735027 caa 23 23
comp 735051..735135 cta 10 10
comp 735146..735222 atgj 380 380
comp 735603..737267 CDS 555 asparagine synthase B
807377..808169 CDS 164 164 264 164 Pseudo, cell division protein CpoB
808334..808409 aaa + 35 35
808445..808520 gta 5 aaa 2 2
808523..808598 aaa 2 gta 51 51
808650..808725 gta 3 3
808729..808804 aaa 48 48
808853..808928 aaa 33 33
808962..809037 aaa 277 277
809315..810358 CDS 348 quinolinate synthase NadA
950069..952345 CDS 343 343 759 343 ATP-dependent Clp protease ATP-binding subunit ClpA
comp 952689..952776 tcc 253 253
comp 953030..953248 CDS 73 translation initiation factor IF-1
comp 1047224..1047883 CDS 206 206 220 206 FtsH protease modulator YccA
comp 1048090..1048177 tca 426 426
1048604..1049722 CDS 373 hydrogenase 1 small subunit
1183656..1184018 CDS 463 463 121 hp
1184482..1184558 aga 278 278 278
> comp 1184837..1185786 CDS 317 Pseudo, IS4 family transposase
1213982..1214809 CDS 165 165 276 165 DUF4942 domain-containing protein
comp 1214975..1215062 tcc 233 233
1215296..1216234 CDS 313 glyoxylate/hydroxypyruvate reductase GhrA
1216817..1217098 CDS 165 165 94 165 DUF4942 domain-containing protein
comp 1217264..1217351 tcc 234 234
1217586..1218524 CDS 313 glyoxylate/hydroxypyruvate reductase GhrA
1457038..1458129 CDS 16 16 364 16 acyl-CoA desaturase
comp 1458146..1458277 ncRNA 46 44 RtT sRNA
comp 1458324..1458408 tac + 33 33
comp 1458442..1458526 tac 2 tac 159 159
comp 1458686..1459528 CDS 281 formyltetrahydrofolate deformylase
comp 1829066..1830322 CDS 307 307 419 hp
1830630..1830706 gtc + 4 4
1830711..1830787 gtc 2 gtc 6 6 6
< 1830794..1831177 CDS @4 128 Pseudo, multidrug efflux MATE transporter MdtK
comp 1831218..1832474 CDS 307 307 419 hp
1832782..1832858 gtc + 4 4
1832863..1832939 gtc 2 gtc 8 8 8
< 1832948..1833280 CDS 111 Pseudo, MATE family efflux transporter
comp 1833321..1834577 CDS 307 307 419 hp
1834885..1834961 gtc + 4 4
1834966..1835042 gtc 2 gtc 108 108 108
1835151..1835456 CDS 102 monooxygenase
comp 2115794..2116459 CDS 195 195 222 UPF0149 family protein YecA
comp 2116655..2116741 tta 12 12
comp 2116754..2116827 tgc 53 53
comp 2116881..2116956 ggc 151 151 151
comp 2117108..2117656 CDS 183 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
comp 2191451..2192287 CDS 278 278 279 hp
comp 2192566..2192655 tcg 93 93 93
2192749..2193546 CDS 100 100 266 100 DgsA anti-repressor MtfA
2193647..2193722 aac 161 161
2193884..2195146 CDS 421 tyrosine-type recombinase/integrase
2232607..2233323 CDS 453 453 239 YebC/PmpR family DNA-binding transcriptional regulator
comp 2233777..2233852 acc 326 326 326
2234179..2235096 CDS 306 nitrogen assimilation transcriptional regulator
2235198..2236148 CDS 37 37 317 HTH-type transcriptional regulator Cbl
comp 2236186..2236261 aac 4 4 4
2236266..2237909 CDS 100 100 548 100 toxic metabolite efflux MATE transporter YeeO
2238010..2238085 aac 161 161
2238247..2239518 CDS 424 tyrosine-type recombinase/integrase
2546968..2548728 CDS 74 74 587 74 cardiolipin transport protein PbgA
2548803..2548879 ccc 101 101
comp 2548981..2549136 CDS 52 autotransporter outer membrane beta-barrel domain-containing protein
2717780..2718712 CDS 75 75 311 75 formate/nitrite transporter family protein
2718788..2718862 agg 437 437
comp 2719300..2719830 CDS 177 OmpH family outer membrane protein
comp 2768744..2770933 CDS 206 206 730 206 sensor domain-containing phosphodiesterase
comp 2771140..2771215 gcc + 39 39
comp 2771255..2771330 gcc 2 gcc 220 220
2771551..2771910 CDS 120 putative DNA-binding transcriptional regulator
comp 2772355..2773770 CDS 258 258 472 glutamate--tRNA ligase
2774029..2774104 gta + 43 43
2774148..2774223 gta 3 gta 46 46
2774270..2774345 gta 4 4
2774350..2774425 aaa 110 110 110
comp 2774536..2775420 CDS 295 LysR family transcriptional regulator
comp 2959205..2960503 CDS 323 323 433 323 alpha-ketoglutarate permease
comp 2960827..2960942 5s 83 116
comp 2961026..2965477 23s 184 4452
comp 2965662..2965737 gaa 431
comp 2966169..2967720 16s 441 441 1552
comp 2968162..2970735 CDS 858 ATP-dependent chaperone ClpB
comp 3027207..3027773 CDS 280 280 189 280 fructose-1-phosphate/6-phosphogluconate phosphatase
comp 3028054..3028130 cgt + 63 63
comp 3028194..3028270 cgt 5 cgt 62 62
comp 3028333..3028409 cgt 62 62
comp 3028472..3028548 cgt 64 64
comp 3028613..3028689 cgt 3 3
comp 3028693..3028785 agc 315 315
comp 3029101..3029286 CDS 62 carbon storage regulator CsrA
comp 3157337..3158434 CDS 208 208 366 208 murein transglycosylase A
3158643..3158719 atgf + 33 33
3158753..3158829 atgf 3 atgf 33 33
3158863..3158939 atgf 635 635
3159575..3160075 CDS 167 type VI secretion system contractile sheath small subunit
3230172..3231401 CDS 316 316 410 HAAAP family serine/threonine permease
comp 3231718..3231791 ggg 78 78 78
comp 3231870..3232625 CDS 252 peptidoglycan DD-metalloendopeptidase family protein
3341048..3341755 CDS 105 105 236 105 DUF554 domain-containing protein
3341861..3341936 ttc 197 197
3342134..3343399 CDS 422 integrase arm-type DNA-binding domain-containing protein
comp 3569308..3569814 CDS 124 124 169 G/U mismatch-specific DNA glycosylase
3569939..3570014 atgi 53 53 53
comp 3570068..3570832 CDS 255 NADPH-dependent ferric chelate reductase
comp 3670227..3670679 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3670886..3670962 atgf 347 347
> 3671310..3672155 CDS 282 Pseudo, argininosuccinate synthase
comp 3673935..3674387 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3674594..3674670 atgf 347 347
> 3675018..3675869 CDS 284 Pseudo, argininosuccinate synthase
comp 3677794..3678246 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3678453..3678529 atgf 347 347
> 3678877..3679722 CDS 282 Pseudo, argininosuccinate synthase
comp 3681532..3681984 CDS 206 206 151 206 ribosome maturation factor RimP
comp 3682191..3682267 atgf 347 347
3682615..3683958 CDS 448 argininosuccinate synthase
comp 3683966..3685591 CDS 456 456 542 phosphoethanolamine transferase
comp 3686048..3686134 ctc 14 14 14
comp 3686149..3686481 CDS 111 preprotein translocase subunit SecG
3784553..3785311 CDS 62 62 253 62 amino acid ABC transporter ATP-binding protein
comp 3785374..3785489 5s @3 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360 1360
3789989..3790543 CDS 185 gamma carbonic anhydrase family protein
comp 4078635..4080242 CDS 743 743 536 dipeptide ABC transporter substrate-binding protein DppA
comp 4080986..4081062 ccg 91 91 91
comp 4081154..4082845 CDS 564 kdo(2)-lipid A phosphoethanolamine 7-transferase
comp 4205966..4207348 CDS 292 292 461 292 glycoside-pentoside-hexuronide family transporter
4207641..4207735 tga 300 300
> 4208036..4208857 CDS 274 Pseudo, DUF4102 domain-containing protein
comp 4338643..4339335 CDS 479 479 231 FadR family transcriptional regulator
4339815..4341342 16s 73 1528
4341416..4341491 gaa 184
4341676..4344286 23s 83 2611
4344370..4344485 5s 53 116
4344539..4344615 gac 8
4344624..4344699 tgg 95 95 95
comp 4344795..4345634 CDS 280 HTH-type transcriptional regulator HdfR
4377681..4379066 CDS 102 102 462 102 amino acid permease
4379169..4379245 cgg 58 58
4379304..4379379 cac 20 20
4379400..4379486 ctg 42 42
4379529..4379605 cca 146 146
4379752..4380987 CDS 412 anaerobic sulfatase maturase
4460971..4461516 CDS 377 377 182 menaquinone-dependent protoporphyrinogen IX dehydrogenase
4461894..4463631 16s 56 1738
4463688..4463764 atc 42 42
4463807..4463882 gca 165
4464048..4467338 23s 83 3291
4467422..4467537 5s 104 104 116 104
comp 4467642..4468169 CDS 176 molybdopterin-guanine dinucleotide biosynthesis protein B
4605577..4606434 CDS 374 374 286 glutamate racemase
4606809..4608362 16s 363 1554
4608726..4608801 gaa 1112
4609914..4610029 5s 136 136 116 136
4610166..4611194 CDS 343 UDP-N-acetylenolpyruvoylglucosamine reductase
comp 4612185..4613135 CDS 361 361 317 type I pantothenate kinase
4613497..4613572 aca 8 8
4613581..4613665 tac 116 116
4613782..4613856 gga 6 6
4613863..4613938 acc 114 114 114
4614053..4615237 CDS 395 elongation factor Tu
comp 4642984..4644573 CDS 616 616 530 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
4645190..4646378 16s’ @1 83 83 1189 83
4646462..4648150 CDS 436 436 563 bifunctional isocitrate dehydrogenase kinase/phosphatase
4648587..4648662 gaa 185
4648848..4651319 23s 83 2472
4651403..4651518 5s 76 76 116 76
4651595..4651978 CDS 128 hypothetical protein
< comp 4834504..4834961 CDS 197 197 153 pseudo, integrase
comp 4835159..4835234 ttc 106 106 106
comp 4835341..4835916 CDS 192 transcriptional regulator
4864628..4865173 CDS 210 210 182 210 oligoribonuclease
4865384..4865459 ggc + 36 36
4865496..4865571 ggc 3 ggc 35 35
4865607..4865682 ggc 233 233
4865916..4865969 CDS 18 hp
comp 4974178..4975197 CDS 195 195 340 NADPH-dependent aldehyde reductase Ahr
4975393..4975477 ttg 39 39 39
<> comp 4975517..4976055 CDS 180 pseudo, IS630 family transposase
5042527..5042763 CDS 38 38 79 38 DUF1435 domain-containing protein
comp 5042802..5042888 ctg + 34 34
comp 5042923..5043009 ctg 3 ctg 28 28
comp 5043038..5043124 ctg 290 290
comp 5043415..5044446 CDS 344 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
comp 5079375..5079581 CDS 117 117 69 117 AlpA family transcriptional regulator
5079699..5081218 16s 73 1520
5081292..5081368 gaa 12 12
5081381..5081454 gca 366 366
5081821..5082018 CDS 524 524 66 hypothetical protein
comp 5082543..5082754 CDS 71 hypothetical protein
comp 5090325..5090876 CDS 1808 1808 184 MarR family transcriptional regulator
comp 5092685..5092760 gaa 588 588 588
< comp 5093349..5093474 CDS 592 592 42 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
5094067..5094142 gaa + 1472 1472
5095615..5095691 atc 3 gaa 42 42
5095734..5095809 atc 2 atc 1130 1130
5096940..5097015 gaa 1145 1145
5098161..5098236 gaa 185
5098422..5100893 23s 83 2472
5100977..5101092 5s 76 76 116 76
5101169..5101552 CDS 63 63 128 hypothetical protein
comp 5101616..5102059 CDS 148 acetyltransferase
5124754..5125197 CDS 63 63 148 acetyltransferase
comp 5125261..5125644 CDS 76 76 128 hypothetical protein
comp 5125721..5125836 5s 83 116
comp 5125920..5128366 23s’ @2 -10 -10 2447 -10
< 5128357..5128479 CDS 41 pilus assembly protein
comp 5252659..5253870 CDS 300 300 404 tyrosine-type recombinase/integrase
comp 5254171..5254249 tga 292 292 292
> 5254542..5255171 CDS 210 pseudo, glycoside-pentoside-hexuronide family transporter
> comp 5305902..5306228 CDS 0 0 109 0 pseudo, hp
comp 5306229..5306302 atc 1096 1096
5307399..5308450 CDS 351 pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
comp 5321144..5321869 CDS 206 206 242 206 pseudo, histidine kinase
comp 5322076..5322151 gcc + 39 39
comp 5322191..5322266 gcc 3 gcc 39 39
comp 5322306..5322381 gcc 220 220
5322602..5322961 CDS 120 putative DNA-binding transcriptional regulator
comp 5323406..5324821 CDS 258 258 472 glutamate--tRNA ligase
5325080..5325155 gta + 44 44
5325200..5325275 gta 2 gta 0 0 0
< 5325276..5325389 CDS 38 pseudo, putative DNA-binding transcriptional regulator
> 5375524..5376270 CDS 891 891 249 891 pseudo, AI-2E family transporter
5377162..5377237 gaa 1047 1047
comp 5378285..5379589 CDS 435 isocitrate lyase
comp > 5341397..5341492 CDS -2 -2 32 -2 ABC transporter ATP-binding protein
comp 5341491..5344303 23s 174 2813
comp 5344478..5344553 gca 42 42
comp 5344596..5344672 atc 56
comp 5344729..5346282 16s 1063 1554
comp 5347346..5347421 gca 42 42
comp 5347464..5347540 atc 56
comp 5347597..5349150 16s 365 365 1554
comp 5349516..5350088 CDS 187 187 191 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
> 5350276..5350914 CDS 213 methionine ABC transporter ATP-binding protein MetN
> comp 5359583..5360512 CDS 120 120 310 tyrosine-type recombinase/integrase
comp 5360633..5360708 gca 42
comp 5360751..5360827 atc 56
comp 5360884..5362138 16s’ 1 1 1255 1
< comp 5362140..5363543 CDS 468 IS66 family transposase
5425965..5426201 CDS 38 38 79 38 DUF1435 domain-containing protein
comp 5426240..5426325 ctg + 26 26 a disparu le 20.12.19
comp 5426352..5426438 ctg 3 ctg 28 28
comp 5426467..5426553 ctg 63 63
< comp 5426617..5427150 CDS 178 pseudo, IS630-like element IS630 family transposase
> 5433568..5433687 CDS 39 39 40 39 pseudo, nicotinamide-nucleotide amidase
comp 5433727..5433814 tcc 253 253
comp 5434068..5434286 CDS 73 translation initiation factor IF-1

ecoN cumuls[modifier | modifier le wikicode]

cumuls. Escherichia coli Nissle 1917
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa gammes cdsa 300
avec rRNA opérons 12 1 0 1 5 1 5 100 16 1 0
16 23 5s 0 20 13 2 50 11 40 10 200 34 30 1
16 atc gca 2 40 17 100 17 80 7 300 29 60 6
16 gaa 235 2 60 9 4 150 16 120 16 400 18 90 8
max a 5 80 4 200 15 160 3 500 18 120 8
a doubles 1 100 0 250 14 200 4 600 8 150 7
spéciaux 8 120 1 300 14 240 9 700 0 180 11
total aas 27 140 0 350 12 280 2 800 2 210 11
sans opérons 50 160 0 400 7 320 2 900 1 240 6
1 aa 32 180 0 450 4 360 3 1000 0 270 9
max a 7 200 0 500 4 400 0 1100 0 300 12
a doubles 15 0 11 2 0 0
total aas 94 44 6 130 63 126 79
total aas 121
remarques 4
avec jaune moyenne 33 32 253 142 272 172
variance 23 15 258 145 162 79
sans jaune moyenne 31 178 127 260
variance 19 109 91 142

ecoN blocs[modifier | modifier le wikicode]

  • Lien tableur: ecoN blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - Protéines en vert, sont hypothétiques ou typées, gc anhydrase. Voir les noms longs.
ecoNb Escherichia coli Nissle 1917, ecoN blocs
ecoNb1 Escherichia coli Nissle 1917, ecoN blocs
gène interca pbs cdsa protéine
cds 365 191 D-glycero
16s 73 1520
gaa 12
gca 174
23s 83 2588
5s 54 116
gac 162
cds 268 gluDkgB
cds 323 433 glutarate pm
5s 83 116
23s 184 4452
gaa 431
16s 441 1552
cds 858 ClpB dep
cds 616 530 AICAR2
16s’ 83 1189
cds 436 563 kinase isocit
gaa 185
23s 83 2472
5s 76 116
cds 128 hp-128
cds 62 253 pu-ABC
5s 39 116
acc 14
5s 777 116
acc 14
5s 1834 116
gaa 1360
cds 185 gc anhydrase
cds 377 182 porphyrine M
16s 56 1738
atc 42
gca 165
23s 83 3291
5s 104 116
cds 176 Mlb pB
cds 479 231 FadR tr
16s 73 1528
gaa 184
23s 83 2611
5s 53 116
gac 8
tgg 95
cds 280 HdfR HTH
ecoNb2 Escherichia coli Nissle 1917, ecoN blocs
gène interca pbs cdsa protéine
cds 374 286 Glu race
16s 363 1554
gaa 1112
5s 136 116
cds 343 UDP-N
cds 117 69 tr AlpA
16s 73 1520
gaa 12
gca 366
cds 524 66 hp-66
cds 71 hp-71
cds -2 32 ABC 32
23s 174 2813
gca 42
atc 56
16s 1063 1554
gca 42
atc 56
16s 365 1554
cds 187 191 D-glycero
cds 213 ABC MetN
cds 120 310 Tyr recb 310
gca 42
atc 56
16s’ 1 1255
cds 468 IS66
cds 63 148 transferase
cds 76 128 hp-128
5s 83 116
23s’ -10 2447
cds 41 pilus
cds 1808 184 MarR
gaa 588
cds 592 42 sn-glycerol
gaa 1472
atc 42
atc 1130
gaa 1145
gaa 185
23s 83 2472
5s 76 116
cds 63 128 hp-128
cds 148 transferase
ecoNb3 ecoN rRNAs
rRNAs pbs
16s
1189
1255
1520
1520
1528
1552
1554
1554
1554
1738
23s
2447
2472
2472
2588
2611
2813
3291
4452
5s
116 x 11

ecoN remarques[modifier | modifier le wikicode]

  • Remarques: ecoN opérons
    Beaucoup de blocs à rRNAs incomplets, 7 sur 12. Parmi les 5 complets 1 est semi-complet puisqu’il manque le 5s peu important. Les 5 blocs complets sont conformes au typage des gamma, avec y atcgca gaagca gaa et avec z sans gactgg gac.
    1. @1
      - Deux 16s aux extrémités non conformes, 16s’, adresses 4645190..4646378 et 5360884..5362138 .
      - Il n’y a pas de 16s° ou de 23s° courts, apparemment ils n’ont pas laissé de traces.
      - C’est ce qui expliquerait les 7 blocs incomplets et le nombre élevé de 32 des clusters sans rRNAs et à 1 seul tRNA.
    2. @2
      - Un 23s aux extrémités non comforme, 23s’, adresse 5125920..5128366 .
      - Même remarque que pour les 16s’, mais en plus je peux attribuer le grand nombre de petits cds aux remaniements qu’ont du subir ces blocs incomplets, voir ecoN blocs.
        5128357..5128479  -10 cp 23s'
        5341397..5341492  atcgca -2
        5360884..5362138  16s’ 1
    3. @3
      - Les 5s se comportent en typage gamma même pour ceux qui sont dans un bloc incomplet. Parmi ces derniers la plupart n’ont pas de z mais dans le cluster comportant 3 5s, adresse 3785374..3785489 , on peut distinguer avec des intercalaires faibles un 5s-acc-5s et un 5s-acc, où les 5s du début appartiendraient à un bloc complet.
    4. @4
      - Parmi les 6 clusters sans rRNA et à 2 tRNAs tous sont doubles et 3 sont identiques même en intercalaires, les 3 gtc. Les 3 autres sont gta tac et gcc.
      - Parmi les 6 clusters sans rRNA et à 3 tRNAs 5 sont des triples dont 2 à cgt ont même 2 intercalaires identiques, adresses. Les tRNAs de ces triplets sont atgf ggc gcc et 2 fois cgt. Le 6ème cluster à 3 tRNAs n’ a pas de doubles.
  • Séquences des doubles:
aas	clusters	doubles	séquences					
1	32		-					
2	6		6	2 tac	2 gtc*3  2 gcc	2 gta	
3	6		5	3 atgf	3 ctg*2  3 ggc	3 gcc	
4	3		1	3 gta				
5	0						
6	1		1	5 cgt				
7	2		2	5 aaa 2 gta    2 cag 2 atgj 2 caa

ecoN distribution[modifier | modifier le wikicode]

  • Lien tableur: ecoN distribution
  • Notes:
    - 3gtc2 gta2+3 2ctg3 gcc2+3 tac2 aaa3 atgf3 ggc3
    - atc: 4 16s, atc2, 1aa
    - gaa: 7 16s, 5s, 4 1aa
    - acc: 2 5s, >1aa, 1aa
    - gac: 2 5s, 1aa
    - Séquences: (aaa gta)2 aaa3
    - Adresse 5098422: ce bloc est compté dans « avec rRNA » dans cumuls. Mais ici je compte
    1 gaa avec rRNA
    2 gaa 1aa
    2 atc >1aa
Gm5 ecoN, Escherichia coli Nissle 1917. gama
g1    t1       
atgi 1 tct tat atgf 7
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 2 tcc tac 3 tgc 1
atc 7 acc 4 aac 3 agc 1
ctc 1 ccc 4 cac 1 cgt 5
gtc 6 gcc 1 gac 3 ggc 4
tta 1 tca 5 taa tga 2
ata aca 1 aaa 6 aga 2
cta 1 cca 1 caa 2 cga
gta 7 gca 1 gaa 12 gga 1
ttg 1 tcg 6 tag tgg 1
atgj 2 acg 1 aag agg 1
ctg 7 ccg 1 cag 2 cgg 1
gtg gcg 1 gag ggg 1
gama >1aa =1aa -5s +5s -16s +16s total
ecoN 64 34 6 17 121

ecoN eco[modifier | modifier le wikicode]

ecoN eco tableaux[modifier | modifier le wikicode]

  • Lien tableur: ecoN eco tableaux
  • Légende: eco 435, la recherche de isocitrate, voir noms longs, se trouve à l'adresse 4217109..4218413 chez eco.
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - Colonne cdsa
    . en clair la longueur de la protéine en aas
    . en orange 1542, longueur des rRNAs en pbs.
    - Colonne cds, les noms courts des cds
    . en clair
    . en vert D glycero, protéine identique entre eco et ecoN, à peu près en longueur et par le nom.
    . en bleu YdiA, protéine complètement différente en nom et/ou en longueur, entre ecoN et eco
    . en turquoise hp-419, protéine identique par la longueur mais différente par le nom, entre ecoN et eco
    . en gris clair D glycero, dans le tableau E13, protéine transposée par complement (colonne sens) entre ecoN et eco alors qu'il y a transposition des intercalaires (colonne interca), 365.
    . en gris foncé ABC 32, dans le tableau E13, protéine non transposée par complement (colonne sens) entre ecoN et eco alors qu'il n'y a pas transposition des intercalaires (colonne interca), 174.
    . en vert très foncé, dans le tableau E13, Tyr recb 404,protéine existant dans ecoN mais non trouvée dans eco.
  • Notes: Les dates de prélèvements des blocs de eco sont ceux de eco opérons du 10.3.19 alors que les cds de eco ont été prélevés le 19.12.19, qu'on voit dans le tableur ecoN eco tableaux. Pour ecoN la date de prélèvement est celle de ecoN opérons.
E1. Comparaison eco ecoN
E11. Clusters eco
cluster sens gènes interca cdsa cds
eco1 222833..223408 cds 362 192 D-glycero
223771..225312 16s 68 1542
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93 2904
228756..228875 5s 52 120
228928..229004 gac 162
229167..229970 cds 268 metDkgB
eco2 236067..236798 cds 132 244 DNAIIIe
236931..237007 gac 327
237335..238120 cds 262 lipo YafT
eco3 261503..262756 cds 114 418 glu5dH
262871..262946 acg 203
comp 263150..263212 cds 21 YdiA
262898..297205 phage 11436 pp CP4-6
eco4 comp 563848..564480 cds 242 211 put FimZ
564723..564799 aga 15
comp 564815..565978 cds 388 put DLP12
564755..586056 phage 7101 pp DLP12
eco5 695101..696276 cds 31 392 octaprenyl
comp 696308..696378 rpr 51 71 rpt71
comp 696430..696504 cag 37
comp 696542..696616 cag 47
comp 696664..696740 atg 15
comp 696756..696830 caa 34
comp 696865..696939 caa 23
comp 696963..697047 cta 9
comp 697057..697133 atg 379
comp 697513..699177 cds 555 Asn B
eco6 779598..780389 cds 164 264 cell CpoB
780554..780629 aaa 135
780765..780840 gta 2
780843..780918 aaa 149
781068..781143 gta 3
781147..781222 aaa 146
781369..781444 aaa 132
781577..781652 aaa 432
782085..783128 cds 348 quino
eco7 923264..925540 cds 343 759 ATP ClpA
comp 925884..925971 tcc 253
comp 926225..926443 cds 73 tif IF-1
eco8 comp 1030759..1031418 cds 206 220 FtsH
comp 1031625..1031712 tca 426
1032139..1033257 cds 373 Hnase1
eco9
*****aga*****
eco10 1095843..1096829 cds 735 329 un-YcdU
comp 1097565..1097652 tcc 233
1097886..1098824 cds 313 glyoxylate A
eco11
*****tcc*****
eco12 1286709..1286984 cds 81 92 p-un-YchS
comp 1287066..1287236 ncRNA -150 171 RttR sRNA
comp 1287087..1287176 cds 67 30 tpr
comp 1287244..1287328 tac 209
comp 1287538..1287622 tac 159
comp 1287782..1288624 cds 281 fTHF
eco13
***** gtc *****
gtc
eco14 ***** gtc *****
gtc
eco15 comp 1744871..1746127 cds 307 419 adhes YdhQ
1746435..1746511 gtc 4
1746516..1746592 gtc 107
1746700..1747005 cds 102 pu-YdhR
eco16 comp 1990954..1991619 cds 195 222 UPF0149 YecA
comp 1991815..1991901 tta 12
comp 1991914..1991987 tgc 54
comp 1992042..1992117 ggc 151
comp 1992269..1992817 cds 183 glycerolP
eco17 2042368..2042898 cds 569 177 pu-cytochrom
comp 2043468..2043557 tcg 93
2043651..2044448 cds 100 266 Mtf
2044549..2044624 aac 313
2044938..2052014 cds 2359 Inv-adhesin
eco18 2056858..2057574 cds 452 239 pu-tr-YeeN
comp 2058027..2058102 aac 100
comp 2058203..2059846 cds 4 548 exporter
2059851..2059926 aac 37
comp 2059964..2060914 cds 101 317 tact Cbl
comp 2061016..2061933 cds 326 306 tr-Nac
2062260..2062335 aac 55
comp 2062391..2063323 cds 311 ErfK
eco19 2284376..2286136 cds 74 587 pu-cardiolip
2286211..2286287 ccc 102
comp 2286390..2288914 cds 842 adhes YejO
eco20 2465301..2466233 cds 75 311 YfdC
2466309..2466383 agg 161
2466545..2467702 cds 386 KpLE1
2466369..2476583 phage 3405 pp CPS-53
eco21 comp 2515643..2517832 cds 208 730 pu-sensor
comp 2518041..2518116 gcc 39
comp 2518156..2518231 gcc 235
2518467..2518811 cds 115 pu- YfeC
eco22 comp 2519257..2520672 cds 258 472 Glu ligase
2520931..2521006 gta 44
2521051..2521126 gta 46
2521173..2521248 gta 4
2521253..2521328 aaa 210
2521539..2521567 rpr 25 29 rpt-29
comp 2521593..2522477 cds 295 XapR
eco23 comp 2724448..2725746 cds 322 433 glutarate sm
comp 2726069..2726188 5s 92 120
comp 2726281..2729184 23s 184 2904
comp 2729369..2729444 gaa 171
comp 2729616..2731157 16s 442 1542
comp 2731600..2734173 cds 858 ClpB
eco24 comp 2784529..2785011 cds 750 161 DUF5507
comp 2785762..2785837 atgi 559
2786397..2788649 cds 751 pu-unYgaQ
eco25 comp 2816937..2817503 cds 280 189 fructose
comp 2817784..2817860 cgt 198
comp 2818059..2818135 cgt 62
comp 2818198..2818274 cgt 198
comp 2818473..2818549 cgt 3
comp 2818553..2818645 agc 315
comp 2818961..2819146 cds 62 Csr
eco26 comp 2946081..2947178 cds 208 366 murein lytic
2947387..2947463 atgf 33
2947497..2947573 atgf 33
2947607..2947683 atgf 73
comp 2947757..2949010 cds 418 Ala C
eco27 comp 2998034..2998828 cds 155 265 YgeQ
comp 2998984..2999057 ggg 78
comp 2999136..2999891 cds 252 pu-LysM
eco28 3109553..3110260 cds 105 236 DUF554
3110366..3110441 ttc 148
comp 3110590..3111126 cds 179 pu-ssM
eco29 comp 3214967..3215473 cds 124 169 G/U station
3215598..3215673 atgi 53
comp 3215727..3216491 cds 255 ferric
eco30
eco31
eco32
eco33 comp 3317554..3318006 cds 206 151 RimP
comp 3318213..3318289 atgf 347
3318637..3319980 cds 448 Arg-suc
eco34 comp 3319988..3321613 cds 458 542 pu-hydrolase
comp 3322072..3322158 ctc 14
comp 322173..3322505 cds 111 SecG-t
eco35 3422436..3423194 cds 228 253 pu-YhdZ
comp 3423423..3423542 5s 37 120
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92 120
comp 3423880..3426783 23s 174 2904
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 1542
3429236..3429790 cds 185 protein YrdA
eco36 comp 3706098..3707705 cds 567 536 dip ABC
comp 3708273..3708306 rpr 16 34 rpt-34
3708323..3708358 rpr 257 36 rpt-36
comp 3708616..3708692 ccg 91
comp 3708784..3710475 cds 564 kdo2
eco37 comp 3834547..3835929 cds 292 461 pu-YicJ
3836222..3836316 tga 108
3836425..3836556 pseudo 396 132 p-yicT
3836953..3838137 cds 395 pu-arabi
eco38 comp 3940635..3941327 cds 480 231 pu-tr YieP
3941808..3943349 16s 85 1542
3943435..3943510 gaa 193
3943704..3946607 23s 92 2904
3946700..3946819 5s 52 120
3946872..3946948 gac 8
3946957..3947032 tgg 95
comp 3947128..3947967 cds 280 HdfR
eco39 3980887..3982272 cds 102 462 pu-YifK
3982375..3982451 cgg 57
3982509..3982585 cac 20
3982606..3982692 ctg 42
3982735..3982811 cca 146
3982958..3984193 cds 412 pu-AslB
eco40 4034608..4035153 cds 377 182 porphyrine O
4035531..4037072 16s 68 1542
4037141..4037217 atc 42
4037260..4037335 gca 183
4037519..4040423 23s 93 2905
4040517..4040636 5s 228 120
4040865..4040900 rpr 5 36 rpt-36
comp 4040906..4041433 cds 176 Mlb adapt
eco41 4165428..4166285 cds 373 286 Glu race
4166659..4168200 16s 171 1542
4168372..4168447 gaa 193
4168641..4171544 23s 92 2904
4171637..4171756 5s 300 120
4172057..4173085 cds 343 UDP-N
eco42 comp 4174076..4175026 cds 361 317 B5 kinase
4175388..4175463 aca 8
4175472..4175556 tac 116
4175673..4175747 gga 6
4175754..4175829 acc 114
4175944..4177128 cds 229 395 tufb
4177358..4177741 cds 128 SecE
eco43 comp 4205943..4207532 cds 614 530 AICAR1
4208147..4209688 16s 85 1542
4209774..4209849 gaa 193
4210043..4212946 23s 93 2904
4213040..4213159 5s 74 120
4213234..4213617 cds 128 stress
eco44 comp 4360396..4361934 cds 256 513 CadC
comp 4362191..4362353 pseudo 197 163 yjdQ
comp 4362551..4362626 ttc 106
comp 4362733..4363308 cds 192 pu-tr YjdC
eco45 4391604..4392149 cds 210 182 oligo-rnase
4392360..4392435 ggc 36
4392472..4392547 ggc 35
4392583..4392658 ggc 233
4392892..4392945 cds 18 un-YjeV
eco46 comp 4495190..4496209 cds 195 340 NADPH- Ah
4496405..4496489 ttg 260
4496750..4497940 cds 397 pu-KpLE2
4496675..4497940 phage 422 pp PR-Y
eco47 4605804..4606040 cds 38 79 protein YjjZ
comp 4606079..4606165 ctg 34
comp 4606200..4606286 ctg 28
comp 4606315..4606401 ctg 157
4606559..4606594 rpr 22 36 rpt 36
comp 4606617..4606650 rpr 18 34 rpt 34
comp 4606669..4607700 cds 344 G1207
E12. Clusters ecoN alignés sur les clusters de eco
cluster sens gènes interca cdsa cds
ecoN1 231864..232436 CDS 365 191 D-glycero
232802..234321 16s 73 1520
234395..234471 gaa 12
234484..234557 gca 174
234732..237319 23s 83 2588
237403..237518 5s 54 116
237573..237649 gac 162
237812..238615 CDS 268 gluDkgB
ecoN2 244934..245665 CDS 132 244 DNAIIIe
245798..245874 gac 120
comp 245995..246852 CDS 286 DUF4942
ecoN3 367329..368582 CDS 114 418 glu5dH
368697..368772 acg 154
368927..369265 CDS 113 DUF4102
ecoN4 comp 631149..632015 CDS 270 289 cyclo FolD
632286..632362 aga 15
comp 632378..632997 CDS 207 Tyr recb 207
ecoN5 733188..734363 CDS 153 392 octaprenyl
comp 734517..734591 cag 37
comp 734629..734703 cag 48
comp 734752..734828 atgj 15
comp 734844..734918 caa 34
comp 734953..735027 caa 23
comp 735051..735135 cta 10
comp 735146..735222 atgj 380
comp 735603..737267 CDS 555 Asn B
ecoN6 807377..808169 CDS 164 264 p-cell CpoB
808334..808409 aaa 35
808445..808520 gta 2
808523..808598 aaa 51
808650..808725 gta 3
808729..808804 aaa 48
808853..808928 aaa 33
808962..809037 aaa 277
809315..810358 CDS 348 quino NadA
ecoN7 950069..952345 CDS 343 759 ATP ClpA
comp 952689..952776 tcc 253
comp 953030..953248 CDS 73 tif IF-1
ecoN8 comp 1047224..1047883 CDS 206 220 FtsH YccA
comp 1048090..1048177 tca 426
1048604..1049722 CDS 373 Hnase1
ecoN9 1183656..1184018 CDS 463 121 hp-121
1184482..1184558 aga 278
> comp 1184837..1185786 CDS 317 p-IS4
ecoN10 1213982..1214809 CDS 165 276 DUF4942
comp 1214975..1215062 tcc 233
1215296..1216234 CDS 313 glyoxyl GhrA
ecoN11 1216817..1217098 CDS 165 94 DUF4942
comp 1217264..1217351 tcc 234
1217586..1218524 CDS 313 glyoxyl GhrA
ecoN12 1457038..1458129 CDS 16 364 acyl-CoA
comp 1458146..1458277 ncRNA 46 44 RtT sRNA
comp 1458324..1458408 tac 33
comp 1458442..1458526 tac 159
comp 1458686..1459528 CDS 281 fTHF
ecoN13 comp 1829066..1830322 CDS 307 419 hp-419
1830630..1830706 gtc 4
1830711..1830787 gtc 6
< 1830794..1831177 CDS 128 p-MdtK
ecoN14 comp 1831218..1832474 CDS 307 419 hp-419
1832782..1832858 gtc 4
1832863..1832939 gtc 8
< 1832948..1833280 CDS 111 p-MATE
ecoN15 comp 1833321..1834577 CDS 307 419 hp-419
1834885..1834961 gtc 4
1834966..1835042 gtc 108
1835151..1835456 CDS 102 mono-O2
ecoN16 comp 2115794..2116459 CDS 195 222 UPF0149 YecA
comp 2116655..2116741 tta 12
comp 2116754..2116827 tgc 53
comp 2116881..2116956 ggc 151
comp 2117108..2117656 CDS 183 CDP-diacyl
ecoN17 comp 2191451..2192287 CDS 278 279 hp-279
comp 2192566..2192655 tcg 93
2192749..2193546 CDS 100 266 MtfA
2193647..2193722 aac 161
2193884..2195146 CDS 421 Tyr recb-421
ecoN18 2232607..2233323 CDS 453 239 tr-YebC
comp 2233777..2233852 acc 326
2234179..2235096 CDS 101 306 tr-nitrogen
2235198..2236148 CDS 37 317 tr-Cbl
comp 2236186..2236261 aac 4
2236266..2237909 CDS 100 548 trp-YeeO
2238010..2238085 aac 161
2238247..2239518 CDS 424 Tyr recb 424
ecoN19 2546968..2548728 CDS 74 587 cardiolipine
2548803..2548879 ccc 101
comp 2548981..2549136 CDS 52 barrel
ecoN20 2717780..2718712 CDS 75 311 nitrite
2718788..2718862 agg 437
comp 2719300..2719830 CDS 177 OmpH
ecoN21 comp 2768744..2770933 CDS 206 730 sensor
comp 2771140..2771215 gcc 39
comp 2771255..2771330 gcc 220
2771551..2771910 CDS 120 pu-tr 120
ecoN22 comp 2772355..2773770 CDS 258 472 Glu ligase
2774029..2774104 gta 43
2774148..2774223 gta 46
2774270..2774345 gta 4
2774350..2774425 aaa 110
comp 2774536..2775420 CDS 295 LysR
ecoN23 comp 2959205..2960503 CDS 323 433 glutarate pm
comp 2960827..2960942 5s 83 116
comp 2961026..2965477 23s 184 4452
comp 2965662..2965737 gaa 431
comp 2966169..2967720 16s 441 1552
comp 2968162..2970735 CDS 858 ClpB dep
ecoN24
****atgi*****
ecoN25
comp 3027207..3027773 CDS 280 189 fructose 6
comp 3028054..3028130 cgt 63
comp 3028194..3028270 cgt 62
comp 3028333..3028409 cgt 62
comp 3028472..3028548 cgt 64
comp 3028613..3028689 cgt 3
comp 3028693..3028785 agc 315
comp 3029101..3029286 CDS 62 CsrA
ecoN26 comp 3157337..3158434 CDS 208 366 murein
3158643..3158719 atgf 33
3158753..3158829 atgf 33
3158863..3158939 atgf 635
3159575..3160075 CDS 167 sscs VI
ecoN27 3230172..3231401 CDS 316 410 HAAAP
comp 3231718..3231791 ggg 78
comp 3231870..3232625 CDS 252 glycan DD
ecoN28 3341048..3341755 CDS 105 236 DUF554
3341861..3341936 ttc 197
3342134..3343399 CDS 422 arm-type
ecoN29 comp 3569308..3569814 CDS 124 169 G/U
3569939..3570014 atgi 53
comp 3570068..3570832 CDS 255 ferric
ecoN30 comp 3670227..3670679 CDS 206 151 RimP
comp 3670886..3670962 atgf 347
> 3671310..3672155 CDS 282 p-Arg-sc 282
ecoN31 comp 3673935..3674387 CDS 206 151 RimP
comp 3674594..3674670 atgf 347
> 3675018..3675869 CDS 284 p-Arg-sc 284
ecoN32 comp 3677794..3678246 CDS 206 151 RimP
comp 3678453..3678529 atgf 347
> 3678877..3679722 CDS 282 p-Arg-sc 282
ecoN33 comp 3681532..3681984 CDS 206 151 RimP
comp 3682191..3682267 atgf 347
3682615..3683958 CDS 448 Arg-suc
ecoN34 comp 3683966..3685591 CDS 456 542 Pet
comp 3686048..3686134 ctc 14
comp 3686149..3686481 CDS 111 SecG-p
ecoN35 3784553..3785311 CDS 62 253 pu-ABC
comp 3785374..3785489 5s 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360
3789989..3790543 CDS 185 gc anhydrase
ecoN36 comp 4078635..4080242 CDS 743 536 DppA
comp 4080986..4081062 ccg 91
comp 4081154..4082845 CDS 564 kdo2
ecoN37 comp 4205966..4207348 CDS 292 461 glycoside-p5
4207641..4207735 tga 300
> 4208036..4208857 CDS 274 p-DUF4102
ecoN38 comp 4338643..4339335 CDS 479 231 FadR tr
4339815..4341342 16s 73 1528
4341416..4341491 gaa 184
4341676..4344286 23s 83 2611
4344370..4344485 5s 53 116
4344539..4344615 gac 8
4344624..4344699 tgg 95
comp 4344795..4345634 CDS 280 HdfR HTH
ecoN39 4377681..4379066 CDS 102 462 aa permease
4379169..4379245 cgg 58
4379304..4379379 cac 20
4379400..4379486 ctg 42
4379529..4379605 cca 146
4379752..4380987 CDS 412 ans maturase
ecoN40 4460971..4461516 CDS 377 182 porphyrine M
4461894..4463631 16s 56 1738
4463688..4463764 atc 42
4463807..4463882 gca 165
4464048..4467338 23s 83 3291
4467422..4467537 5s 104 116
comp 4467642..4468169 CDS 176 Mlb pB
ecoN41 4605577..4606434 CDS 374 286 Glu race
4606809..4608362 16s 363 1554
4608726..4608801 gaa 1112
4609914..4610029 5s 136 116
4610166..4611194 CDS 343 UDP-N
ecoN42 comp 4612185..4613135 CDS 361 317 B5 kinase I
4613497..4613572 aca 8
4613581..4613665 tac 116
4613782..4613856 gga 6
4613863..4613938 acc 114
4614053..4615237 CDS 395 tuf
ecoN43 comp 4642984..4644573 CDS 616 530 AICAR2
4645190..4646378 16s’ 83 1189
4646462..4648150 CDS 436 563 kinase isocit
4648587..4648662 gaa 185
4648848..4651319 23s 83 2472
4651403..4651518 5s 76 116
4651595..4651978 CDS 128 hp-128
ecoN44
< comp 4834504..4834961 CDS 197 153 pu-integrase
comp 4835159..4835234 ttc 106
comp 4835341..4835916 CDS 192 tr 192
ecoN45 4864628..4865173 CDS 210 182 oligo-rnase
4865384..4865459 ggc 36
4865496..4865571 ggc 35
4865607..4865682 ggc 233
4865916..4865969 CDS 18 hp-18
ecoN46 comp 4974178..4975197 CDS 195 340 NADPH- Ahr
4975393..4975477 ttg 39
<> comp 4975517..4976055 CDS 180 p-IS630
ecoN47 5042527..5042763 CDS 38 79 DUF1435
comp 5042802..5042888 ctg 34
comp 5042923..5043009 ctg 28
comp 5043038..5043124 ctg 290
comp 5043415..5044446 CDS 344 G1207 RsmC
E13. Clusters ecoN au-delà de eco
ecoN suite sens gènes interca cdsa cds
EcoN 48 comp 5079375..5079581 CDS 117 69 tr AlpA
ok 5079699..5081218 16s 73 1520
5081292..5081368 gaa 12
5081381..5081454 gca 366
5081821..5082018 CDS 524 66 hp-66
comp 5082543..5082754 CDS 71 hp-71
eco1 222833..223408 cds 362 192 D-glycero
223771..225312 16s 68 1542
225381..225457 atc 42
225500..225575 gca 183
225759..228662 23s 93 2904
228756..228875 5s 52 120
228928..229004 gac 162
229167..229970 cds 268 metDkgB
EcoN 56 comp > 5341397..5341492 CDS -2 32 ABC 32
ok comp 5341491..5344303 23s 174 2813
comp 5344478..5344553 gca 42
comp 5344596..5344672 atc 56
comp 5344729..5346282 16s 1063 1554
comp 5347346..5347421 gca 42
comp 5347464..5347540 atc 56
comp 5347597..5349150 16s 365 1554
comp 5349516..5350088 CDS 187 191 D-glycero
> 5350276..5350914 CDS 213 ABC MetN
eco35 eco 3422436..3423194 cds 228 253 pu-YhdZ
comp 3423423..3423542 5s 37 120
comp 3423580..3423655 acc 12
comp 3423668..3423787 5s 92 120
comp 3423880..3426783 23s 174 2904
comp 3426958..3427033 gca 42
comp 3427076..3427152 atc 68
comp 3427221..3428762 16s 473 1542
3429236..3429790 cds 185 protein YrdA
ecoN35 3784553..3785311 CDS 62 253 pu-ABC
comp 3785374..3785489 5s 39 116
comp 3785529..3785605 acc 14
comp 3785620..3785735 5s 777 116
comp 3786513..3786588 acc 14
comp 3786603..3786718 5s 1834 116
comp 3788553..3788628 gaa 1360
3789989..3790543 CDS 185 gc anhydrase
EcoN 59 > 5433568..5433687 CDS 39 40 p-Nam
ok comp 5433727..5433814 tcc 253
comp 5434068..5434286 CDS 73 tif IF-1
ecoN
EcoN 53 comp 5321144..5321869 CDS 206 242 p-His kinase
ok comp 5322076..5322151 gcc 39
comp 5322191..5322266 gcc 39
comp 5322306..5322381 gcc 220
5322602..5322961 CDS 120 pu-tr 120
ecoN
EcoN 54 comp 5323406..5324821 CDS 258 472 Glu ligase
ok 5325080..5325155 gta 44
5325200..5325275 gta 0
< 5325276..5325389 CDS 38 p-pu-tr 38
EcoN 51 comp 5252659..5253870 CDS 300 404 Tyr recb 404
ok comp 5254171..5254249 tga 292
> 5254542..5255171 CDS 210 p-glycoside
EcoN 52 > comp 5305902..5306228 CDS 0 109 p-hp
comp 5306229..5306302 atc 1096
ecoN ? 5307399..5308450 CDS 351 p-Ada
EcoN 57 > comp 5359583..5360512 CDS 120 310 Tyr recb 310
comp 5360633..5360708 gca 42
ecoN40 comp 5360751..5360827 atc 56
comp 5360884..5362138 16s’ 1 1255
< comp 5362140..5363543 CDS 468 IS66
EcoN 55 > 5375524..5376270 CDS 891 249 p-AI-2E
5377162..5377237 gaa 1047 eco 435
ecoN ? comp 5378285..5379589 CDS 435 isocitrate
EcoN 49 comp 5090325..5090876 CDS 1808 184 MarR
comp 5092685..5092760 gaa 588
ecoN ? < comp 5093349..5093474 CDS 592 42 sn-glycerol
5094067..5094142 gaa 1472
5095615..5095691 atc 42
5095734..5095809 atc 1130
5096940..5097015 gaa 1145
ok ecoN43 5098161..5098236 gaa 185
5098422..5100893 23s 83 2472
5100977..5101092 5s 76 116
5101169..5101552 CDS 63 128 hp-128
comp 5101616..5102059 CDS 148 transferase
EcoN 50 5124754..5125197 CDS 63 148 transferase
comp 5125261..5125644 CDS 76 128 hp-128
ecoN40 comp 5125721..5125836 5s 83 116
comp 5125920..5128366 23s’ -10 2447
< 5128357..5128479 CDS 41 pilus
EcoN 58 5425965..5426201 CDS 38 79 DUF1435
ok comp 5426240..5426325 ctg 26
comp 5426352..5426438 ctg 28
comp 5426467..5426553 ctg 63
< comp 5426617..5427150 CDS 178 p-IS630

ecoN eco noms cds[modifier | modifier le wikicode]

ecoN eco. Liste des noms longs et courts, et des fonctions
fonction Noms courts Noms longs
tr-regulator XapR DNA-binding transcriptional activator XapR
permease aa permease amino acid permease
ABC bind ABC 32 ABC transporter ATP-binding protein
ABC bind ABC MetN methionine ABC transporter ATP-binding protein MetN
desaturase acyl-CoA acyl-CoA desaturase
adhesin adhes YdhQ adhesin-like autotransporter YdhQ
adhesin adhes YejO adhesin-like autotransporter YejO, gene fragment 2 of yejO, misc_feature
hydrolase AICAR1 bifunctional AICAR transformylase/IMP cyclohydrolase
hydrolase AICAR2 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
amidase Ala C N-acetylmuramoyl-L-alanine amidase C
maturase ans maturase anaerobic sulfatase maturase
synthetase Arg-suc argininosuccinate synthetase
integrase arm-type integrase arm-type DNA-binding domain-containing protein
synthetase Asn B asparagine synthetase B
protease b ATP ClpA ATP-dependent Clp protease ATP-binding subunit ClpA
kinase B5 kinase pantothenate kinase
kinase B5 kinase I type I pantothenate kinase
transporter barrel autotransporter outer membrane beta-barrel domain-containing protein
tr-regulator CadC DNA-binding transcriptional activator CadC
cardiolipin cardiolipine cardiolipin transport protein PbgA
transferase CDP-diacyl CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
division cell CpoB cell division coordinator CpoB
chaperone ClpB ClpB chaperone
chaperone ClpB dep ATP-dependent chaperone ClpB
storage Csr carbon storage regulator
storage CsrA carbon storage regulator CsrA
hydrolase cyclo FolD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
phosphatase D-glycero D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase
ABC bind dip ABC dipeptide ABC transporter periplasmic binding protein
polymerase DNAIIIe DNA polymerase III subunit epsilon
ABC bind DppA dipeptide ABC transporter substrate-binding protein DppA
DUF DUF1435 DUF1435 domain-containing protein
DUF DUF4102 DUF4102 domain-containing protein
DUF DUF4942 DUF4942 domain-containing protein
DUF DUF5507 DUF5507 domain-containing protein YpjC
DUF DUF554 DUF554 domain-containing protein
DUF DUF554 Yqg DUF554 domain-containing protein YqgA
peptidase ErfK L,D-transpeptidase ErfK
exporter exporter FMN/FAD exporter
tr-regulator FadR tr FadR family transcriptional regulator
reductase ferric NADPH-dependent ferric chelate reductase
phosphatase fructose fructose-1-phosphatase
phosphatase fructose 6 fructose-1-phosphate/6-phosphogluconate phosphatase
deformylase fTHF formyltetrahydrofolate deformylase
protase FtsH modulator of FtsH protease
protease FtsH YccA FtsH protease modulator YccA
glycosylase G/U G/U mismatch-specific DNA glycosylase
glycosylase G/U station stationary phase mismatch/uracil DNA glycosylase
transferase G1207 16S rRNA m(2)G1207 methyltransferase
transferase G1207 RsmC 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
anhydrase gc anhydrase gamma carbonic anhydrase family protein
ligase Glu ligase glutamate--tRNA ligase
racemase Glu race glutamate racemase
dehydrogenase glu5dH glutamate-5-semialdehyde dehydrogenase
reductase gluDkgB 2,5-didehydrogluconate reductase DkgB
permease glutarate pm alpha-ketoglutarate permease
symporter glutarate sm alpha-ketoglutarate:H(+) symporter
peptidase glycan DD peptidoglycan DD-metalloendopeptidase family protein
synthetase glycerolP phosphatidylglycerophosphate synthase
transporter glycoside-p5 glycoside-pentoside-hexuronide family transporter
reductase glyoxyl A glyoxylate/hydroxypyruvate reductase A
reductase glyoxyl GhrA glyoxylate/hydroxypyruvate reductase GhrA
permease HAAAP HAAAP family serine/threonine permease
tr-regulator HdfR DNA-binding transcriptional dual regulator HdfR
tr-regulator HdfR HTH HTH-type transcriptional regulator HdfR
hydrogenase Hnase1 hydrogenase 1 small subunit
hp hp-121 hp-121
hp hp-128 hypothetical protein
hp hp-18 hp-18
adhesin Inv-adhesin inverse autotransporter adhesin
transposase IS66 IS66 family transposase
lyase isocitrate isocitrate lyase
transferase kdo2 kdo(2)-lipid A phosphoethanolamine 7-transferase
kinase/Pase kinase isocit bifunctional isocitrate dehydrogenase kinase/phosphatase
prophage KpLE1 CPS-53 (KpLE1) prophage; prophage CPS-53 integrase
lipoprotein lipo YafT lipoprotein YafT
tr-regulator LysR LysR family transcriptional regulator
tr-regulator MarR MarR family transcriptional regulator
reductase metDkgB methylglyoxal reductase DkgB
GDP Mlb adapt molybdopterin-guanine dinucleotide biosynthesis adaptor protein
GDP Mlb pB molybdopterin-guanine dinucleotide biosynthesis protein B
oxygenase mono-O2 monooxygenase
titration Mtf Mlc titration factor
tr-regulator MtfA DgsA anti-repressor MtfA
glycosylase murein murein transglycosylase A
glycosylase murein lytic membrane-bound lytic murein transglycosylase A
reductase NADPH- Ah aldehyde reductase, NADPH-dependent
reductase NADPH- Ahr NADPH-dependent aldehyde reductase Ahr
transporter nitrite formate/nitrite transporter family protein
hydroxylase octaprenyl 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
rnase oligo-rnase oligoribonuclease
protein OmpH OmpH family outer membrane protein
transferase p-Ada pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
transporter p-AI-2E pseudo, AI-2E family transporter
synthetase p-Arg-sc 282 Pseudo, argininosuccinate synthase
synthetase p-Arg-sc 284 Pseudo, argininosuccinate synthase
division p-cell CpoB Pseudo, cell division protein CpoB
DUF p-DUF4102 Pseudo, DUF4102 domain-containing protein
transporter p-glycoside pseudo, glycoside-pentoside-hexuronide family transporter
kinase p-His kinase pseudo, histidine kinase
hp p-hp pseudo, hp 109
integrase p-integrase pseudo, integrase
transposase p-IS4 Pseudo, IS4 family transposase
transposase p-IS630 pseudo, IS630 family transposase
transporter p-MATE Pseudo, MATE family efflux transporter
transporter p-MdtK Pseudo, multidrug efflux MATE transporter MdtK
amidase p-Nam pseudo, nicotinamide-nucleotide amidase
tr-regulator p-pu-tr 38 pseudo, putative DNA-binding transcriptional regulator
protein p-un-YchS putative uncharacterized protein YchS
gene p-yicT p-yicT
transferase Pet phosphoethanolamine transferase
protein pilus pilus assembly protein
dehydrogenase porphyrine M menaquinone-dependent protoporphyrinogen IX dehydrogenase
oxidase porphyrine O protoporphyrinogen oxidase
prophage pp CP4-6 note="cryptic prophage CP4-6" misc_feature
prophage pp CPS-53 cryptic prophage CPS-53, misc_feature
prophage pp DLP12 note="cryptic prophage DLP12" misc_feature
prophage pp PR-Y cryptic prophage PR-Y
protein protein YjjZ protein YjjZ
protein protein YrdA protein YrdA
tr-regulator pu- YfeC putative DNA-binding transcriptional regulator YfeC
ABC bind pu-ABC amino acid ABC transporter ATP-binding protein
exporter pu-arabi putative arabinose exporter
sulfatase pu-AslB putative anaerobic sulfatase maturation enzyme AslB
cardiolipin pu-cardiolip putative cardiolipin transport protein
cytochrome pu-cytochrom putative cytochrome
hydrolase pu-hydrolase putative hydrolase, inner membrane
integrase pu-KpLE2 KpLE2 phage-like element; putative integrase
peptidase pu-LysM LysM domain-containing putative peptidase lipoprotein YgeR
GMP pu-sensor putative c-di-GMP phosphodiesterase PdeA
protein Pu-ssM putative type II secretion system M-type protein
tr-regulator pu-tr 120 putative DNA-binding transcriptional regulator
tr-regulator pu-tr YieP putative transcriptional regulator YieP
tr-regulator pu-tr YjdC putative DNA-binding transcriptional regulator YjdC
tr-regulator pu-tr-YeeN putative transcriptional regulator YeeN
protein pu-unYgaQ putative uncharacterized protein YgaQ
oxygenase pu-YdhR putative monooxygenase YdhR
ABC bind pu-YhdZ putative ABC transporter ATP-binding subunit YhdZ
transporter pu-YicJ putative xyloside transporter YicJ
transporter pu-YifK putative transporter YifK
prophage put DLP12 DLP12 prophage; putative integrase
tr-regulator put FimZ putative LuxR family transcriptional regulator FimZ
synthetase quino quinolinate synthase
synthetase quino NadA quinolinate synthase NadA
ribosome RimP ribosome maturation factor RimP
rpt rpt-29 rpt-29
rpt rpt-34 rpt_type=other
rpt rpt-36 rpt_type=other
rpt rpt71 rpt_type=other 71
sRNA RttR sRNA small RNA RttR
translocase SecE Sec translocon subunit SecE
translocase SecG-p preprotein translocase subunit SecG
translocase SecG-t Sec translocon subunit SecG
esterase sensor sensor domain-containing phosphodiesterase
ABC bind sn-glycerol sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
protein sscs VI type VI secretion system contractile sheath small subunit
protein stress stress response protein
tr-regulator tact Cbl DNA-binding transcriptional activator Cbl
translation tif IF-1 translation initiation factor IF-1
protein tpr protamine-like protein
tr-regulator tr 192 transcriptional regulator
tr-regulator tr AlpA AlpA family transcriptional regulator
tr-regulator tr-Cbl HTH-type transcriptional regulator Cbl
tr-regulator tr-Nac DNA-binding transcriptional dual regulator Nac
tr-regulator tr-nitrogen nitrogen assimilation transcriptional regulator
tr-regulator tr-YebC YebC/PmpR family DNA-binding transcriptional regulator
transferase transferase acetyltransferase
transporter trp-YeeO toxic metabolite efflux MATE transporter YeeO
translation tuf elongation factor Tu
translation tufb tufb, translation elongation factor Tu 2
integrase Tyr recb 207 tyrosine-type recombinase/integrase
integrase Tyr recb 404 tyrosine-type recombinase/integrase
integrase Tyr recb 421 tyrosine-type recombinase/integrase
integrase Tyr recb 424 tyrosine-type recombinase/integrase
reductase UDP-N UDP-N-acetylenolpyruvoylglucosamine reductase
protein un-YcdU uncharacterized protein YcdU
protein un-YjeV uncharacterized protein YjeV
protein UPF0149 YecA UPF0149 family protein YecA
protein YdiA YdiA family protein
protein YfdC inner membrane protein YfdC
protein YgeQ protein YgeQ
gene yjdQ gene="yjdQ"
DUF DUF1435 DUF1435 domain-containing protein
transposase p-IS630 pseudo, IS630-like element IS630 family transposase

Vibrio campbellii[modifier | modifier le wikicode]

vha opérons[modifier | modifier le wikicode]

vha1. Vibrio campbellii ATCC BAA-1116
45.4%GC 26.7.19 Paris 121 doubles interca cds aa avec aa cdsa cdsd
Chromosome I
comp 1..1384 16s @1 103 103
comp 1488..1604 cds 102507 39
104112..105239 cds 529 529 376 529
comp 105769..105845 atgf + 158 158
comp 106004..106079 ggc 7 ggc 35 35
comp 106115..106190 ggc 5 atgf 35 35
comp 106226..106301 ggc 18 18
comp 106320..106396 atgf 39 39
comp 106436..106511 ggc 90 90
comp 106602..106678 atgf 39 39
comp 106718..106793 ggc 18 18
comp 106812..106888 atgf 39 39
comp 106928..107003 ggc 18 18
comp 107022..107098 atgf 39 39
comp 107138..107213 ggc 156 156 156
comp 107370..107915 cds 81764 182
189680..190715 cds 101 101 345 101
comp 190817..190933 5s 107
comp 191041..193955 23s 290
comp 194246..194321 gca 43 43
comp 194365..194441 atc 97
comp 194539..196096 16s @2 371
comp 196468..196584 5s 77
comp 196662..199576 23s 290
comp 199867..199942 gca 43 43
comp 199986..200062 atc 97
comp 200160..201717 16s 853 853 853
comp 202571..204706 cds 29595 712
comp 234302..235486 cds 101 101 395 101
comp 235588..235663 acc 13 13
comp 235677..235751 gga 35 35
comp 235787..235871 tac 52 52
comp 235924..235999 aca 206 206
236206..237129 cds 4144 308
comp 241274..242467 cds 546 546 398 546
comp 243014..243090 tgg 68 68
comp 243159..243235 gac 32
comp 243268..243384 5s 117
comp 243502..246404 23s 310
comp 246715..246790 gta 30 30
comp 246821..246896 aaa 2 2
comp 246899..246974 gaa 122
comp 247097..248654 16s 554 554 554
249209..249664 cds 60596 152
310261..311296 cds 121 121 345 121
comp 311418..311508 tca 91
comp 311600..311716 5s 108
comp 311825..314739 23s 289
comp 315029..315104 gca 43 43
comp 315148..315224 atc 56
comp 315281..316842 16s 471 471 471
comp 317314..318027 cds 40242 238
358270..359305 cds 147 147 345
comp 359453..359529 gac 31
comp 359561..359677 5s 108
comp 359786..362700 23s 310
comp 363011..363086 gta 30 30
comp 363117..363192 aaa 2 2
comp 363195..363270 gaa 82
comp 363353..364914 16s 83 83 83
comp 364998..365133 cds 84252 45
449386..449521 cds 83 83 45 83
449605..451162 16s 122
451285..451360 gaa 2 2
451363..451438 aaa 9 9
451448..451523 gca 37 37
451561..451636 gta 51 51 51
comp 451688..451873 cds 16 16 62 16
451890..454804 23s 77
454882..454998 5s 32
455031..455107 gac 162 162
comp 455270..455533 cds 11718 88
comp 467252..467665 cds 361 361 138
468027..468103 cgg 35 35
468139..468214 cac 76 76
468291..468367 cca 46 46
468414..468489 cac 64 64
468554..468630 cca 194 194 194
comp 468825..469550 cds 365688 242
comp 835239..835550 cds 138 138 104 138
comp 835689..835764 atgi 145 145
comp 835910..837772 cds 182191 621
1019964..1020128 cds 119 119 55
1020248..1021805 16s 129
1021935..1022010 gcc 41 41
1022052..1022127 gaa 55 55 55
comp 1022183..1022368 cds 16 16 62 16
1022385..1025299 23s 111
1025411..1025527 5s 31
1025559..1025635 gac 35 35
1025671..1025747 tgg 3 3 3
comp 1025751..1025933 cds 225465 61
1251399..1252574 cds 158 158 392
comp 1252733..1252817 cta + 54 54
comp 1252872..1252946 caa 5 cta 46 46
comp 1252993..1253077 cta 3 atgj 21 21
comp 1253099..1253183 cta 2 caa 18 18
comp 1253202..1253278 atgj 23 23
comp 1253302..1253386 cta 70 70
comp 1253457..1253533 atgj 79 79
comp 1253613..1253687 caa 31 31
comp 1253719..1253803 cta 39 39
comp 1253843..1253919 atgj 26 26 26
comp 1253946..1254157 cds 14564 71
comp 1268722..1268862 cds 260 260 47
1269123..1269199 cca 243 243 243
comp 1269443..1269628 cds 16361 62
1285990..1286571 cds 88 88 194
comp 1286660..1286736 agg 68 68 68
comp 1286805..1287938 cds 116753 378
comp 1404692..1405552 cds 204 204 287 204
1405757..1405833 aga 244 244
1406078..1407685 cds 49950 536
1457636..1458508 cds 407 407 291
comp 1458916..1459000 tac + 100 100
comp 1459101..1459185 tac 4 tac 100 100
comp 1459286..1459370 tac @7 100 100
comp 1459471..1459555 tac 282 282 282
1459838..1460935 cds 170368 366
1631304..1631753 cds 144 144 150 144
1631898..1631985 tcc 312 312
1632298..1632684 cds 550413 129
2183098..2183436 cds 179 179 113
2183616..2183692 gtc + 46 46
2183739..2183815 gtc 2 gtc 149 149 149
2183965..2185344 cds 578546 460
comp 2763891..2766782 cds 763 763 964 763
comp 2767546..2767621 ggc + 11 11
comp 2767633..2767719 tta 2 ggc 78 78
comp 2767798..2767873 ggc 37 37
comp 2767911..2767984 tgc 400 400 400
comp 2768385..2768942 cds 82481 186
2851424..2851855 cds 62 62 144 62
2851918..2851992 gga 333 333
2852326..2852970 cds 133282 215
comp 2986253..2986402 cds 1 1 50 1
2986404..2986479 aac 372 372
2986852..2989149 cds 60873 766
3050023..3051831 cds 139 139 603 139
3051971..3052061 tca 321 321
3052383..3053693 cds 384243 437
comp 3437937..3438392 cds 233 233 152
comp 3438626..3438702 atgf 56 56
comp 3438759..3438842 ctc 18 18 18
comp 3438861..3439199 cds 113972 113
comp 3553172..3554167 cds 189 189 332 189
comp 3554357..3554433 cgt + 59 59
comp 3554493..3554569 cgt 7 cgt 57 57
comp 3554627..3554703 cgt 2 agc 57 57
comp 3554761..3554837 cgt 57 57
comp 3554895..3554971 cgt 57 57
comp 3555029..3555105 cgt 85 85
comp 3555191..3555282 agc 29 29
comp 3555312..3555388 cgt 31 31
comp 3555420..3555511 agc 243 243
comp 3555755..3555952 cds 83212 66
3639165..3640295 cds 108 108 377 108
3640404..3640479 ttc + 51 51
3640531..3640606 aca 3 ttc 7 7
3640614..3640689 ttc 2 aca 43 43
3640733..3640808 aac 2 aac 69 69
3640878..3640953 aca 10 10
3640964..3641039 ttc 42 42
3641082..3641158 aac 292 292
3641451..3643076 cds 233 233 542
3643310..3643385 ttc 51 51
3643437..3643512 aca + 21 21
3643534..3643609 aac 2 aca 39 39
3643649..3643724 aca 2 aac 15 15
3643740..3643815 aac 156 156 156
comp 3643972..3645405 cds 561 561 478 561
comp 3645967..3646043 gac 31
comp 3646075..3646191 5s 57
comp 3646249..3646324 acc 100
comp 3646425..3646541 5s 111
comp 3646653..3649567 23s -13 -13 -13
comp 3649555..3649797 cds @3 35 35 81 35
comp 3649833..3649908 gca 43 43
comp 3649952..3650028 atc 97
comp 3650126..3651683 16s 557 557 557
comp 3652241..3653491 cds 9514 417
comp 3663006..3663598 cds 181 181 198
comp 3663780..3663864 ttg 177 177 177
comp 3664042..3664707 cds 93515 222
3758223..3759258 cds 578 578 345 578
comp 3759837..3759913 gac 68
comp 3759982..3760098 5s 111
comp 3760210..3763124 23s 290
comp 3763415..3763490 gca 43 43
comp 3763534..3763610 atc 97
comp 3763708..3765265 16s 86
comp 3765351 16s début
Chromosome II
comp 673782..674186 cds 358 358 135
comp 674545..674635 tca 329 329 329
674965..675645 cds 205537 227
881183..882640 cds 244 244 486 244
882885..882958 tgc 302 302
883261..883725 cds 1229 155
884955..886649 cds 245 245 565 245
886895..886981 tta 97 97
887079..887154 ggc 5 5
887160..887233 tgc 317 317
887551..889074 cds 465 508
comp 889540..890328 cds 386 386 263
890715..890801 tta + 53 53
890855..890928 tgc 2 tgc 181 181
891110..891183 tgc 366 366 366
891550..891891 cds 443950 114
1335842..1336042 cds 17 17 17
1336060..1336134 gga 272 272
comp 1336407..1337222 cds 505333 272
1842556..1842741 cds -36 -36 62 -36
1842706..1842789 ctc 29 29 29
1842819..1843430 cds 77699 204
1921130..1921561 cds 62 62 144 62
1921624..1921698 gga 337 337
comp 1922036..1922209 cds 15660 58
comp 1937870..1939129 cds 84 84 420
comp 1939214..1939304 tca 90
comp 1939395..1939511 5s 77
comp 1939589..1942503 23s 306
comp 1942810..1942885 gta 35 35
comp 1942921..1942996 gca 24 24
comp 1943021..1943096 aaa 2 2
comp 1943099..1943174 gaa 114
comp 1943289..1944850 16s 83 83 83
comp 1944934..1945071 cds 46

vha cumuls[modifier | modifier le wikicode]

cumuls. Vibrio campbellii ATCC BAA-1116
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 11 1 0 0 1 3 1 1 100 17
16 aas 23 5s 3 20 10 5 50 8 20 5 200 17
16 atc gca 4 40 17 6 100 10 40 3 300 10
16 cds 23 5s 3 60 16 6 150 12 60 2 400 13
max a 5 80 6 1 200 9 80 3 500 6
a doubles 0 100 6 0 250 9 100 3 600 4
spéciaux 1 120 0 0 300 4 120 3 700 2
total aas 37 140 0 0 350 7 140 3 800 2
sans opérons 27 160 1 0 400 6 160 4 900 0
1 aa 14 180 0 0 450 1 180 1 1000 1
max a 12 200 1 0 500 1 200 2 1100 0
a doubles 10 0 0 8 8 0
total aas 84 57 18 78 38 72
total aas 121
remarques 3
avec jaune moyenne 30 266
variance 19 199
sans jaune moyenne 46 183 86 240
variance 25 114 59 178

vha blocs[modifier | modifier le wikicode]

vha1. Vibrio campbellii ATCC BAA-1116, blocs à rRNA.
cds 103
cds 853 cds 471 16s 86
16s 97 16s 56 16s 97
atc 43 atc 43 atc 43
gca 290 gca 289 gca 290
23s 77 23s 108 23s 111
5s 371 5s 91 5s 68
16s 97 tca gac
atc 43
gca 290
23s 107
5s 101
cds
cds 554 cds 83 cds 119 cds 557
16s 122 16s 82 16s 129 16s 97
gaa 2 gaa 2 gcc 41 atc 43
aaa 30 aaa 30 gaa 55 gca 35
gta 310 gta 310 cds 16 cds -13
23s 117 23s 108 23s 111 23s 111
5s 32 5s 31 5s 31 5s 100
gac gac gac acc 57
5s 31
gac
cds 83 cds 83
16s 114 16s 122
gaa 2 gaa 2
aaa 24 aaa 9
gca 35 gca 37
gta 306 gta 51
23s 77 cds 16
5s 90 23s 77
tca 5s 32
gac

vha remarques[modifier | modifier le wikicode]

  • A faire, en comparaison avec vpb
  • Note du 4.10.20: contrôle des cds, 0/3 cds dans NCBI du 1.8.20

vha distribution[modifier | modifier le wikicode]

  • Lien tableur: vha distribution
  • Notes:
    - gtc2 cta2 tac4 tgc2 cgt6 ggc3
    - acc: 5s + >1aa
    - tca: 2 5s+ 2 1aa
    - gga: 1>a + 3 1aa
    - Séquences:
    (cac cca)2
    cgt5 (cgt agc)2
    ttc (aca aac)2
    (atgf ggc) ggc2 (atgf ggc)4
    ttc aca (ttc aac) aca (ttc aac)
Gm6 vha, Vibrio campbellii ATCC BAA-1116. gama
g1    t1       
atgi 1 tct tat atgf 8
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 4 tcc 1 tac 5 tgc 5
atc 5 acc 2 aac 5 agc 2
ctc 2 ccc cac 2 cgt 7
gtc 2 gcc 1 gac 6 ggc 8
tta 3 tca 4 taa tga
ata aca 5 aaa 4 aga 1
cta 5 cca 3 caa 2 cga
gta 4 gca 7 gaa 5 gga 4
ttg 1 tcg tag tgg 2
atgj 3 acg aag agg 1
ctg ccg cag cgg 1
gtg gcg gag ggg
gama >1aa =1aa -5s +5s -16s +16s total
vha 70 14 11 26 121

Aeromonas media WS[modifier | modifier le wikicode]

amed opérons[modifier | modifier le wikicode]

amed1. Aeromonas media WS
61.2%GC 25.7.19 Paris 126 doubles interca cds aa avec aa cdsa cdsd
6590..7159 cds 3 190
comp 7163..8359 cds 512 512 399
8872..10421 16s 66
10488..10564 atc 10 10
10575..10650 gca 231
10882..13800 23s 98
13899..14013 5s 386 386 386
14400..14717 cds 102422 106
117140..117850 cds 47 47 237 47
117898..117973 ttc 52 52
118026..118101 aca 3 3
118105..118180 ttc 45 45
118226..118301 aac 252 252
118554..119573 cds 50489 340
comp 170063..170329 cds 103 103 89 103
comp 170433..170518 ctg + 71 71
comp 170590..170675 ctg 5 ctg 46 46
comp 170722..170807 ctg 46 46
comp 170854..170939 ctg 51 51
comp 170991..171076 ctg 116 116
comp 171193..172653 cds 146173 487
318827..320692 cds 190 190 622 190
320883..320959 atgi 244 244
comp 321204..323780 cds 62601 859
386382..386732 cds 514 514 117
387247..388802 16s 268
389071..389146 gaa 245
389392..392312 23s 104
392417..392531 5s 268 268 268
comp 392800..394413 cds 81847 538
476261..476482 cds 64 64 74 64
comp 476547..476622 aac 5 5
comp 476628..476703 ttc 622 622
477326..477547 cds 22721 74
500269..500814 cds 177 177 182 177
500992..501067 ggc + 24 24
501092..501167 ggc 6 ggc 29 29
501197..501272 ggc 38 38
501311..501386 ggc 25 25
501412..501487 ggc 23 23
501511..501586 ggc 363 363
comp 501950..502159 cds 4810 70
506970..507110 cds 236 236 47 236
507347..507422 gcc + 28 28
507451..507526 gcc 5 gcc 66 66
507593..507668 gcc 58 58
507727..507802 gcc 40 40
507843..507918 gcc 471 471
508390..508473 riboswitch @1 134002 28
642476..642802 cds 9 9 109 9
642812..642896 ctc 91 91
642988..643064 atgf 166 166
643231..643689 cds 128528 153
772218..774050 cds 195 195 611 195
comp 774246..774329 cta + 8 8
comp 774338..774414 atg 3 atg 38 38
comp 774453..774527 caa 4 caa 47 47
comp 774575..774649 caa 17 17
comp 774667..774743 atg 35 35
comp 774779..774853 caa 47 47
comp 774901..774975 caa 13 13
comp 774989..775065 atg 235 235
comp 775301..776392 cds 3148 364
comp 779541..780557 cds 104 104 339 104
comp 780662..780736 caa -21 -21 -21
comp 780716..781612 cds 373301 299
comp 1154914..1155384 cds 131 131 157 131
comp 1155516..1155592 ccc 226 226
comp 1155819..1157162 cds 67691 448
comp 1224854..1226290 cds 301 301 479
comp 1226592..1226667 aac 2 2
comp 1226670..1226744 gga 164 164 164
comp 1226909..1227181 cds 13604 91
comp 1240786..1241733 cds 350 350 316
comp 1242084..1242156 aac + 2 2
comp 1242159..1242234 aac 2 aac 49 49 49
1242284..1242496 cds 294 71
1242791..1244527 cds 181 181 579 181
1244709..1244796 tcc 407 407
1245204..1246064 cds 161293 287
comp 1407358..1408338 cds 410 410 327
comp 1408749..1408836 tcc 177 177 177
comp 1409014..1409631 cds 34595 206
1444227..1444688 cds 146 146 154
1444835..1444922 tcc 127 127 127
1445050..1446834 cds 14349 595
comp 1461184..1462401 cds 163 163 406 163
comp 1462565..1462640 cac 124 124
comp 1462765..1462838 aga 240 240
comp 1463079..1464389 cds 61984 437
comp 1526374..1527606 cds 151 151 411 151
comp 1527758..1527833 cac 123 123
comp 1527957..1528033 aga 36 36
comp 1528070..1528146 cca 203 203
1528350..1529207 cds 60230 286
1589438..1589644 cds 138 138 69
comp 1589783..1589858 aac 132 132 132
1589991..1592003 cds 57434 671
1649438..1651867 cds 104 104 810 104
comp 1651972..1652048 gtc + 36 36
comp 1652085..1652161 gtc 5 gtc 26 26
comp 1652188..1652264 gtc 15 15
comp 1652280..1652356 gtc 11 11
comp 1652368..1652444 gtc 170 170
comp 1652615..1653994 cds 277443 460
comp 1931438..1932934 cds 145 145 499 145
comp 1933080..1933156 atgf + 110 110
comp 1933267..1933343 atgf 9 atgf 102 102
comp 1933446..1933522 atgf @2 101 101
comp 1933624..1933700 atgf 101 101
comp 1933802..1933877 atgf 103 103
comp 1933981..1934057 atgf 102 102
comp 1934160..1934236 atgf 102 102
comp 1934339..1934415 atgf 92 92
comp 1934508..1934584 atgf 268 268
comp 1934853..1935572 cds 490897 240
comp 2426470..2427675 cds 350 350 402
comp 2428026..2428112 tta 40 40
comp 2428153..2428226 tgc 35 35
comp 2428262..2428337 ggc 181 181 181
comp 2428519..2429073 cds 117921 185
comp 2546995..2547534 cds 271 271 180 271
2547806..2547882 ccc 1103 1103
2548986..2550593 cds 107760 536
2658354..2659094 cds 87 87 247 87
2659182..2659257 acg 108 108
< comp 2659366..2659705 cds 198821 113
comp 2858527..2859036 cds 126 126 170
2859163..2859247 tac + 30 30
2859278..2859362 tac 2 tac 121 121 121
comp 2859484..2863335 cds 115303 1284
2978639..2979358 cds 119 119 240 119
comp 2979478..2979552 gga 104 104
comp 2979657..2979730 ggg 201 201
2979932..2981701 cds 41492 590
3023194..3023487 cds 75 75 98 75
comp 3023563..3023636 tgc 57 57
comp 3023694..3023769 ggc 248 248
3024018..3027455 cds 17375 1146
3044831..3045361 cds 133 133 177 133
comp 3045495..3045584 tcg 380 380
3045965..3046882 cds 221147 306
comp 3268030..3268398 cds 318 318 123
comp 3268717..3268804 tca 198 198 198
3269003..3269752 cds 20717 250
3290470..3291624 cds 50 50 385 50
3291675..3291751 agg 126 126
comp 3291878..3292804 cds 41865 309
3334670..3335758 cds 230 230 363
3335989..3336073 tac + 32 32
3336106..3336190 tac 3 tac 45 45
3336236..3336320 tac 135 135 135
3336456..3336731 cds 169091 92
comp 3505823..3506272 cds 275 275 150 275
comp 3506548..3506662 5s 101
comp 3506764..3509682 23s 229
comp 3509912..3509987 gaa 218
comp 3510206..3511760 16s 592 592
3512353..3515220 cds 161083 956
comp 3676304..3677323 cds 113 113 340
comp 3677437..3677521 ttg 49 49 49
3677571..3678182 cds 9862 204
3688045..3688872 cds 369 369 276
comp 3689242..3689318 cgt + 25 25
comp 3689344..3689420 cgt 5 cgt 25 25
comp 3689446..3689522 cgt 26 26
comp 3689549..3689625 cgt 98 98
comp 3689724..3689800 cgt 4 4
comp 3689805..3689897 agc 213 213 213
comp 3690111..3690299 cds 196546 63
3886846..3887601 cds 302 302 252 302
comp 3887904..3887980 gac 98
comp 3888079..3888193 5s 105
comp 3888299..3891217 23s 231
comp 3891449..3891524 gca 10 10
comp 3891535..3891611 atc 66
comp 3891678..3893232 16s 420 420
comp 3893653..3894195 cds 18750 181
comp 3912946..3913317 cds 60 60 124
comp 3913378..3913454 tgg 52 52 52
comp 3913507..3914691 cds @3 171 171 395 171
comp 3914863..3914937 gga 38 38
comp 3914976..3915060 tac 263 263
3915324..3916262 cds 45900 313
comp 3962163..3963533 cds 306 306 457
comp 3963840..3963916 tgg 202 202 202
3964119..3964703 cds 59641 195
comp 4024345..4026816 cds 658 658 824
comp 4027475..4027551 ccg 140 140 140
comp 4027692..4028417 cds 80995 242
4109413..4111986 cds 99 99 858
comp 4112086..4112200 5s 101
comp 4112302..4115220 23s 231
comp 4115452..4115527 gaa 192
comp 4115720..4117273 16s 94 94 94
comp 4117368..4117547 cds 32227 60
comp 4149775..4150248 cds 204 204 158 204
comp 4150453..4150529 cca 58 58
comp 4150588..4150673 ctg 20 20
comp 4150694..4150769 cac 49 49
comp 4150819..4150895 cgg 258 258
4151154..4151744 cds 74862 197
4226607..4227725 cds 428 428 373
4228154..4229708 16s 192
4229901..4229976 gaa 229
4230206..4233124 23s 104
4233229..4233343 5s 106
4233450..4233525 acc 23
4233549..4233663 5s 164 164 164
4233828..4234793 cds 119351 322
comp 4354145..4355686 cds 622 622 514
4356309..4357863 16s 268
4358132..4358207 gaa 230
4358438..4361364 23s 102
4361467..4361581 5s 106
4361688..4361763 acc 233 233 233
4361997..4363241 cds 71363 415
4434605..4435198 cds 465 465 198
4435664..4437217 16s 219
4437437..4437512 gaa 229
4437742..4440657 23s 103
4440761..4440875 5s 98
4440974..4441050 gac 167 167 167
4441218..4442054 cds 39919 279
comp 4481974..4482513 cds 477 477 180
4482991..4484545 16s 513
4485059..4485549 23s° 37
comp 4485587..4486115 23s° 229
comp 4486345..4486419 gaa 218
comp 4486638..4488193 16s 94 94 94
comp 4488288..4488509 cds 72132 74
comp 4560642..4561676 cds 192 192 345
comp 4561869..4561944 gta + 18 18
comp 4561963..4562038 aaa 7 gta 34 34
comp 4562073..4562148 gta 5 aaa 18 18
comp 4562167..4562242 aaa 2 aag 23 23
comp 4562266..4562341 gta 18 18
comp 4562360..4562435 aaa 23 23
comp 4562459..4562534 gta 18 18
comp 4562553..4562628 aaa 34 34
comp 4562663..4562738 gta 22 22
comp 4562761..4562836 aag 46 46
comp 4562883..4562958 gta 22 22
comp 4562981..4563056 aag 46 46
comp 4563103..4563178 gta 32 32
comp 4563211..4563286 aaa 174 174 174
comp 4563461..4564276 cds 70895 272
comp 4635172..4636173 cds 275 275 334 275
comp 4636449..4636525 gac 95
comp 4636621..4636735 5s 101
comp 4636837..4639756 23s 231
comp 4639988..4640063 gca 10 10
comp 4640074..4640150 atc 66
comp 4640217..4641771 16s 512 512
4642284..4643480 cds 3 399
comp 4643484..4644053 cds 190

amed cumuls[modifier | modifier le wikicode]

cumuls. Aeromonas media WS
opérons Fréquences intercalaires tRNAs Fréquences intercalaires cds Fréquences aas cds
effectif gammes sans rRNAs avec rRNAs gammes cds gammes cdsd gammes cdsa
avec rRNA opérons 10 1 0 - 1 1 40 1 100 14
16 gaa 23 5s 6 20 15 50 5 60 5 200 21
16 atc gca 3 40 27 100 8 80 2 300 15
16 23 5s 0 60 14 150 19 100 3 400 18
max a 3 80 2 200 17 120 4 500 11
a doubles 0 100 3 250 13 140 7 600 6
spéciaux 1 120 8 300 8 160 2 700 3
total aas 18 140 2 350 6 180 8 800 0
sans opérons 38 160 0 400 4 200 5 900 4
1 aa 16 180 0 450 4 220 3 1000 1
max a 14 200 0 500 3 240 2 1100 0
a doubles 12 0 8 6 2
total aas 109 71 0 96 48 95
total aas 127
remarques 3
avec jaune moyenne 49 156
variance 34 77
sans jaune moyenne 214 274
variance 122 157

amed blocs[modifier | modifier le wikicode]

A1. Aeromonas media WS, blocs à rRNA.
cds 512 cds 302 cds 275
16s 66 gac 98 gac 95
atc 10 5s 105 5s 101
gca 231 23s 231 23s 231
23s 98 gca 10 gca 10
5s 386 atc 66 atc 66
16s 420 16s 512
cds 514 275 99
16s 268 101 101
gaa 245 229 231
23s 104 218 192
5s 268 592 94
cds 428 cds 622 cds 465
16s 192 16s 268 16s 219
gaa 229 gaa 230 gaa 229
23s 104 23s 102 23s 103
5s 106 5s 106 5s 98
acc 23 acc 233 gac 167
5s 164

amed remarques[modifier | modifier le wikicode]

  • A faire

amed distribution[modifier | modifier le wikicode]

  • Lien tableur: amed distribution
  • Notes:
    - gtc5 ctg5 gcc5 tac3+2 aac2 caa2+2 atgf9 cgt5 ggc6
    - Séquences
    (atgj caa2)2
    (gta aaa)4 (gta aag)2 gta aaa
Gm7 amed, Aeromonas media WS. gama
g1    t1       
atgi 1 tct tat atgf 10
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 3 tcc 3 tac 6 tgc 2
atc 3 acc 2 aac 6 agc 1
ctc 1 ccc 2 cac 3 cgt 5
gtc 5 gcc 5 gac 3 ggc 8
tta 1 tca 1 taa tga
ata aca 1 aaa 5 aga 2
cta 1 cca 2 caa 5 cga
gta 7 gca 3 gaa 7 gga 3
ttg 1 tcg 1 tag tgg 2
atgj 3 acg 1 aag 2 agg 1
ctg 6 ccg 1 cag cgg 1
gtg gcg gag ggg 1
gama >1aa =1aa -5s +5s -16s +16s total
amed 93 16 5 13 127

gamma synthèse[modifier | modifier le wikicode]

gamma distribution par génome[modifier | modifier le wikicode]

gamma. distribution par génome
gama >1aa 1aa -5s +5s -16s +16s duplica 1-3aas total
spl 46 8 6 79 3 142
vpb 60 11 21 22 12 126
vha 51 14 26 19 11 121
amed 47 16 13 46 5 127
eal 25 23 10 23 4 85
eco 20 23 10 29 4 86
ecoN 20 34 17 44 6 121
total 269 129 0 0 0 103 262 45 808

gamma distribution du total[modifier | modifier le wikicode]

  • Lien tableur: gamma distribution du total
  • Notes: dans le tableau de droite gaa comprend 33 +16s et 1 +5s.
  • Légende:
    - Couleurs du 1er tableau: voir bacilli
    - Couleurs du 2ème tableau: d'après les couleurs du pieds du tableau
    - Tableau des indices, en-tête: total des génomes, total des tRNAs, indice ttt, indice tgt.
Gamma. Distribution du total.
gamma. Distribution du total sans +16s +5s
g1    t1       
atgi 11 tct tat atgf 48
att act aat agt
ctt cct cat cgt
gtt gct gat ggt
ttc 21 tcc 14 tac 30 tgc 18
atc 3 acc 6 aac 34 agc 11
ctc 9 ccc 6 cac 12 cgc 40
gtc 21 gcc 16 gac 7 ggc 46
tta 14 tca 12 taa tga 4
ata aca 19 aaa 33 aga 10
cta 24 cca 14 caa 23 cga
gta 34 gca gaa 17 gga 14
ttg 7 tcg 4 tag tgg 4
atgj 19 acg 4 aag 2 agg 7
ctg 21 ccg 4 cag 6 cgg 7
gtg gcg gag ggg 4
gama7 >1aa 1aa -5s +5s -16s +16s total
type 531 129 0 0 0 0 660
gamma. Distribution du total. +16s +5s (1-3aas)
g1    t1       
atgi tct tat atgf 0
att act aat agt
ctt cct cat cgt
gtt gct gat ggt
ttc tcc tac tgc
atc 23 acc 9 aac agc
ctc ccc cac cgc
gtc gcc 2 gac 23 ggc
tta tca 4 taa tga
ata aca aaa 8 aga
cta cca caa cga
gta 8 gca 29 gaa 34 gga
ttg tcg tag tgg 8
atgj acg aag agg
ctg ccg cag cgg
gtg gcg gag ggg
gama7 >1aa 1aa -5s +5s -16s +16s total
type 45 103 148
gamma. indices du 27.5.20 1183 génomes
g1 t1 1183 86713 1,5  0
atgi 130 tct 1,7 tat 1,3 atgf 292
att 0,1 act 0,5 aat 0,2 agt
ctt 0,9 cct cat cgc
gtt 0,5 gct gat ggt 0,5
ttc 175 tcc 152 tac 227 tgc 114
atc 285 acc 155 aac 311 agc 106
ctc 102 ccc 86 cac 115 cgt 298
gtc 173 gcc 167 gac 289 ggc 351
tta 120 tca 140 taa 1,0 tga 64
ata 0,8 aca 141 aaa 377 aga 151
cta 128 cca 141 caa 189 cga 13
gta 321 gca 283 gaa 324 gga 114
ttg 103 tcg 83 tag 2,7 tgg 113
atgj 170 acg 71 aag 24 agg 110
ctg 252 ccg 62 cag 102 cgg 100
gtg 8,3 gcg 6,9 gag 7,6 ggg 72
inter max min total

gamma distribution par type[modifier | modifier le wikicode]

Gamma. Distribution par type.
gamma. distribution des solitaires
g1    t1          
atgi 9 tct tat atgf 6
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 7 tcc 14 tac tgc 1
atc 1 acc 1 aac 14 agc
ctc 5 ccc 6 cac cgt
gtc gcc gac 3 ggc
tta tca 10 taa tga 4
ata aca aaa aga 6
cta cca 2 caa 1 cga
gta gca gaa 4 gga 4
ttg 7 tcg 4 tag tgg 2
atgj acg 4 aag agg 7
ctg ccg 4 cag cgg
gtg gcg gag ggg 3
gama7 1aa 129
gamma. distribution du type >1aa sans duplicata.
g1    t1          
atgi 2 tct tat atgf 18
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 14 tcc tac 6 tgc 15
atc acc 5 aac 11 agc 11
ctc 4 ccc cac 12 cgt 2
gtc 2 gcc 2 gac ggc 17
tta 14 tca taa tga
ata aca 19 aaa 15 aga 4
cta 18 cca 10 caa 12 cga
gta 13 gca gaa gga 10
ttg tcg tag tgg
atgj 19 acg aag 2 agg
ctg 4 ccg cag cgg 7
gtg gcg gag ggg 1
gama7 >1aa 269
gamma. distribution du type duplicata
g1    t1          
atgi tct tat atgf 24
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc tcc tac 24 tgc 2
atc 2 acc aac 9 agc
ctc ccc cac cgt 38
gtc 19 gcc 14 gac 4 ggc 29
tta tca 2 taa tga
ata aca aaa 18 aga
cta 6 cca 2 caa 10 cga
gta 21 gca gaa 13 gga
ttg tcg tag tgg 2
atgj acg aag agg
ctg 17 ccg cag 6 cgg
gtg gcg gag ggg
gama7 dupli 262

gamma par rapport au groupe de référence[modifier | modifier le wikicode]

Comparaison avec la référence
tRNAs blocs tRNAs blocs rRNAs
gama7 1aa >1aa dup +5s 1-3aas autres total
21 faible 37 18 39 2 96
16 moyen 51 104 31 21 52 259
14 fort 41 147 192 24 49 453
129 269 262 45 103 808
10 g+cga 15 3 6 24
2 agg+cgg 7 7 14
4 carre ccc 11 8 33 2 54
5 autres 4 4
37 18 39 2 96
total tRNAs ‰
gama7 1aa >1aa dup +5s 1-3aas autres gama ‰ ref.‰
21 faible 46 22 48 2 119 26
16 moyen 63 129 38 26 64 321 324
14 fort 51 182 238 30 61 561 650
160 333 324 56 127 808 729
10 g+cga 19 4 7 30 10
2 agg+cgg 9 9 17
4 carre ccc 14 10 41 2 67 16
5 autres 5 5
46 22 48 2 119
blocs tRNAs ‰ total colonne %
gama7 1aa >1aa dup total ref.‰ 1aa >1aa dup
21 faible 56 27 59 142 26 29 7 15
16 moyen 77 158 47 282 324 40 39 12
14 fort 62 223 291 576 650 32 55 73
195 408 397 660 729 129 269 262
10 g+cga 23 5 9 36 10 41 15
2 agg+cgg 11 11 21 19
4 carre ccc 17 12 50 79 16 30 85
5 autres 6 6 11
56 27 59 142 37 39

gamma, estimation des -rRNAs[modifier | modifier le wikicode]

  • Lien tableur: gamma, estimation des -rRNAs
  • Liens fiche:   typage
  • Légende: prélèvement de la base gtRNAdb le 22.1.21
    - ttt et tgt sont nuls partout
    - atgi, c'est Ile2, mis à la place de ttt, très rare chez les procaryotes.
    - atgf, c'est Metf, mis à la place de tgt, très rare chez les procaryotes.
    - atgj, c'est Met, remplace le atg standard qui est la somme Ile2 Met fMet.
    - Voir la légende des tris, g1 t1 et des couleurs

gamma, calcul des -rRNAs[modifier | modifier le wikicode]

gam gamma 144 génomes
gam1 cumul des +rRNAs de la fiche gamma pour 144 génomes
g1    t1       
atgi tct tat atgf 3
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 3 tcc tac 1 tgc
atc 373 acc 57 aac agc 3
ctc ccc cac 10 cgt
gtc gcc 3 gac 151 ggc
tta 1 tca 3 taa tga
ata aca aaa 13 aga
cta cca 14 caa cga
gta 14 gca 378 gaa 423 gga
ttg 1 tcg tag tgg 73
atgj 1 acg aag agg
ctg ccg cag cgg 11
gtg gcg gag ggg
gama144 inter max min total
900 622 14 1536
gam2 indices du clade gamma du 27.5.20 de gtRNAdb pour 100 génomes
g1    t1     1183 1.5  0
atgi 130 tct 1.7 tat 1.3 atgf 292
att 0.1 act 0.5 aat 0.2 agt
ctt 0.9 cct cat cgc
gtt 0.5 gct gat ggt 0.5
ttc 175 tcc 152 tac 227 tgc 114
atc 285 acc 155 aac 311 agc 106
ctc 102 ccc 86 cac 115 cgt 298
gtc 173 gcc 167 gac 289 ggc 351
tta 120 tca 140 taa 1.0 tga 64
ata 0.8 aca 141 aaa 377 aga 151
cta 128 cca 141 caa 189 cga 13
gta 321 gca 283 gaa 324 gga 114
ttg 103 tcg 83 tag 2.7 tgg 113
atgj 170 acg 71 aag 24 agg 110
ctg 252 ccg 62 cag 102 cgg 100
gtg 8.3 gcg 6.9 gag 7.6 ggg 72
gtRNA inter max min total
2517 3550 1254 7321
gam3 cumul des -rRNAs de l'annexe gamma 7 génomes
g1    t1       
atgi 11 tct tat atgf 48
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 21 tcc 14 tac 30 tgc 18
atc 3 acc 6 aac 34 agc 11
ctc 9 ccc 6 cac 12 cgt 40
gtc 21 gcc 16 gac 7 ggc 46
tta 14 tca 12 taa tga 4
ata aca 19 aaa 33 aga 10
cta 24 cca 14 caa 23 cga
gta 34 gca gaa 17 gga 14
ttg 7 tcg 4 tag tgg 4
atgj 19 acg 4 aag 2 agg 7
ctg 21 ccg 4 cag 6 cgg 7
gtg gcg gag ggg 4
gama7 inter max min total
186 380 94 660
gam4 indices des +rRNAs de la fiche gamma pour 100 génomes
g1    t1       
atgi tct tat atgf 2
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 2 tcc tac 1 tgc 18
atc 259 acc 40 aac agc 2
ctc ccc cac 7 cgt 40
gtc gcc 2 gac 105 ggc 46
tta 1 tca 2 taa tga 4
ata aca aaa 9 aga 10
cta cca 10 caa cga
gta 10 gca 263 gaa 294 gga 14
ttg 1 tcg tag tgg 51
atgj 1 acg aag agg 7
ctg ccg cag cgg 8
gtg gcg gag ggg 4
gama144 inter max min total
625 432 10 1067
gam5 estimation des -rRNA du clade gamma pour 100 génomes
g1    t1       
atgi 130 tct 1.7 tat 1.3 atgf 290
att 0.1 act 0.5 aat 0.2 agt
ctt 0.9 cct cat cgc
gtt 0.5 gct gat ggt 0.5
ttc 173 tcc 152 tac 226 tgc 114
atc 26 acc 115 aac 311 agc 104
ctc 102 ccc 86 cac 108 cgt 298
gtc 173 gcc 165 gac 184 ggc 351
tta 119 tca 138 taa tga 64
ata 0.8 aca 141 aaa 368 aga 151
cta 128 cca 131 caa 189 cga 13
gta 311 gca 21 gaa 30 gga 114
ttg 102 tcg 83 tag tgg 62
atgj 169 acg 71 aag 24 agg 110
ctg 252 ccg 62 cag 102 cgg 92
gtg 8.3 gcg 6.9 gag 7.6 ggg 72
-rRNA inter max min total
1892 3118 1244 6254
gam6 indices des -rRNAs de l'annexe archeo pour 100 génomes
g1    t1       
atgi 157 tct tat atgf 686
att act aat agt
ctt cct cat cgc
gtt gct gat ggt 0.5
ttc 300 tcc 200 tac 429 tgc 257
atc 43 acc 86 aac 486 agc 157
ctc 129 ccc 86 cac 171 cgt 571
gtc 300 gcc 229 gac 100 ggc 657
tta 200 tca 171 taa tga 57
ata aca 271 aaa 471 aga 143
cta 343 cca 200 caa 329 cga 13
gta 486 gca gaa 243 gga 200
ttg 100 tcg 57 tag tgg 57
atgj 271 acg 57 aag 29 agg 100
ctg 300 ccg 57 cag 86 cgg 100
gtg gcg gag ggg 57
gama7 inter max min total
2657 5429 1343 9429

gamma, comparaison clade-annexe des -rRNAs[modifier | modifier le wikicode]

  • Lien tableur: gamma, comparaison clade-annexe des -rRNAs
  • Légende
    - gam7. diff, somme des couleurs de gam7. La différence entre tRNAs est faite entre gam5 et gam6 du tableau précédent. Elle est exprimée en % et rapporté à la plus grande valeur des 2 termes de la différence. Ce qui fait quand un tRNA est à zéro la différence en % est égale à 100.
    - gam8. rap, rapport des sommes couleurs gam5/gam2. Le rapport -rRNA/total est celui du tRNA de gam5 sur celui de gam2.
  • Fréquences des différences en % du tableau gam7
gamme		0/0	10	20	30	40	50	60	70	80	90	100		total
fréquence	0	7	7	6	8	10	2	1	0	1	6	0	48
tot ≤ 50						38							
  • Comparaison avec le nombre de tRNAs de la fiche du clade: L’estimation des -rRNA par l'annexe est 62% au dessus de celle de la fiche des gamma.
tRNAs		fiche		annexe
sans		8335		660
avec		1401		148
genomes		144		7
indice %	58		94
gam gamma 63 génomes
gam7 gamma, différence clade-annexe des -rRNAs
g1    t1       
atgi 17 tct 100 tat 100 atgf 58
att 100 act 100 aat 100 agt
ctt 100 cct cat cgc
gtt 100 gct gat ggt 100
ttc 42 tcc 24 tac 47 tgc 56
atc 39 acc 26 aac 36 agc 34
ctc 21 ccc 0 cac 37 cgt 48
gtc 42 gcc 28 gac 46 ggc 47
tta 40 tca 20 taa tga 11
ata 100 aca 48 aaa 22 aga 5
cta 63 cca 34 caa 42 cga 100
gta 36 gca 100 gaa 88 gga 43
ttg 2 tcg 31 tag tgg 8
atgj 38 acg 20 aag 16 agg 9
ctg 16 ccg 8 cag 16 cgg 8
gtg 100 gcg 100 gag 100 ggg 21
diff inter max min total
425 656 229 1310
gam8 gamma, rapports -rRNA/total
g1    t1       
atgi tct tat atgf 99
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttc 99 tcc tac tgc
atc 9 acc 74 aac agc 98
ctc ccc cac 94 cgt
gtc gcc 99 gac 64 ggc
tta 99 tca 99 taa tga
ata aca aaa 98 aga
cta cca 93 caa cga
gta 97 gca 7 gaa 9 gga
ttg 99 tcg tag tgg 55
atgj acg aag agg
ctg ccg cag cgg 92
gtg gcg gag ggg
rap inter max min total
75 88 99 85