Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/gamma

Shewanella

spl opérons

• Liens: gtRNAdb [1], NCBI [2], génome []
• Lien tableur: spl opérons

S1. Shewanella pealeana

39.1%GC	30.6.19 Paris	147	doubles	interca
	45136..46685	16s	@1	339
	47025..49946	23s		112
	50059..50174	5s
	51490..53039	16s		339
	53379..56298	23s		114
	56413..56528	5s
	182271..183820	16s	@2	71
	183892..183968	atc		65
	184034..184109	gca		364
	184474..187395	23s		112
	187508..187623	5s		100
	187724..187800	gac
	191614..191689	aca		8
	191698..191782	tac		35
	191818..191891	gga
	235182..236731	16s		374
	237106..240025	23s		114
	240140..240255	5s
	243631..245180	16s		338
	245519..248440	23s		113
	248554..248669	5s		68
	248738..248813	acc		17
	248831..248946	5s
	416766..416842	cgg		39
	416882..416957	cac		41
	416999..417075	cca	+	58
	417134..417210	cca	2 cca
	493711..495260	16s		339
	495600..498519	23s		114
	498634..498749	5s
	641376..641466	tca	@3	1172
	642639..642729	tca
	645847..647396	16s		71
	647468..647544	atc		65
	647610..647685	gca		329
	648015..650937	23s		156
	651094..651209	5s
	728115..728199	ttg
comp	1168942..1169018	atgi
comp	1339706..1339781	aca	+	52
comp	1339834..1339909	ttc	2 ttc	539
comp	1340449..1340524	aca	2 aca	52
comp	1340577..1340652	ttc
comp	1342467..1342542	aca		52
comp	1342595..1342670	ttc
	1456724..1456815	agc		21
	1456837..1456913	cgt	+	30
	1456944..1457020	cgt	7 cgt	32
	1457053..1457129	cgt	3 agc	30
	1457160..1457236	cgt		33
	1457270..1457346	cgt		9
	1457356..1457447	agc		76
	1457524..1457600	cgt		35
	1457636..1457712	cgt		9
	1457722..1457813	agc
comp	1627363..1627438	agg
comp	1770483..1770558	gta	+	37
comp	1770596..1770671	gta	11 gta	37
comp	1770709..1770784	gta		37
comp	1770822..1770897	gta		37
comp	1770935..1771010	gta		37
comp	1771048..1771123	gta		37
comp	1771161..1771236	gta		37
comp	1771274..1771349	gta		37
comp	1771387..1771462	gta		37
comp	1771500..1771575	gta		39
comp	1771615..1771690	gta
	1773910..1773985	gcc	+	80
	1774066..1774141	gaa	13 gaa	102
	1774244..1774319	gaa	2 gcc	102
	1774422..1774497	gaa		102
	1774600..1774675	gaa		102
	1774778..1774853	gaa		102
	1774956..1775031	gaa		102
	1775134..1775209	gaa		102
	1775312..1775387	gaa		253
	1775641..1775716	gaa		102
	1775819..1775894	gaa		102
	1775997..1776072	gaa		102
	1776175..1776250	gaa		102
	1776353..1776428	gaa		47
	1776476..1776551	gcc
	2081297..2082846	16s		338
	2083185..2086104	23s		114
	2086219..2086334	5s
comp	2143274..2143350	ccc
comp	2366164..2366240	atgf	+	40
comp	2366281..2366357	atgf	4 atgf	40
comp	2366398..2366474	atgf		40
comp	2366515..2366591	atgf
	2376218..2376308	tca
	2379767..2379842	ggc		13
	2379856..2379929	tgc		85
	2380015..2380100	tta
	2550857..2550932	ggc		13
	2550946..2551019	tgc	+	95
	2551115..2551200	tta	3 tgc	634
	2551835..2551908	tgc	3 tta	95
	2552004..2552089	tta		479
	2552569..2552642	tgc		132
	2552775..2552860	tta
	2558019..2558109	tca
comp	2717566..2717655	tcc
comp	2759730..2759806	atgf	+	189
comp	2759996..2760072	atgf	4 atgf	45
comp	2760118..2760194	gtc	2 gtc	2
comp	2760197..2760273	atgf		35
comp	2760309..2760385	gtc		13
comp	2760399..2760475	atgf
	2858823..2858907	tac	+	30
	2858938..2859022	tac	5 tac	85
	2859108..2859192	tac		107
	2859300..2859384	tac		107
	2859492..2859576	tac
	2866268..2866343	aac	+	45
	2866389..2866464	aac	7aac	41
	2866506..2866581	aac		26
	2866608..2866683	aac		32
	2866716..2866791	aac		33
	2866825..2866900	aac		40
	2866941..2867016	aac
comp	2929429..2929505	gac	+	97
comp	2929603..2929679	gac	4 gac	97
comp	2929777..2929853	gac		83
comp	2929937..2930013	gac
comp	3120289..3120364	aaa	+	58
comp	3120423..3120498	aaa	12 aaa	58
comp	3120557..3120632	aaa		58
comp	3120691..3120766	aaa		59
comp	3120826..3120901	aaa		57
comp	3120959..3121034	aaa		58
comp	3121093..3121168	aaa		58
comp	3121227..3121302	aaa		59
comp	3121362..3121437	aaa		58
comp	3121496..3121571	aaa		59
comp	3121631..3121706	aaa		59
comp	3121766..3121841	aaa
comp	3269860..3269935	cac		8
comp	3269944..3270020	aga		63
comp	3270084..3270160	cca
comp	3757983..3758059	atgf
comp	3758163..3758249	ctc
comp	3835257..3835331	caa	+	51
comp	3835383..3835467	cta	5 caa	131
comp	3835599..3835673	caa	5 cta	20
comp	3835694..3835778	cta	3 atg	96
comp	3835875..3835949	caa		49
comp	3835999..3836083	cta		211
comp	3836295..3836371	atg		5
comp	3836377..3836451	caa		47
comp	3836499..3836583	cta		55
comp	3836639..3836715	atg		5
comp	3836721..3836795	caa		47
comp	3836843..3836927	cta		55
comp	3836983..3837059	atg
comp	3862885..3862961	tgg	+	167
comp	3863129..3863205	tgg	2 tgg
comp	3867049..3867164	5s		114
comp	3867279..3870198	23s		338
comp	3870537..3872086	16s
	3882154..3882229	ttc
comp	4331488..4331563	ggc	+	130
comp	4331694..4331769	ggc	6 ggc	47
comp	4331817..4331892	ggc		162
comp	4332055..4332130	ggc		16
comp	4332147..4332222	ggc		48
comp	4332271..4332346	ggc
comp	4616881..4616996	5s		112
comp	4617109..4620030	23s		364
comp	4620395..4620470	gca		65
comp	4620536..4620612	atc		71
comp	4620684..4622233	16s
comp	5129770..5129846	gac		100
comp	5129947..5130062	5s		115
comp	5130178..5133097	23s		339
comp	5133437..5134986	16s

spl cumuls

• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.spl. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

spl cumuls	opérons			effectif
avec rRNA	opérons			11
		16 23 5s 0		6
		16 atc gca		3
		16 23 5s a		2
		max a			3
		a doubles		0
		spéciaux		0
		total aas		9
sans 		opérons			29
		1 aa			8
		max a			15
		a doubles		15
		total aas		133
total aas				142
remarques				3

spl blocs

• Lien tableur: spl blocs

S1. Shewanella pealeana, blocs à rRNA.

16s	339	339	374	339	338	338
23s	112	114	114	114	114	114
5s
16s	71	71	71	16s	338	16s	339
atc	65	65	65	23s	113	23s	115
gca	364	329	364	5s	68	5s	100
23s	112	156	112	acc	17	gac
5s	100			5s
gac

spl remarques

• Remarques :
  1. @1   8 blocs 16-23-5s. Ils ont tous les mêmes intercalaires, 338 113 68.

       - 6 blocs sont solo avec un dont l'intercalaire 16s-23s fait 11% de plus que le reste, 36/338.

       - 2 blocs avec 1 aa dont un possède en plus un 5s, gac et acc-5s.

  2. @2   Les 2 blocs 16-atc-gca ont les mêmes intercalaires, 71 65 364 112. L’intercalaire 23s-5s est le même que les 6 autres blocs.

       - Les 2 blocs n'ont que 5 aas, soit pour les 8 opérons à rRNA 7 aas au total. Ce qui est quasiment nul.

  3. @3   Les intercalaires élevés ne touchent que 3 opérons sans rRNAs

				
	-		anciens	-		nouveaux	-
	intercalires	n aas	doubles		nv doubles	nv opérons
	1172		2	2			0	2
	539		4	2,2			0	2
	634, 479	6	3,3			0	3
					
	résultats	ancien 	nouveau		
	total opérons	29	33		
	1 aa		8	10		
	max aa		15	15		
	doubles		15	12		

• Séquences des doubles : Les intercalaires excessives ne changent pas fondamentalement le spectre des doubles et leurs séquences. Ainsi les répétitions suivantes sont caractéristiques de ce génome.

  - opéron à 13 gaa avec 11 intercalalires identiques de 102 bases, soit 11 répétitions d’une séquence de 180 bases environ, longueur de gaa+102.

  - Les répétitions de séquences sont nombreuses. La plus longue est celle de l’opéron à 5 cta 5 caa 3 atg. Ce sont 5 séquences caa-cta avec un intercalaire de 50 interrompues par 2 atg et 2 intercalaires de 100 bases environ.

  - Les 2 autres opérons à séquences répétées sont, 4atgf 2gtc (2*(2atgf-gtc)) et 6 ggc (avec 2 ggc-ggc séparées par des intercalaires longs).

  - Répétitions du même codon avec son intercalaire comme pour le cas de l'opéron à 15 codons,

				
	codon	répétition	intercalaire		
	gaa	13		102		
	gta	11		37		
	tac	5		100		
	aac	7		35		
	gac	4		97		
	aaa	12		58		
	atgf	4		40		

spl distribution

• Lien tableur: spl distribution
• Notes:

  - gta11 tca2 cca2 tac5 aac7 gac4 aaa12 gaa13 atgf4+2 cgt5+2 ggc8 tgg2

  - tca: tca2, 2 1aa

  - gac: 2 5s, gac4

  - Séquences:

  (aca ttc)2

  (tgc tta)3

  (atf gtc)2

  (caa cta atgj)3 ou (caa cta)5

Gm1 spl, Shewanella pealeana. gama

g1		t1
a atgi	1	a tct		tat		atgf	9
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	4	b tcc	1	tac	6	tgc	4
f atc	3	j acc	1	aac	7	agc	3
g ctc	1	f ccc	1	cac	2	cgt	7
h gtc	2	n gcc	2	gac	6	ggc	8
i tta	4	c tca	4	taa		tga
j ata		k aca	4	aaa	12	aga	1
k cta	5	g cca	3	caa	5	cga
l gta	11	o gca	3	gaa	13	gga	1
m ttg	1	d tcg		tag		tgg	2
n atgj	3	l acg		aag		agg	1
o ctg		h ccg		cag		cgg	1
p gtg		p gcg		gag		ggg
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
spl	125	8		3		6	140

spl intergen51

Intergen51. spl. Le génome

• spl Le prélèvement: Aspl
• Le nom et le lien NCBI: spl, Shewanella pealeana ATCC 700345, NCBI [3], date 24.09.20.
• Note de l'étude préliminaire pour l'étude des intercalaires cds-cds:

  - Pour les génomes des annexes j'ai relevé les intercalaires entre tRNAs et entre ceux-ci et les cds qui leur sont adjacents. L'exemple est celui de rru du clade alpha. L'idée de départ de ces prélèvements est la recherche d'opérons formés de tRNA et de protéine comme dans le cas d'E.coli: l'intercalaire entre le tRNA et la protéine devrait être faible. Voir l'exemple d'eco (remarque @3) avec tac-tac-tpr et aca-tac-gga-acc-tufB.

• spl La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
spl	789 212		5 174 581	15,3

spl données intercalaires

• Lien tableur: spl données intercalaires
• Lien sauvegarde NCBI: Aspl

spl données intercalaires 200

• Lien tableur: données intercalaires 200.

spl autres intercalaires aas

• Lien tableur: spl autres intercalaires aas
• Lien sauvegarde NCBI: Aspl

Intergen51. spl. Les différents types d'intercalaires

• Lien au tableur: Intergen51. spl les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 spl les différents types d'intercalaires entre gènes

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 2 482 414 17 2 913 2,2 141 7 148 x 1 305 12 1 1 318 0 11 11 t 3 787 426 18 4 231 141 18 159 % 89,5 10,1 0,4

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 39 0 0 39 1,7 tRNA-CDS 62 25 x 22 1 0 23 RNA-RNA 141 56 t 61 1 0 62 CDS-rRNA 18 7 % 98,4 1,6 0,0 non RNA 32 13 - total 253 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 10,2 38,5 1,2 24,1 0,0 63 0,6 0,0 x 17,6 30,4 8,3 3,1 0,0 58 0,1 0,0

Intergen51. spl. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  spl présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: à partir des colonnes fx fc des données intercalaires.

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	spl
R2	x3		x2		x		c		Inflexion poly3	x	c
0,613	3,91E-06	-2,74E-03	4,89E-01	6,45	fx1	abscisse	220,9	150,6
0,805	-4,24E-06	3,25E-03	-8,35E-01	85,1	fc1	ordonnée	21,5	24,0
					
0,655	1,66E-06	-1,10E-03	1,26E-01	29,4	fx41			
0,909	8,15E-07	-3,68E-04	-6,78E-02	39,8	fc41			

• Moyennes glissantes des fc+400, diagonale. Voir le détail des calculs dans abs.

données	spl		calculs			poly3	spl
effect	2482		R2.21	802		abscis	400
xm	45		pte	8,97		flexa	150
ym	7		cste	3,22		flexo	2,36
x1m	248		r400l	152		xm	42
y1m	1		restp	222,00		sup4	97,4
rfin	101,93		%sd	27,38		sup4t	334,0
bornf	147		lond	203		%	29,2
supd	132,4		%sf	28,56		long	108
supdt	483,5		lonf	102			
xmp	294,52		sf/lf	0,89			
r400	120,06		sr/lr	0,41			
supf	90,7		sd/ld	0,65			
supft	317,5		i.r400	0,79							

Intergen51. spl. Les CDS-CDS négatifs

Sous-totaux	spl			totale	
fréquence	x-	c-		x-	c-
-1		0	126		4	4140
-2		2	0		85	11
-3		0	0		3	12
-4		5	136		717	10938
-5		0	0		5	19
sp6		5	152		1642	8424
total		12	414		2 456	23 544
reste		1	5		264	420
s6		1	0		361	41
s7		0	30		321	1438
s8		3	117		696	6525
rappot s1-5						
4/2/1		2,5	1,1		8,4	2,6
% / sp6						
s6/sp6		20,0	0,0		22,0	0,5
s7/sp6		0,0	19,7		19,5	17,1
s8/sp6		60,0	77,0		42,4	77,5
reste/sp6	20,0	3,3		16,1	5,0
						
total s1-5	7	262		814	15120
% / total						
%s1-5		58,3	63,3		33,1	64,2
%sp6		41,7	36,7		66,9	35,8

Intergen51. spl. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		11			CDS 16s		5	5
16s 23s		8			5s CDS		2	6
16s tRNA	3			16 CDS			
tRNA 23s	3			CDS 5s			
5s tRNA		3			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig				5s 16s		1	
tRNA hors	108			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		140	0		total		8	11

• Les rares voir gamma pour la longueur des intercalaires

type		c	x
tRNA CDS 		-23
tRNA5s-acc	17	
5s16s		1319	

• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. spl. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. spl. Les intercalaires tRNA-tRNA extra bloc
• Les contigus aux blocs: inexistants
• Les hors blocs: 108 au total avec de fortes répétitions qui donnent un diagramme en dents de scie (tableur). Voir les doubles dans ancien spl et le chapitre distribution qui le suit.
• Notes: les 12 intercalaires supérieurs à 120 pdbs sont dans des séquences à répétition

1172	tca	51	caa	80	gcc
**	tca	131	cta	11* 102	gaa
52	aca	20	caa	253	gaa
539	ttc	96	cta	47	gaa
52	aca	49	caa	**	gcc
**	ttc	211	cta	13	ggc
128	cat	5	atgj	95	tgc
128	cat	47	caa	634	tta
189	atgf	55	cta	95	tgc
45	atgf	5	atgj	479	tta
2	gtc	47	caa	132	tgc
35	atgf	55	cta	**	tta
13	gtc	**	atgj		
**	atgf	167	tgg		
		**	tgg		

Int51.31 spl. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa		inter	aa
8	aca		9* 37	gta		30	tac		8	cac
35	tac		39	gta		85	tac		63	aga
**	gga		**	gta		107	tac		**	cca
39	cgg		80	gcc		107	tac		103	atgf
41	cac		11* 102	gaa		**	tac		**	ctc
58	cca		253	gaa		45	aac		51	caa
**	cca		47	gaa		41	aac		131	cta
1172	tca		**	gcc		26	aac		20	caa
**	tca		3* 40	atgf		32	aac		96	cta
52	aca		**	atgf		33	aac		49	caa
539	ttc		13	ggc		40	aac		211	cta
52	aca		85	tgc		**	aac		5	atgj
**	ttc		**	tta		97	gac		47	caa
52	aca		13	ggc		97	gac		55	cta
**	ttc		95	tgc		83	gac		5	atgj
21	agc		634	tta		**	gac		47	caa
30	cgt		95	tgc		58	aaa		55	cta
32	cgt		479	tta		58	aaa		**	atgj
30	cgt		132	tgc		58	aaa		167	tgg
33	cgt		**	tta		59	aaa		**	tgg
9	cgt		128	cat		57	aaa		20	ggc
76	agc		128	cat		58	aaa		13	ggt
35	cgt		189	atgf		58	aaa		47	ggc
9	cgt		45	atgf		59	aaa		47	ggc
**	agc		2	gtc		58	aaa		15	ggt
			35	atgf		59	aaa		16	ggc
			13	gtc		59	aaa		48	ggc
			**	atgf		**	aaa		**	ggc

spl intercalaires entre cds

• Lien NCBI [4]
• Note: Pour les génomes des annexes j'ai relevé les intercalaires entre tRNAs et entre ceux-ci et les cds qui leur sont adjacents. L'exemple est celui de rru du clade alpha. L'idée de départ de ces prélèvements est la recherche d'opérons formés de tRNA et de protéine comme dans le cas d'E.coli: l'intercalaire entre le tRNA et la protéine devrait être faible. Voir l'exemple d'eco (remarque @3) avec tac-tac-tpr et aca-tac-gga-acc-tufB.

spl intercalaires positifs S+

• Lien tableur: spl intercalaires positifs S+
• Diagrammes 400:  spl myr,   diagramme 1-40: c+ spl myr total,   texte: myr.
• Légende du tableau diagrammes 400: voir la légende de cvi.

spl. Sx+ Sc+ Les diagrammes 400

spl	Sx+							Sc+
Poly3	-7	-5	-3	1	R2	flex x+	comment.	-7	-5	-3	1	R2	flex c+	comment.
1 à 400	47	-333	594	7.7	611	236	max80	-47	363	-934	95	806	257	min50
31 à 400	-	-	-	-	-	-		10.3	-50	-57	43	915	162	2 parties
droite	-a	cste	-	R2	note	R2’		-a	cste	-	R2	note	R2’
1 à 400	59	37	-	275	poly	336	tF	158	57		614	poly	192	SF
31 à 400								106	43	-	885	dte	30	tf

• Légende du tableau corrélations et fréquences faibles

spl. Sx+ Sc+ Les diagrammes 400. Corrélations et les fréquences faibles 1-30

		effectifs diagramme			corrélation x+ c+, 41-n				corrélation x+ c+, 1-n
gen	minima	x+	c+	total	400	200	250	diff	200	250	400
myr	min20	828	2081	2909	872	649	764	115	-143	41	323
spl	min10	1071	2215	3286	884	735	784	49	-353	-202	172
rru	min40	874	2056	2930	829	193	611	418	722	792	861
1-30 ‰			effectifs		0 ‰		<0 ‰		effectifs 1-40		corel
1-30 x+	1-30 c+	x+/c+	x	c	x	c	x-	c-	x+	c+	x+/c+
71	392	0.18	999	2556	5	5	20	110	97	899	-78
37	270	0.14	1313	2900	1	6	9	143	69	683	-342
169	266	0.64	1037	2749	1	4	71	222	175	630	17

• Diagrammes 400:  spl myr,   diagramme 1-40: c+ spl myr total,   texte: myr.
• Résumé: spl ressemble beaucoup à myr. C’est le 3ème génome sans fréquences faibles, 1-30, sur les 13 que j’ai signalés dans ase et cvi. Son minimum x+ est à la fréquence 10, min10. La conséquence, c’est 1 tilde fort du diagramme x+ 31-400. Mais ce génome a la particularité d’avoir une corrélation forte comme ase cvi abra myr dans la plage 41-250, en plus de n’avoir quasiment pas de fréquences faibles.

  - Les courbes des diagrammes 400

  • Je n’ai pas représenté le diagramme x+ 31-400, les fréquences faibles ayant très peu d’effectifs pour modifier notablement la courbe de x+ 1-400.
  • Au minimum local min50 de c+ 1-400, x+ 1-400 présente un maximum local max80, décalé par rapport à celui de myr, max70.
  • Et toujours la courbe du c+ 1-400 est un SF.
  • x+ 1-400 a un tilde très fort, tF, avec un R2’ de 336 comme cbei et pmq, et plus fort que celui de abra et myr , R2’ 96 68.
  • c+ 31-400 a un tilde très faible, tf, avec un R2’ 30 contre 85 86 pour respectivement abra et myr. La courbe est quasiment une droite avec 2 renflements dans la 1ère partie.

  - Les corrélations

  • Le total des effectifs est aussi élevé que celui de myr, 3286 contre 2909 et comme myr sa corrélation 41-250 est forte, 784 contre 764. Par contre sa corrélation se maintient dans la plage de fréquences 41-200, avec une différence (diff) de 49 contre 115 pour myr.
  • A cause des fréquences faibles inexistantes les corrélations 1-n sont très faibles en positif ou en négatif, comme abra, mais au contraire de pmg qui a des taux de fréquences faibles élevés et des corrélations 1-n nettement supérieures à celles du 41-250, autour de 900.

  - Les courbes des diagrammes 1-40

  • Avec un effectif réduit de 69 pour le total des fréquences x+ 1-40, le diagramme et la corrélation c+/x+ sont peu significatifs.
  • Avec un effectif élevé de 683 le diagramme des c+ 1-40 ressemble beaucoup au modèle et à celui de ade avec un effectif de 876, nette mieux que celui de myr avec un effectif de 899.

Vibrio parahaemolyticus

vpb opérons

• Liens: gtRNAdb [5], NCBI chr1 [6], NCBI chr2 [7], génome []
• Lien tableur: vpb opérons
• Légende:

  - cds1 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF

  - cds2 198 MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKSYVSSQGSTFSKDFQSRRF

  - cds3 180 MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS

vpb1. Vibrio parahaemolyticus BB22OP

45.3%GC	6.7.19 Paris	126	doubles	interca
		chr1
	33614..35175	16s	@4	80
	35256..35331	gaa		2
	35334..35409	aaa		30
	35440..35515	gta		55
comp	35571..35768	cds1		59
	35828..38743	23s		73
	38817..38932	5s
	49997..50073	cgg		32
	50106..50181	cac	+	72
	50254..50330	cca	2 cac	49
	50380..50455	cac	2 cca	24
	50480..50556	cca
comp	400045..400120	atgi
	577971..579532	16s		88
	579621..579696	gcc		12
	579709..579784	gaa		258
	580043..582958	23s		73
	583032..583147	5s		30
	583178..583254	gac		35
	583290..583366	tgg
comp	769649..769733	cta	+	29
comp	769763..769847	cta	10 cta	47
comp	769895..769971	atg	4 atg	24
comp	769996..770080	cta	5 caa	52
comp	770133..770207	caa		29
comp	770237..770321	cta		53
comp	770375..770451	atg		24
comp	770476..770560	cta		52
comp	770613..770687	caa		29
comp	770717..770801	cta		54
comp	770856..770930	caa		29
comp	770960..771044	cta		35
comp	771080..771154	caa		48
comp	771203..771287	cta		31
comp	771319..771403	cta		77
comp	771481..771557	atg		77
comp	771635..771709	caa		31
comp	771741..771825	cta		40
comp	771866..771942	atg
	786939..787015	cca
comp	802315..802391	agg
	910219..910295	aga
comp	982089..982173	tac	+	81
comp	982255..982339	tac	4 tac	81
comp	982421..982505	tac		81
comp	982587..982671	tac
	1124715..1124802	tcc
	1418321..1418397	gtc	+	32
	1418430..1418506	gtc	2gtc
comp	1988127..1988202	ggc	+	10
comp	1988213..1988299	tta	2 ggc	76
comp	1988376..1988451	ggc		20
comp	1988472..1988545	tgc
	2164082..2164157	aac
	2193593..2193683	tca
comp	2547884..2547960	atgf		56
comp	2548017..2548100	ctc
	2652092..2652168	cgt	+	56
comp	2652225..2652301	cgt	9 cgt	57
comp	2652359..2652435	cgt	2 agc	57
comp	2652493..2652569	cgt		57
comp	2652627..2652703	cgt		57
comp	2652761..2652837	cgt		56
comp	2652894..2652970	cgt		210
comp	2653181..2653257	cgt		31
comp	2653289..2653380	agc	@5	320
comp	2653701..2653777	cgt		31
comp	2653809..2653900	agc
	2735697..2735772	ttc	+	64
	2735837..2735912	aca	3 ttc	7
	2735920..2735995	ttc	2 aca	70
	2736066..2736141	aac	2 aac	71
	2736213..2736288	aca		7
	2736296..2736371	ttc		43
	2736415..2736490	aac
	2738623..2738698	ttc		51
	2738750..2738825	aca	+	21
	2738847..2738922	aac	2 aca	39
	2738962..2739037	aca	2 aac	15
	2739053..2739128	aac
comp	2741263..2741339	gac		31
comp	2741371..2741487	5s		57
comp	2741545..2741620	acc		100
comp	2741721..2741836	5s		73
comp	2741910..2744825	23s		257
comp	2745083..2745158	gca		41
comp	2745200..2745276	atc		56
comp	2745333..2746894	16s
comp	2755928..2756012	ttg
comp	2847646..2847722	tgg		68
comp	2847791..2847867	gac		30
comp	2847898..2848013	5s		73
comp	2848087..2851002	23s		258
comp	2851261..2851336	gaa		80
comp	2851417..2852978	16s
comp	2987485..2987561	atgf	+	56
comp	2987618..2987693	ggc	5 atgf	18
comp	2987712..2987788	atgf	8 ggc	35
comp	2987824..2987899	ggc		50
comp	2987950..2988025	ggc		49
comp	2988075..2988150	ggc		49
comp	2988200..2988275	ggc		30
comp	2988306..2988382	atgf		55
comp	2988438..2988513	ggc		30
comp	2988544..2988620	atgf		39
comp	2988660..2988735	ggc		19
comp	2988755..2988831	atgf		35
comp	2988867..2988942	ggc
comp	3060924..3061000	tgg		68
comp	3061069..3061145	gac		30
comp	3061176..3061291	5s		73
comp	3061365..3064280	23s		257
comp	3064538..3064613	gta		14
comp	3064628..3064703	gca		32
comp	3064736..3064811	aaa		2
comp	3064814..3064889	gaa		80
comp	3064970..3066531	16s	@3	319
comp	3066851..3066966	5s		73
comp	3067040..3069955	23s		261
comp	3070217..3071778	16s
comp	3105094..3105169	acc		13
comp	3105183..3105257	gga		35
comp	3105293..3105377	tac		36
comp	3105414..3105489	aca
comp	3111073..3111149	gac		30
comp	3111180..3111295	5s		73
comp	3111369..3114284	23s		261
comp	3114546..3116107	16s	@1	317
comp	3116425..3116540	5s		73
comp	3116614..3119529	23s		261
comp	3119791..3121352	16s
comp	3175944..3176034	tca		69
comp	3176104..3176219	5s		73
comp	3176293..3179211	23s		257
comp	3179469..3179544	gca		41
comp	3179586..3179662	atc		56
comp	3179719..3181280	16s	@2
comp	3217187..3217263	gac		30
comp	3217294..3217409	5s		73
comp	3217483..3220398	23s		59
	3220458..3220655	cds2		55
comp	3220711..3220786	gta		30
comp	3220817..3220892	aaa		2
comp	3220895..3220970	gaa		80
comp	3221051..3222612	16s
		chr2
	132908..134469	16s		80
	134550..134625	gaa		2
	134628..134703	aaa		16
	134720..134795	gca		14
	134810..134885	gta		54
comp	134940..135122	cds3		19
	135142..138059	23s		73
	138133..138248	5s		69
	138318..138408	tca
comp	192886..192969	ctc
comp	591931..592021	tca
comp	1009457..1009530	tgc		73
comp	1009604..1009690	tta
comp	1021568..1021641	tgc		73
comp	1021715..1021801	tta
comp	1029973..1030048	ggc		3
comp	1030052..1030125	tgc
	1125193..1125267	gga

vpb cumuls

• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.vpb. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

vpb cumuls	opérons		effectif
avec rRNA	opérons		9
		16 23 5s 0	0
		16 atc gca	2
		16 23 5s a	1
		max a		6
		a doubles	0
		spéciaux	6
		total aas	33
sans 		opérons		25
		1 aa		11
		max a		19
		a doubles	8
		total aas	93
total aas			126
remarques			5

vpb blocs

• Lien tableur: vpb blocs

vpb1. Vibrio parahaemolyticus BB22OP, blocs à rRNA.

16s	80	16s	80	16s	80
gaa	2	gaa	2	gaa	2
aaa	30	aaa	30	aaa	16
gta	55	gta	55	gca	14
cds 198	59	cds 198	59	gta	54
23s	73	23s	73	cds 180	19
5s		5s	30	23s	73
		gac		5s	69
				tca
16s	56	16s	56	16s	88	16s	80
atc	41	atc	41	gcc	12	gaa	258
gca	257	gca	257	gaa	258	23s	73
23s	73	23s	73	23s	73	5s	30
5s	100	5s	69	5s	30	gac
acc	57	tca		gac
5s	31
gac
16s	261	16s	261
23s	73	23s	73
5s	319	5s	317
16s	80	16s	261
gaa	2	23s	73
aaa	32	5s	30
gca	14	gac
gta	257
23s	73
5s	30
gac

vpb remarques

• Remarques : 2 chromosomes circulaires. EFTU et beaucoup de doubles.
  1. @1 Blocs 16-23-5s, il y en a 3 dont 2 sont sur un opéron avec 1 aa. Le 4ème appartient à un opéron spécial.

       - Les 3 ont les mêmes Intercalaires, 73 261. L’intercalaire 23-5s se retrouve dans tout les autres opérons.

       - Les 2 blocs accolés sont séparés du reste par de grands intercalaires, 320 bases.

  2. @2 Les opérons 16-atc-gca sont au nombre de 2 avec 3 aas en plus.

       - 4 de leurs intercalaires, 73 257 41 56, sont identiques et le 5ème est du même ordre de grandeur, 100 69.

       - Un opéron est clasisque et a un aa en plus, le 2ème a la séquence 5s-aa-5s-aa donc 2 aa en +.

  3. @3 Les opérons analogues aux 16-atc-gca sont au nombre de 3 et ont 2 intercalaires en commun avec eux, 257 73 correspondant à aa-23s-5s.

       - Un opéron 16-gcc-gaa-23s-5s avec 2 aas entre les 2 rRNAs. Il a 4 aas.

       - Un opéron 16-gaa-23s-5s avec 1 aa entre les 2 rRNAs. Il a 3 aas.

       - Un opéron 16-gaa-3aas-23s-5s avec 4 aas entre les 2 rRNAs. Il a 6 aas.

  4. @4 Les opérons analogues aux 16-atc-gca avec une protéine sont au nombre de 3 et ont l’intercalaire 73 du 23s-5s comme tous les autres opérons.

     - Différence importante avec lam qui a des opérons analogues, la protéine est dans le brin complémentaire du brin des RNAs. Alors que dans lam protéine et RNAs sont sur le même brin.

     - La séquence est 16s-gaa-aaa-xxx-gta-protéine-23s-5s et les 3 opérons ont en commun les 4 mêmes intercalaires, 16s-80-aaa-2-xxx-gta-55-protéine-23s-73-5s.

     - Deux opérons, sans xxx, sont identiques en aas, intercalaires et protéines mais un a un aa en plus après 5s. Ils ont respectivement 3 et 4 aas.

     - Un opéron a une protéine plus petite, 180 aas au lieu de 198, avec xxx=gca entre les rRNAs plus 1 au-delà du 5s, soit 5 aas au total.

     - Note du 4.10.20: contrôle des cds au 10.2.20 du NCBI, 0 cds.

  5. @5 L’opéron 9cgt 2agc a une intercalaire élevée, 320 bases.
• Séquences des doubles : beaucoup de doubles et de séquences répétées comme cbn.

    - 8 opérons sur 14 à 2aas et plus sont remarquables :

	opéron			n*séquence
	cgg+4			2*2
	10 cta 5caa 4atg	3*4
	4 tac			4*1
	2 gtc			2*1
	9 cgt 2agc		8*1
	ttc+6			2*3
	ttc+4			2*2
	8 ggc 5atgf		5*2

vpb distribution

• Lien tableur: vpb distribution
• Notes:

  - gtc2 cta2+2 tac4 cgt8 ggc4

  - acc: 5s + >1aa

  - tca: 2 5s + 2 1aa

  - Séquences:

  (cac cca)2

  (cgt agc)2

  ttc (aca aac)2

  ttc (aca ttc aac)2

  cta (cta atgj cta caa)2 (cta caa)2 cta (cta atgj) caa (cta atgj)

  (atgf ggc)2 ggc3 (atgf ggc)3

Gm2 vpb, Vibrio parahaemolyticus BB22OP. gama

g1		t1
a atgi	1	a tct		tat		atgf	6
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	4	b tcc	1	tac	5	tgc	4
f atc	2	j acc	2	aac	5	agc	2
g ctc	2	f ccc		cac	2	cgt	9
h gtc	2	n gcc	1	gac	6	ggc	11
i tta	3	c tca	4	taa		tga
j ata		k aca	5	aaa	4	aga	1
k cta	10	g cca	3	caa	5	cga
l gta	4	o gca	4	gaa	6	gga	2
m ttg	1	d tcg		tag		tgg	3
n atgj	4	l acg		aag		agg	1
o ctg		h ccg		cag		cgg	1
p gtg		p gcg		gag		ggg
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
vpb	82	11		12		21	126

vpb1. Intergen51

Intergen51. vpb1. Le génome

• vpb1 Le prélèvement: gama
• Le nom et le lien NCBI: vpb1, Vibrio parahaemolyticus BB22OP chromosome 1, NCBI [8], date 20.02.22.
• vpb1 La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
vpb1	403,530		3,297,305	12.2	

vpb1 données intercalaires

• Lien tableur: vpb1 données intercalaires
• Lien sauvegarde NCBI:gama

vpb1 données intercalaires 200

• Lien tableur: données intercalaires 200.

vpb1 autres intercalaires aas

• Lien tableur: vpb1 autres intercalaires aas
• Lien sauvegarde NCBI:gama

Intergen51. vpb1. Les différents types d'intercalaires

• Lien au tableur: Intergen51. vpb1 les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 vpb1 les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 1,748 344 9 2,101 2.6 113 8 121 x 781 13 1 795 0 3 3 t 2,529 357 10 2,896 113 11 124 % 87.3 12.3 0.3

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 27 0 0 27 1.4 tRNA-CDS 47 23 x 20 0 0 20 RNA-RNA 113 56 t 47 0 0 47 CDS-rRNA 11 5 % 100.0 0.0 0.0 non RNA 32 16 - total 203 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 5.3 14.8 0.0 31.6 11.1 58 0.4 0.0 x 11.5 30.0 7.7 4.2 0.0 15 0.1 0.0

Intergen51. vpb1. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  vpb1 présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	vpb1
R2	x3		x2		x		c		Inflexion poly3	x	c
0.539	5.80E-06	-3.66E-03	5.44E-01	16.10	fx1	abscisse	574.0	218.4
0.786	-6.92E-06	5.11E-03	-1.23E+00	110.0	fc1	ordonnée	24.1	16.6
								
0.749	-6.04E-07	1.04E-03	-5.00E-01	82.7	fx41			
0.944	2,00E-06	-1,31E-03	1,48E-01	26.0	fc51			

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	vpb1		calculs			poly3	vpb1
effect	1757		R2.21	767		abscis	400
xm	41		pte	9,71		flexa	203
ym	5		cste	3,24		flexo	1,78
x1m	231		r400l	169		xm	43
y1m	1		restp	159,36		sup4	178,5
rfin	52,93		%sd	32,70		sup4t	437,1
bornf	185		lond	190		%	40,8
supd	156,1		%sf	32,39		long	160
supdt	477,5		lonf	144			
xmp	363,12		sf/lf	0,92			
r400	106,43		sr/lr	0,52			
supf	132,4		sd/ld	0,82			
supft	408,7		i.r400	0,63										

Intergen51. vpb1. Les CDS-CDS négatifs

Sous-totaux	vpb1			totale	
fréquence	x-	c-		x-	c-
 - 1		0	83		4	4140
 - 2		0	0		85	11
 - 3		0	0		3	12
 - 4		2	115		717	10938
 - 5		0	0		5	19
sp6		11	146		1642	8424
total		13	344		2,456	23,544
reste		1	0		264	420
s6		3	0		361	41
s7		1	21		321	1438
s8		6	125		696	6525
rappot s1-5						
4/2/1		-	1.4		8.4	2.6
% / sp6						
s6/sp6		27.3	0.0		22.0	0.5
s7/sp6		9.1	14.4		19.5	17.1
s8/sp6		54.5	85.6		42.4	77.5
reste/sp6	9.1	0.0		16.1	5.0
						
total s1-5	2	198		814	15120
% / total						
%s1-5		15.4	57.6		33.1	64.2
%sp6		84.6	42.4		66.9	35.8

Intergen51. vpb1. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		10			CDS 16s		6	2
16s 23s		3			5s CDS			1
16s tRNA	7			16 CDS			
tRNA 23s	7			CDS 5s			
5s tRNA		8			23s CDS			
tRNA in		10			CDS 23s			
tRNA contig	3			5s 16s		2	
tRNA hors	64			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		113	0		total		8	3

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. vpb1. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. vpb1. Les intercalaires tRNA-tRNA extra bloc

contig	aa
35	gac
**	tgg
68	tgg
**	gac
68	tgg
**	gac

Int51.31 vpb1. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa		inter	aa
32	cgg		81	tac		31	cgt		56	atgf
72	cac		81	tac		**	agc		18	ggc
49	cac		81	tac		64	ttc		35	atgf
24	cac		**	tac		7	aca		50	ggc
**	cac		32	gtc		70	ttc		49	ggc
29	cta		**	gtc		71	aac		49	ggc
47	cta		10	ggc		7	aca		30	ggc
24	atgj		76	tta		43	ttc		55	atgf
52	cta		20	ggc		**	aac		30	ggc
29	caa		**	tgc		51	ttc		39	atgf
53	cta		56	atgf		21	aca		19	ggc
24	atgj		**	ctc		39	aac		35	atgf
52	cta		56	cgt		15	aca		**	ggc
29	caa		57	cgt		**	aac		13	acc
54	cta		57	cgt					35	gga
29	caa		57	cgt					36	tac
35	cta		57	cgt					**	aca
48	caa		56	cgt
31	cta		210	cgt
77	cta		31	cgt
77	atgj		**	agc
31	caa
40	cta
**	atgj

vpb2. Intergen51

Intergen51. vpb2. Le génome

• vpb2 Le prélèvement: gama
• Le nom et le lien NCBI: vpb2, Vibrio parahaemolyticus BB22OP chromosome 2, NCBI [9], date 20.02.22.
• vpb2 La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
vpb2	242,529		1,806,219	13.4		

vpb2 données intercalaires

• Lien tableur: vpb2 données intercalaires
• Lien sauvegarde NCBI:gama

vpb2 données intercalaires 200

• Lien tableur: données intercalaires 200.

vpb2 autres intercalaires aas

• Lien tableur: vpb2 autres intercalaires aas
• Lien sauvegarde NCBI:gama

Intergen51. vpb2. Les différents types d'intercalaires

• Lien au tableur: Intergen51. vpb2 les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 vpb2 les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 817 171 11 999 1.7 10 1 11 x 560 14 1 575 0 0 0 t 1,377 185 12 1,574 10 1 11 % 87.5 11.8 0.8

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 5 0 0 5 0.6 tRNA-CDS 13 41 x 8 0 0 8 RNA-RNA 10 31 t 13 0 0 13 CDS-rRNA 1 3 % 100.0 0.0 0.0 non RNA 8 25 - total 32 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 7.6 20.0 0.0 28.1 0.0 60 1.1 0.0 x 12.7 50.0 7.1 5.0 12.5 36 0.2 0.0

Intergen51. vpb2. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  vpb2 présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	vpb2
R2	x3		x2		x		c		Inflexion poly3	x	c
0.570	5.31E-06	-3.50E-03	5.58E-01	12.10	fx1	abscisse	161.6	185.7
0.735	-6.33E-06	4.65E-03	-1.11E+00	99.2	fc1	ordonnée	29.8	19.8
								
0.672	1.64E-06	-7.95E-04	-4.75E-02	51.3	fx41			
0.764	7.96E-07	-4.44E-04	-2.56E-02	34.7	fc41			

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	vpb2		calculs			poly3	vpb2
effect	828		R2.21	593		abscis	400
xm	45		pte	6,77		flexa	127
ym	2		cste	2,72		flexo	2,54
x1m	254		r400l	146		xm	45
y1m	1		restp	176,33		sup4	77,5
rfin	76,09		%sd	42,21		sup4t	246,4
bornf	192		lond	209		%	31,5
supd	205,9		%sf	42,57		long	82
supdt	487,9		lonf	147			
xmp	335,75		sf/lf	1,15			
r400	100,24		sr/lr	0,60			
supf	168,6		sd/ld	0,99			
supft	396,1		i.r400	0,69							

Intergen51. vpb2. Les CDS-CDS négatifs

Sous-totaux	vpb2			totale	
fréquence	x-	c-		x-	c-
 - 1		0	50		4	4140
 - 2		1	0		85	11
 - 3		0	0		3	12
 - 4		4	53		717	10938
 - 5		0	0		5	19
sp6		9	68		1642	8424
total		14	171		2,456	23,544
reste		1	0		264	420
s6		3	0		361	41
s7		0	6		321	1438
s8		5	62		696	6525
rappot s1-5						
4/2/1		4	1.1		8.4	2.6
% / sp6						
s6/sp6		33.3	0.0		22.0	0.5
s7/sp6		0.0	8.8		19.5	17.1
s8/sp6		55.6	91.2		42.4	77.5
reste/sp6	11.1	0.0		16.1	5.0
						
total s1-5	5	103		814	15120
% / total						
%s1-5		35.7	60.2		33.1	64.2
%sp6		64.3	39.8		66.9	35.8

Intergen51. vpb2. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		1			CDS 16s		1	
16s 23s					5s CDS			
16s tRNA	1			16 CDS			
tRNA 23s	1			CDS 5s			
5s tRNA		1			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig				5s 16s			
tRNA hors	3			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s								
16s 5s								
5s 23s								
5s 5s								
total		10	0		total		1	0

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. vpb2. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. vpb2. Les intercalaires tRNA-tRNA extra bloc

hors b	aa
73	tgc
**	tta
73	tgc
**	tta
3	ggc
**	tgc

Escherichia albertii

eal opérons

• Liens: gtRNAdb [10], NCBI [11], génome [orgn]
• Lien tableur: eal opérons

eal1. Escherichia albertii

49.6%GC	10.3.19 Paris	89	doubles	interca
	219063..219144	tac	+	212
	219357..219438	tac	2 tac
	413135..413219	tcc
	462888..462972	tca
comp	489120..489191	gga		6
comp	489198..489270	aca
	615149..615233	tcc
comp	756823..756895	aaa	+	5
comp	756901..756973	gta	3 aaa	48
comp	757022..757094	aaa	2 gta	5
comp	757100..757172	gta		48
comp	757221..757293	aaa
	834529..834602	atgj	+	10
	834613..834694	cta	2atgj	26
	834721..834792	caa	2caa	37
	834830..834901	caa	2 cag	18
	834920..834993	atgj		51
	835045..835116	cag		35
	835152..835223	cag
comp	968958..969031	aga
comp	1192416..1192488	acg
comp	1269526..1269599	gac
comp	1277040..1277113	gac		52
comp	1277166..1277285	5s	@1	169
comp	1277455..1280377	23s		186
comp	1280564..1280636	gca		45
comp	1280682..1280755	atc		70
comp	1280826..1282367	16s
	1567231..1567314	ctg	+	31
	1567346..1567429	ctg	3 ctg	35
	1567465..1567548	ctg
comp	1657309..1657390	ttg
comp	1765401..1765473	ggc	+	159
comp	1765633..1765705	ggc	2 ggc
	1795516..1795588	ttc
comp	2006002..2006121	5s		169
comp	2006291..2009214	23s		186
comp	2009401..2009473	gca		45
comp	2009519..2009592	atc		70
comp	2009663..2011202	16s
comp	2042057..2043241	tuf1	CDS 1185pb	117
comp	2043359..2043431	acc		9
comp	2043441..2043512	gga		119
comp	2043632..2043713	tac		11
comp	2043725..2043797	aca	@3
comp	2047429..2047548	5s		169
comp	2047718..2050648	23s		186
comp	2050835..2050907	gca		45
comp	2050953..2051026	atc		68
comp	2051095..2052636	16s
comp	2208305..2208424	5s	@2	169
comp	2208594..2211517	23s		198
comp	2211716..2211788	gaa		85
comp	2211874..2213418	16s
comp	2267554..2267627	cca		43
comp	2267671..2267754	ctg		23
comp	2267778..2267850	cac		61
comp	2267912..2267985	cgg
comp	2305358..2305430	tgg		11
comp	2305442..2305515	gac		52
comp	2305568..2305687	5s		169
comp	2305857..2308779	23s		198
comp	2308978..2309050	gaa		85
comp	2309136..2310676	16s
comp	2426158..2426248	tga
	2556305..2556378	ccg
	2810766..2812307	16s		85
	2812393..2812465	gaa		198
	2812664..2815586	23s		169
	2815756..2815875	5s		151
	2816027..2816099	acc		40
	2816140..2816259	5s
	2911129..2911212	ctc
	2913088..2913161	atgf
comp	3010332..3010404	atgi
comp	3177717..3177789	ttc
	3301617..3301687	ggg
comp	3366868..3366941	atgf	+	37
comp	3366979..3367052	atgf	3 atgf	37
comp	3367090..3367163	atgf
	3469914..3470003	agc		6
	3470010..3470083	cgt	+	201
	3470285..3470358	cgt	3 cgt	200
	3470559..3470632	cgt
	3505321..3505393	atgi
	3563056..3564598	16s		85
	3564684..3564756	gaa		198
	3564955..3567876	23s		169
	3568046..3568165	5s
comp	3779750..3779822	aaa		7
comp	3779830..3779902	gta	+	47
comp	3779950..3780022	gta	2 gta
	3782718..3782790	gcc	+	42
	3782833..3782905	gcc	2 gcc
comp	3810369..3810440	agg
comp	3993500..3993573	ccc
comp	4232176..4232248	aac
	4233996..4234068	aac
comp	4242952..4243024	aac
comp	4248342..4248414	aac
	4249406..4249492	tcg
	4256696..4256768	atgi		100
	4256869..4256942	aga
	4317980..4318052	ggc		56
	4318109..4318179	tgc		14
	4318194..4318277	tta
comp	4556753..4556826	gtc	+	7
comp	4556834..4556907	gtc	2 gtc

eal cumuls

• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.eal. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

eal cumuls	opérons		effectif
avec rRNA	opérons		7
		16 23 5s 0	0
		16 atc gca	3
		16 23 5s a	0
		max a		3
		a doubles	0
		spéciaux	4
		total aas	13
sans 		opérons		38
		1 aa		23
		max a		7
		a doubles	10
		total aas	71
total aas			84
remarques			3

eal blocs

• Lien tableur: eal blocs

eal1. Escherichia albertii, blocs à rRNA.

16s	70	70	68
atc	45	45	45
gca	186	186	186
23s	169	169	169
5s	52
gac
16s	85	85	85
gaa	198	198	198
23s	169	169	169
5s	52
gac
16s	85
gaa	198
23s	169
5s	151
acc	40
5s

eal remarques

• Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles.

1. @1 Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.

   - Les intercalaires sont les mêmes pour les 3 opérons, 70 45 186 169.

   - Un seul opéron a un aa en plus.

2. @2 4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s.

   - Les intercalaires sont les mêmes pour les 4 opérons, 85 198 169.

   - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.

   - Les aas suplémentaires sont absents pour 2 opérons et sont 2 pour un autre.

   - Le 4ème opéron a 1 aa et 1 5s en supplément.

3. @3 2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB

• Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.

  - 5 opérons à 2 aas répétés

  - 3 opérons à 3 aas répétés

  - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.

  - Un opéron à 5 aas a une séquence répétée, aaa + 2*2.

  - 5 opérons sans répétitions

		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca

• Notes :

eal distribution

• Lien tableur: eal distribution
• Notes:

  - gtc2 gta2 ctg3 gcc2 tac2 caa2 cag2 atgf3 cgt3 ggc2

  - atgi: 2 1aa + 1 >1aa

  - gac: 1aa + 2 5s

  - Séquences:

  aaa (gta aaa)2

Gm3 eal, Escherichia albertii. gama

g1		t1
a atgi	3	a tct		tat		atgf	4
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	2	b tcc	2	tac	3	tgc	1
f atc	3	j acc	2	aac	4	agc	1
g ctc	1	f ccc	1	cac	1	cgt	3
h gtc	2	n gcc	2	gac	3	ggc	3
i tta	1	c tca	1	taa		tga	1
j ata		k aca	2	aaa	4	aga	2
k cta	1	g cca	1	caa	2	cga
l gta	4	o gca	3	gaa	4	gga	2
m ttg	1	d tcg	1	tag		tgg	1
n atgj	2	l acg	1	aag		agg	1
o ctg	4	h ccg	1	cag	2	cgg	1
p gtg		p gcg		gag		ggg	1
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
eal	48	23		4		10	85

eal intergen51

Intergen51. eal. Le génome

• eal Le prélèvement: gama
• Le nom et le lien NCBI: eal, Escherichia albertii KF1, NCBI [12], date 28.2.14.
• eal La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
eal	594,081		4,701,875	12.6

eal données intercalaires

• Lien tableur: eal données intercalaires
• Lien sauvegarde NCBI: gama

eal données intercalaires 200

• Lien tableur: données intercalaires 200.

eal autres intercalaires aas

• Lien tableur: eal autres intercalaires aas
• Lien sauvegarde NCBI: gama

Intergen51. eal. Les différents types d'intercalaires

• Lien au tableur: Intergen51. eal les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 eal les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 2,268 617 18 2,903 2.2 62 5 67 x 1,173 119 12 1,304 0 7 7 t 3,441 736 30 4,207 62 12 74 % 81.8 17.5 0.7

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 42 0 0 42 1.2 tRNA-CDS 77 14 x 35 0 0 35 RNA-RNA 62 12 t 77 0 0 77 CDS-rRNA 12 2 % 100.0 0.0 0.0 non RNA 386 72 - total 537 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 6.0 11.9 0.6 31.2 2.4 66 0.6 0.0 x 10.3 8.6 5.9 8.4 2.9 36 0.9 0.0

Intergen51. eal. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  eal présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	eal
R2	x3		x2		x		c		Inflexion poly3	x	c
0.697	2.04E-06	-1.21E-03	9.15E-02	36.00	fx1	abscisse	348.9	349.1
0.837	-6.99E-06	5.31E-03	-1.31E+00	115.0	fc1	ordonnée	9.0	4.6
								
0.791	-8.80E-07	9.21E-04	-3.75E-01	65.1	fx41			
0.966	-9.74E-07	1.02E-03	-4.00E-01	61.4	fc41			

• Moyennes glissantes des fc+400, diagonale. Voir le détail des calculs dans abs.

données	eal		calculs			poly3	eal
effect	2286		R2.21	798		abscis	200
xm	43		pte	15,96		flexa	112
ym	9		cste	4,62		flexo	2,84
x1m	227		r400l	173		xm	35
y1m	1		restp	176,73		sup4	77,2
rfin	60,37		%sd	16,97		sup4t	283,0
bornf	138		lond	184		%	27,3
supd	76,8		%sf	10,41		long	77
supdt	452,3		lonf	95			
xmp	370,95		sf/lf	0,30			
r400	116,36		sr/lr	0,55			
supf	28,2		sd/ld	0,42			
supft	270,8		i.r400	0,67															

Intergen51. eal. Les CDS-CDS négatifs

Sous-totaux	eal			totale	
fréquence	x-	c-		x-	c-
 - 1		0	157		4	4140
 - 2		4	0		85	11
 - 3		0	0		3	12
 - 4		39	250		717	10938
 - 5		0	0		5	19
sp6		76	210		1642	8424
total		119	617		2,456	23,544
reste		7	4		264	420
s6		23	0		361	41
s7		16	42		321	1438
s8		30	164		696	6525
rappot s1-5						
4/2/1		9.75	1.6		8.4	2.6
% / sp6						
s6/sp6		30.3	0.0		22.0	0.5
s7/sp6		21.1	20.0		19.5	17.1
s8/sp6		39.5	78.1		42.4	77.5
reste/sp6	9.2	1.9		16.1	5.0
						
total s1-5	43	407		814	15120
% / total						
%s1-5		36.1	66.0		33.1	64.2
%sp6		63.9	34.0		66.9	35.8

Intergen51. eal. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		7			CDS 16s		3	4
16s 23s					5s CDS		2	3
16s tRNA	7			16 CDS			
tRNA 23s	7			CDS 5s			
5s tRNA		3			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig	1			5s 16s			
tRNA hors	33			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		62	0		total		5	7

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. eal. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. eal. Les intercalaires tRNA-tRNA extra bloc

Int51.31 eal. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa
212	tac		31	ctg		6	agc
**	tac		35	ctg		201	cgt
6	gga		**	ctg		200	cgt
**	aca		159	ggc		**	cgt
5	aaa		**	ggc		7	aaa
48	gta		9	acc		47	gta
5	aaa		119	gga		**	gta
48	gta		11	tac		42	gcc
**	aaa		**	aca		**	gcc
10	atgj		43	cca		100	atgi
26	cta		23	ctc		**	aga
37	caa		61	cac		56	ggc
18	caa		**	cgg		14	tgc
51	atgj		37	atgf		**	tta
35	cag		37	atgf		7	gtc
**	cag		**	atgf		**	gtc

Escherichia coli

eco opérons

• Liens: gtRNAdb [13], NCBI [14], génome [orgn]
• Lien tableur: eco opérons

eco1. Escherichia coli str. K-12 substr. MG1655

50.6%GC	10.3.19 Paris	89	doubles	interca	EcoCyc	adIP
	223771..225312	16s		68	opéron
	225381..225457	atc		42	ileV	[15]
	225500..225575	gca		183	«
	225759..228662	23s		93	«
	228756..228875	5s	@1	52	«
	228928..229004	gac			aspU	[16]
	236931..237007	gac
	262871..262946	acg
	564723..564799	aga
comp	696430..696504	cag	+	37	opéron
comp	696542..696616	cag	2 cag	47	glnT	[17]
comp	696664..696740	atg	2 atg	15	«
comp	696756..696830	caa	2 caa	34	«
comp	696865..696939	caa		23	«
comp	696963..697047	cta		9	«
comp	697057..697133	atg
	780554..780629	aaa	+	135	lysT	[18]
	780765..780840	gta	5 aaa	2	opéron
	780843..780918	aaa	2 gta	149	«
	781068..781143	gta		3	valZ	[19]
	781147..781222	aaa		146	opéron
	781369..781444	aaa		132	lysZ	[20]
	781577..781652	aaa			lysQ	[21]
					EcoCyc	[22]
comp	925884..925971	tcc			InfA-serW	[23]
comp	1031625..1031712	tca
comp	1097565..1097652	tcc
comp	1287087..1287176	tpr	cds 90pb	67	tpr
comp	1287244..1287328	tac	+	209	opéron
comp	1287538..1287622	tac	2 tac		tyrT	[24]
	1746435..1746511	gtc	+	4	valV	[25]
	1746516..1746592	gtc	2 gtc		opéron
					«RNA 67pb
comp	1991815..1991901	tta		12	leuZ	[26]
comp	1991914..1991987	tgc		54	«
comp	1992042..1992117	ggc			opéron
comp	2043468..2043557	tcg
	2044549..2044624	aac
comp	2058027..2058102	aac
	2059851..2059926	aac
	2062260..2062335	aac
	2286211..2286287	ccc
	2466309..2466383	agg
comp	2518041..2518116	gcc	+	39	alaX	[27]
comp	2518156..2518231	gcc	2 gcc		opéron
	2520931..2521006	gta	+	44	valU	[28]
	2521051..2521126	gta	3gta	46	opéron
	2521173..2521248	gta		4	«
	2521253..2521328	aaa			«
comp	2726069..2726188	5s	@2	92	opéron
comp	2726281..2729184	23s		184
comp	2729369..2729444	gaa		171
comp	2729616..2731157	16s
comp	2785762..2785837	atgi
comp	2817784..2817860	cgt	+	198	«
comp	2818059..2818135	cgt	4 cgt	62	«
comp	2818198..2818274	cgt		198	«
comp	2818473..2818549	cgt		3	opéron
comp	2818553..2818645	agc			serV	[29]
	2947387..2947463	atgf	+	33	opéron
	2947497..2947573	atgf	3 atgf	33	metW	[30]
	2947607..2947683	atgf			«
comp	2998984..2999057	ggg
	3110366..3110441	ttc
	3215598..3215673	atgi
comp	3318213..3318289	atgf
comp	3322072..3322158	ctc
comp	3423423..3423542	5s		37	«
comp	3423580..3423655	acc		12	«
comp	3423668..3423787	5s		92	«
comp	3423880..3426783	23s		174	«
comp	3426958..3427033	gca		42	«
comp	3427076..3427152	atc		68	ileU	[31]
comp	3427221..3428762	16s			opéron
comp	3708616..3708692	ccg
	3836222..3836316	tga
					ecoliwiki	[32]
	3941808..3943349	16s		85	gltU	[33]
	3943435..3943510	gaa		193	opéron
	3943704..3946607	23s		92	«
	3946700..3946819	5s		52	«
	3946872..3946948	gac		8	aspT	[34]
	3946957..3947032	tgg			trpT	[35]
	3982375..3982451	cgg		57	argX	[36]
	3982509..3982585	cac		20	opéron
	3982606..3982692	ctg		42	«
	3982735..3982811	cca			«
	4035531..4037072	16s		68	opéron
	4037141..4037217	atc		42	ileT	[37]
	4037260..4037335	gca		183	«
	4037519..4040423	23s		93	«
	4040517..4040636	5s			«
	4166659..4168200	16s		171	opéron
	4168372..4168447	gaa		193
	4168641..4171544	23s		92
	4171637..4171756	5s
	4175388..4175463	aca	@3	8	thrU	[38]
	4175472..4175556	tac		116	opéron
	4175673..4175747	gga		6	«
	4175754..4175829	acc		114	«
	4175944..4177128	tufb	cds 1185 pb		«
	4208147..4209688	16s		85	opéron
	4209774..4209849	gaa		193
	4210043..4212946	23s		93
	4213040..4213159	5s
comp	4362551..4362626	ttc
	4392360..4392435	ggc	+	36	opéron
	4392472..4392547	ggc	3 ggc	35	glyX	[39]
	4392583..4392658	ggc			«
	4496405..4496489	ttg
comp	4606079..4606165	ctg	+	34	opéron
comp	4606200..4606286	ctg	3 ctg	28	leuV	[40]
comp	4606315..4606401	ctg			«

eco cds

• Liens: gtRNAdb [41], NCBI [42], génome [orgn]
• Lien tableur: eco cds
• Légende

  - protéines1: metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp

  - protéine2: secG

  - évidence faible1, avec un pseudo.

eco2. les CDS eco pour opérons

cluster	6.8.19 Paris			interca	cdsa	promoteur	terminateur	notes
	222833..223408		cds	362	192	sigma FIS
	223771..225312		16s	68
	225381..225457		atc	42
	225500..225575		gca	183
	225759..228662		23s	93
	228756..228875		5s	52
	228928..229004		gac	162		Terminateur	+ sigma
	229167..229970		cds		268
comp	2724448..2725746		cds	322	433	rien	début opéron	rien
comp	2726069..2726188		5s	92
comp	2726281..2729184		23s	184
comp	2729369..2729444		gaa	171
comp	2729616..2731157		16s	442		sigma FIS
comp	2731600..2734173		cds		858
	3422436..3423194		cds	228	253	Terminateur	fin opéron	rien
comp	3423423..3423542		5s	37
comp	3423580..3423655		acc	12
comp	3423668..3423787		5s	92
comp	3423880..3426783		23s	174
comp	3426958..3427033		gca	42
comp	3427076..3427152		atc	68
comp	3427221..3428762		16s	473		sigma FIS
	3429236..3429790		cds		185
comp	3940635..3941327		cds	480	231	sigma FIS
	3941808..3943349		16s	85
	3943435..3943510		gaa	193
	3943704..3946607		23s	92
	3946700..3946819		5s	52
	3946872..3946948		gac	8
	3946957..3947032		tgg	95		Terminateur	fin opéron	rien
comp	3947128..3947967		cds		280
	4034608..4035153		cds	377	182	Sigma Lrp-leu
	4035531..4037072		16s	68
	4037141..4037217		atc	42
	4037260..4037335		gca	183
	4037519..4040423		23s	93
	4040517..4040636		5s	228
	4040865..4040900		rprg	5		pas de Term	fin opéron	rien
comp	4040906..4041433		cds		176
	4165428..4166285		cds	373	286	Sigma Lrp-leu
	4166659..4168200		16s	171
	4168372..4168447		gaa	193
	4168641..4171544		23s	92
	4171637..4171756		5s	300		Terminateur	début opéron	rien
	4172057..4173085		cds		343
comp	4205943..4207532		cds	614	530	sigma FIS
	4208147..4209688		16s	85
	4209774..4209849		gaa	193
	4210043..4212946		23s	93
	4213040..4213159		5s	74		Terminateur	début opéron	rien
	4213234..4213617		cds		128
	695101..696276		cds	31	392
comp	696308..696378		rprg	51		Terminateur	fin opéron	rien
comp	696430..696504		cag	37
comp	696542..696616		cag	47
comp	696664..696740		atg	15
comp	696756..696830		caa	34
comp	696865..696939		caa	23
comp	696963..697047		cta	9
comp	697057..697133		atg	379		sigma FIS	fin opéron	rien
comp	697513..699177		cds		555
	779598..780389		cds	164	264	sigma FIS	fin opéron	rien
	780554..780629		aaa	135
	780765..780840		gta	2
	780843..780918		aaa	149
	781068..781143		gta	3
	781147..781222		aaa	146
	781369..781444		aaa	132
	781577..781652		aaa	432		Terminateur	début opéron	NadR pas sigma
	782085..783128		cds		348
	1286709..1286984		cds	81	92	Terminateur
comp	1287066..1287236		ncRNA	-150
comp	1287087..1287176		tpr	67	30
comp	1287244..1287328		tac	209
comp	1287538..1287622		tac	159		sigma FIS
comp	1287782..1288624		cds		281
solitaire				promoteur	terminateur	interc avant	interc après	protéines	lien
	236931..237007		gac	sigma FIS	Term 1	133	328		[43]
	262871..262946		acg	sigma FIS	rien	115	204		[44]
	564723..564799		aga	sigma FIS	rien	243	16		[45]
comp	925884..925971		InfA-tcc	sigma FIS	Term 1	344	254		[46]
comp	1031625..1031712		tca	sigma FIS	Term 2	207	427		[47]
comp	1097565..1097652		tcc	sigma FIS	Term 4	736	234		[48]
comp	2043468..2043557		tcg	sigma -	Term 1	570	94		[49]
	2044549..2044624		aac	sigma -	Term 1	101	314		[50]
comp	2058027..2058102		aac	sigma -	Term 1	453	101		[51]
	2059851..2059926		aac	sigma -	Term 1	5	38		[52]
	2062260..2062335		aac	sigma NtrC	rien	327	56		[53]
	2286211..2286287		ccc	sigma FIS	Term 1	75	103		[54]
	2466309..2466383		agg	sigma -	Term 1	76	162		[55]
comp	2785762..2785837		atgi	rien	rien	410	-37	évidence faible1	[56]
comp	2998984..2999057		ggg	sigma FIS	rien	156	79	évidence faible	[57]
	3110366..3110441		ttc	sigma FIS	Term 1	106	149		[58]
	3215598..3215673		atgi	sigma -	Term 1	125	54		[59]
comp	3318213..3318289		atgf	sigma FIS	Term 2	207	348	protéines1	[60]
comp	3322072..3322158		ctc	sigma -	Term 1	459	15	protéine2	[61]
comp	3708616..3708692		ccg	sigma FIS	Term 2	911	92		[62]
	3836222..3836316		tga	sigma -	rien	293	109		[63]
comp	4362551..4362626		ttc	sigma FIS	Term 1	198	107		[64]
	4496405..4496489		ttg	sigma FIS	Term 1	196	261		[65]

eco cumuls

• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.eco. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

eco cumuls	opérons		effectif
avec rRNA	opérons		7
		16 23 5s 0	0
		16 atc gca	3
		16 23 5s a	0
		max a		3
		a doubles	0
		spéciaux	4
		total aas	14
sans 		opérons		36
		1 aa		23
		max a		7
		a doubles	10
		total aas	72
total aas			86
remarques			3

eco blocs

• Lien tableur: eco blocs

eco1. Escherichia coli, blocs à rRNA.

16s	68	16s	68	68
atc	42	atc	42	42
gca	174	gca	183	183
23s	92	23s	93	93
5s	12	5s	52
acc	37	gac
5s
16s	85	171	171	85
gaa	193	184	193	193
23s	92	92	92	93
5s	52
gac

eco remarques

• Remarques : Pas de blocs 16-23-5s, un nouveau bloc 16-gaa-23-5s, beaucoup de doubles. Comme eal.
  1. @1  Les blocs 16-atc gca-23-5s sont au nombre de 3 avec 1 seul aa en plus.

     - Les intercalaires sont les mêmes pour les 3 opérons, 68 42 183 93.

     - Cependant les 3 1ers intercalaires diminuent de 3 bases chacun et le 4ème est divisé par 2.

     - Par rapport à eal un opéron sans aa de plus, s'est transformé avec 1 aa et 1 5s en plus. Son intercalaire gca-23s a diminué de 5 % par rapport aux 2 autres, 9/183.

  2. @2  4 nouveaux blocs analogues aux précédents, 16-gaa-23-5s, comme eal.

     - Les intercalaires sont les mêmes pour 2 opérons sans aa supplémentaire, 171 193 92.

     - Pour les 2 autres opérons le 1er intrcalaire est divisé par 2, 85 193 92.

     - Elles sont, dans le même ordre, analogue à celles des blocs 16-atc gca-23-5s.

     - Par rapport à eal, l'opéron avec 1 aa et 1 5s a perdu ces suppléments. Et l’on a 3 opérons sans et 1 opéron avec 2 aas en supplément.

  3. @3  2 opérons tRNAs+protéine : tactac-tpr et acatacggaacc-tufB
• Séquences des doubles : beaucoup de doubles mais peu de séquences répétées.

  - Il y a 4 remaniements qui consistent tous en une ou 2 répétions de plus des répétitions déjà existantes

  - 2 opérons sans rRNAs et sans doubles ont été perdus de eal à eco.

  - Pour eco il y a toujours 10 opérons avec répétition et 3 sans répétitions:

  - 3 opérons à 2 aas répétés

  - 4 opérons à 3 aas répétés

  - 1 opéron à 4 aas répétés.

  - L'opéron au maximum de 7 aas a 2 répétitions de 2 aas en séquence et la 3ème a ses 2 aas séparés : atg cta 2caa atg 2cag.

  - Un opéron à 7 aas a une séquence répétée, 3aaa + 2*2.

		
		eco			eal
		Opérons sans rRNAs avec doubles		
		2tac			2tac
		2gtc			2gtc
		2gcc			2gcc
		3ctg			3ctg
		3atgf			3atgf
		atg cta 2caa atg 2cag	atg cta 2caa atg 2cag
		Remaniements des répétitions		
		3ggc			2ggc
		aaa 3gta		aaa 2gta
		agc 4cgt		agc 3cgt
		5aaa 2gta		3aaa 2gta
		Opérons sans rRNAs sans doubles		
		tta tgc ggc		tta tgc ggc
		cgg cac ctg cca		cgg cac ctg cca
		aca tac gga acc		aca tac gga acc
		Disparition de 2 opérons chez eco		
		-			atgi aga
		-			gga aca

• Notes :

eco distribution

• Lien tableur: eco distribution
• Notes:

  - gtc2 gta3 ctg3 gcc2 tac2 aaa3 caa2 cag2 atgf3 cgt4 ggc3

  - gac: 1aa + 2 5s

  - Séquences:

  (aaa gta)2 aaa3

Gm4 eco, Escherichia coli str. K-12 substr. MG1655. gama

g1		t1
a atgi	2	a tct		tat		atgf	4
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	2	b tcc	2	tac	3	tgc	1
f atc	3	j acc	2	aac	4	agc	1
g ctc	1	f ccc	1	cac	1	cgt	4
h gtc	2	n gcc	2	gac	3	ggc	4
i tta	1	c tca	1	taa		tga	1
j ata		k aca	1	aaa	6	aga	1
k cta	1	g cca	1	caa	2	cga
l gta	5	o gca	3	gaa	4	gga	1
m ttg	1	d tcg	1	tag		tgg	1
n atgj	2	l acg	1	aag		agg	1
o ctg	4	h ccg	1	cag	2	cgg	1
p gtg		p gcg		gag		ggg	1
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
eco	49	23		4		10	86

eco intergen51

Intergen51. eco. Le génome

• eco Le prélèvement: alpha gama
• Le nom et le lien NCBI: eco, Escherichia coli str. K-12 substr. MG1655, NCBI [66], date 7.3.22.
• spl La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

 		
Nom	intercals	génome		taux en %			
eco	501 283		4 641 652	10.8

eco données intercalaires

• Lien tableur: eco données intercalaires
• Lien sauvegarde NCBI:alpha gama

eco données intercalaires 200

• Lien tableur: données intercalaires 200.

eco autres intercalaires aas

• Lien tableur: eco autres intercalaires aas
• Lien sauvegarde NCBI:alpha gama

Intergen51. eco. Les différents types d'intercalaires

• Lien au tableur: Intergen51. eco les différents types d'intercalaires.

Int51.2 eco les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 2 188 647 16 2 851 2,4 65 6 71 x 1 061 95 13 1 169 0 6 6 t 3 249 742 29 4 020 65 12 77 % 80,8 18,5 0,7

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 37 0 0 37 1,3 tRNA-CDS 65 9 x 28 0 0 28 RNA-RNA 65 9 t 65 0 0 65 CDS-rRNA 12 2 % 100,0 0,0 0,0 non RNA 570 80 - total 712 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 2,9 10,8 13,7 33,8 2,7 47 0,6 0,0 x 5,3 14,3 3,9 5,9 3,6 65 1,1 0,0

Intergen51. eco. Les diagrammes CDS-CDS positifs

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	eco
R2	x3		x2		x		c		Inflexion poly3	x	c
0,538	2,01E-06	-1,39E-03	1,81E-01	29,40	fx1	abscisse	257,1	366,3	
0,802	-7,30E-06	5,57E-03	1,38E+00	121,0	fc1	ordonnée	19,9	3,8
								
0,706	-1,40E-06	1,08E-03	-3,51E-01	62,5	fx41			
0.964	-1,05E-06	1,16E-03	-4,61E-01	69.1	fc51		

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	eco		calculs			poly3	eco
effect	2204		R2.21	800		abscis	250
xm	46		pte	12,36		flexa	137
ym	7		cste	3,74		flexo	2,53
x1m	222		r400l	178		xm	35
y1m	1		restp	136,57		sup4	117,4
rfin	29,04		%sd	29,98		sup4t	353,4
bornf	121		lond	176		%	33,2
supd	139,4		%sf	31,14		long	102
supdt	465,1		lf	75			
xmp	398,37		sf/lonf	1,15			
r400	107,53		sr/lr	0,53			
supf	86,2		sd/ld	0,79			
supft	276,8		i.r400	0,60													

Intergen51. eco. Les CDS-CDS négatifs

Sous-totaux	eco			totale	
fréquence	x-	c-		x-	c-
-1		0	162		4	4140
-2		2	0		85	11
-3		0	0		3	12
-4		43	260		717	10938
-5		0	0		5	19
sp6		50	225		1642	8424
total		95	647		2 456	23 544
reste		13	25		264	420
s6		14	0		361	41
s7		6	48		321	1438
s8		17	152		696	6525
rappot s1-5						
4/2/1		21,5	1,6		8,4	2,6
% / sp6						
s6/sp6		28,0	0,0		22,0	0,5
s7/sp6		12,0	21,3		19,5	17,1
s8/sp6		34,0	67,6		42,4	77,5
reste/sp6	26,0	11,1		16,1	5,0
						
total s1-5	45	422		814	15120
% / total						
%s1-5		47,4	65,2		33,1	64,2
%sp6		52,6	34,8		66,9	35,8

Intergen51. eco. Les intercalaires des blocs

• Le détail et les rares
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		7			CDS 16s		4	3
16s 23s		7			5s CDS		2	3
16s tRNA				16 CDS			
tRNA 23s	7			CDS 5s			
5s tRNA		3			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig				5s 16s			
tRNA hors	37			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		65	0		total		6	6

Intergen51. eco. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. eco. Les intercalaires tRNA-tRNA extra bloc
• Les contigus aux blocs: inexistants
• Les hors blocs: 37 au total avec de fortes répétitions qui donnent un diagramme à 2 pics aux abscisses 5 35. Voir les doubles dans ancien eco et le chapitre distribution qui le suit. Faire un tableau avec couleurs.
• Notes: les 7 intercalaires supérieurs à 120 pdbs sont dans des séquences à répétition

Int51.31 eco. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa
37	cag		4	gtc		33	atgf
47	cag		**	gtc		33	atgf
15	atgj		12	tta		**	atgf
34	caa		54	tgc		8	gac
23	caa		**	ggc		**	tgg
9	cta		39	ggc		57	cgg
**	atgj		**	ggc		20	cac
135	aaa		44	gta		42	ctg
2	gta		46	gta		**	cca
149	aaa		4	gta		8	aca
3	gta		**	aaa		116	tac
146	aaa		198	cgt		6	gga
132	aaa		62	cgt		**	acc
**	aaa		198	cgt		36	ggc
209	tac		3	cgt		35	ggc
**	tac		**	agc		**	ggc
						34	ctg
						28	ctg
						**	ctg

eco intercalaires entre cds

• Lien NCBI [67] daté du 23-9-2020 pour ces prélèvements.
• Note: Pour les génomes des annexes j'ai relevé les intercalaires entre tRNAs et entre ceux-ci et les cds qui leur sont adjacents. L'exemple est celui de rru du clade alpha. L'idée de départ de ces prélèvements est la recherche d'opérons formés de tRNA et de protéine comme dans le cas d'E.coli: l'intercalaire entre le tRNA et la protéine devrait être faible. Voir l'exemple d'eco (remarque @3) avec tac-tac-tpr et aca-tac-gga-acc-tufB.

eco intercalaires positifs S+

• Lien tableur: eco intercalaires positifs S+
• Diagrammes 400:  eco cbn,   diagramme 1-40: c+ eco c+ cbn x+ eco total,   texte: cbn.
• Légende: voir la légende de cvi.

eco. Sx+ Sc+ Les diagrammes 400

eco	Sx+							Sc+
Poly3	-7	-5	-3	1	R2	flex x+	comment.	-7	-5	-3	1	R2	flex c+	comment.
1 à 400	22	-151	195	32	532	230	max50	-74	565	-1405	124	805	255	min50
31 à 400								7.6	-18	-162	50	934	79	2 parties
droite	-a	cste	-	R2	note	R2’		-a	cste	-	R2	note	R2’
1 à 400	94	44	-	489	dte	43	tm	197	65	-	540	poly	265	SF
31 à 400								117	43	-	873	poly	61	tm

• Légende du tableau des corrélations et des fréquences faibles

eco. Sx+ Sc+ Les diagrammes 400. Corrélations et les fréquences faibles 1-30

		effectifs diagramme			corrélation x+ c+, 41-n				corrélation x+ c+, 1-n
gen	minima	x+	c+	total	400	200	250	diff	200	250	400
cbn	min20	489	1701	2190	731	543	505	-38	-222	-114	271
eco	min20	1003	2130	3133	735	296	440	144	-178	-64	287
bsu	min10	1028	2444	3472	659	8	282	274	152	257	470
1-30 ‰			effectifs		0 ‰		<0 ‰		effectifs 1-40		corel
1-30 x+	1-30 c+	x+/c+	x	c	x	c	x-	c-	x+	c+	x+/c+
65	312	0.21	553	1940	2	5	17	86	56	620	-382
63	348	0.18	1169	2855	11	6	80	226	126	821	-119
140	333	0.42	1125	3091	2	8	31	186	302	936	-432

• Diagrammes 400:  eco cbn,   diagramme 1-40: c+ eco c+ cbn x+ eco total,   texte: cbn.
• Résumé: J’ai classé les 21 génomes suivant la forme des diagrammes x+ 1-400. J’ai obtenu 3 groupes,
  1. Les tildes au nombre de 5. Ils sont réguliers et forts, tF, avec un R2’ supérieur à 138 pour 4 d’entre eux et scc avec 71. Ce sont, cbei mba pmq et blo scc.
  2. Les formes S au nombre de 6. Leurs forces (R2’) sont variables, ade rru Sf 20-39, ant mja Sm 70-78, pmg pub SF 179-249.
  3. Les diagrammes à pyramide, c’est à dire présentant une bosse avec 4 ou 5 points contigus. Ils sont au nombre de 10 dont 9 sont des tildes et bsu est un Sf très faible (R2’18). abra rtb spl afn sont des tF avec plus de 96, ase cbn cvi sont des tf avec moins de 30, eco myr sont des tm 43 68.

  - eco ressemble beaucoup à cbn comme on vient de le voir avec des courbes x+ 1-400 à pyramide et de forme tilde faible et moyen (R2’ 43 26). Ils ne diffèrent que par le total des effectifs 3133 contre 2190.

  - Les diagrammes 400

  • x+ 1-400:

    + Les 2 génomes ont une pyramide à 4 fréquences avec un maximum à 50. Quand j’enlève les 3 fréquences faibles pour ne laisser que la pyramide, la courbe eco devient une S faible, Sf, R2’ à 36 et la courbe cbn devient une S forte, SF, R2’ à 75. Je n’ai pas représenté les courbes x+ 31-400 à cause des taux peu élevés des fréquences faibles 1-30 65 pour cbn et eco.

    + Les fréquences faibles 1-30 sont en opposition avec celles des cbn c+1-400 et en parallèle avec eco. Cette différence va impacter différemment les corrélations 1-n qu’on verra plus loin.

    + Les points d’inflexion sont normaux et presque égaux 238 pour cbn contre 230.

  • c+ 1-400: Ce sont 2 courbes presque identiques de formes S fort avec un R2’ de 265 pour eco contre 203 et des 2 points d’inflexion normaux, 255 pour eco et 263 pour cbn.
  • x+ 31-400: Je n’ai pas représenté les courbes x+ 31-400 à cause des taux peu élevés des fréquences faibles 1-30, 65 environ pour les 2. Il faudrait les remplacer par les courbes avec pyramide seule sans les fréquences faibles 1-30, voir le paragraphe x+ 1-400 ci-dessus.
  • c+ 31-400: Les 2 formes sont des tildes moyens , tm, avec un R2’ de 61 pour eco et 41 pour cbn. Les 2 points d’inflexions sont différents mais petits, 79 pour eco contre 121.

  - Les corrélations:

  • Sur les plages 41-n: Les 2 corrélations sur 41-250 sont quasiment identiques 440 pour eco contre 505. Par contre eco chute fortement sur 41-200, avec une différence de 144, alors que cbn s’améliore avec une différence de -38.
  • Sur les plages 1-n: les évolutions contraires des fréquences faibles 1-30 que j’ai mentionnées au paragraphe x+ 1-400 agissent fortement sur les corrélations 1-n.

    + Chez eco les fréquences faibles évoluent en parallèle entre celles de x+ 1-400 et c+ 1-400 d’où des corrélations sur 1-n fortement négatives -178 pour 1-200 et -64 pour 1-250.

    + Chez cbn les fréquences faibles évoluent en opposition entre celles de x+ 1-400 et c+ 1-400 d’où des corrélations sur 1-n fortement négatives comme eco -222 pour 1-200 et -114 pour 1-250.

  - Les faibles fréquences: Les faibles fréquences 1-30 ne sont intéressantes à comparer que pour les génomes à courbes 1-400 semblables où le taux de ces fréquences sont élevés et évoluent en parallèle comme entre pmg et pub où le rapport x+/c+ passe de 0.78 à 0.51. Pour eco et cbn ils sont autour de 0.20. Les zéros sont à 7‰ pour cbn et 17‰ pour eco, avantage donné par les x+; alors que le taux des négatifs fait le triple de cbn chez eco, 103‰ contre 306‰ comme chez cvi.

  - Les courbes 1-40:

  • c+ 1-40: Les 2 courbes sont semblables et très proche de celle du total des c+ 1-40.
  • x+ 1-40: Avec un effectif de 56 pour cbn la courbe ne peut être significative. Eco avec 126 est différente du modèle c+ 1-40 car c’est une courbe régulièrement croissante à partir de la fréquence 8 et aussi à cause de la corrélation négative x+/c+ de -119.

eco autres intercalaires

• Lien tableur: eco autres intercalaires aas
• Légende:  

  - comp, le gène est sur le brin complement

  - deb, fin sont respectivement dans le sens des adresses croissantes, le cds avant le 1er tRNA et le cds après le dernier tRNA du bloc.

  - misc_f, pour misc_feature

  - regul, pour regulatory

  - mobile, pour mobile_element

  - rep_or, pour rep_origin

  - gene, est dans NCBI, un pseudo gène

• Note: attention le dernier 233 n'est pas comp', contrôle à l'adresse 4392892. corrigé ici
• Totaux:

tRNA-cds		tRNA-tRNA		autres-cds		total	676
c+	x+	x-	c+	x+	c-	c+	c-	x+		
49	28	0	65	0	0				142	
cds-mob						19	44		63	
cds-gen						149	30	1	180	
cds-misc					39	17		56	
cds-ncR						118	25		143	1 x-
non cds						57	31	1	89	
rep-O						2			2	
gene	mobile	misc_f	ncRNA	rep-O	total	384	147	2	675	
129	50	48	79	1	307					

• Méthode de calculs des intercalaires autres que les CDS-CDS voir le cas de amed.

Escherichia coli Nissle 1917

ecoN opérons

• Liens: gtRNAdb [68], NCBI [69], génome [70]
• Lien tableur: ecoN opérons
• Phylogénie: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia.
• Légende: cdsa: cds aas, cdsd: cds dirigé

G7. Escherichia coli Nissle 1917

50%GC	21.8.19 Paris	123	doubles	intercal	cds	aa	avec aa	cdsa	cdsd	protéines
	231864..232436	CDS		365	365			191		D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
	232802..234321	16s		73				1520
	234395..234471	gaa		12			12
	234484..234557	gca		174
	234732..237319	23s		83				2588
	237403..237518	5s		54				116
	237573..237649	gac		162	162				162
	237812..238615	CDS						268		2,5-didehydrogluconate reductase DkgB
	244934..245665	CDS		132	132			244		DNA polymerase III subunit epsilon
	245798..245874	gac		120	120				120
comp	245995..246852	CDS						286		DUF4942 domain-containing protein
	367329..368582	CDS		114	114			418	114	glutamate-5-semialdehyde dehydrogenase
	368697..368772	acg		154	154
	368927..369265	CDS						113		DUF4102 domain-containing protein
comp	631149..632015	CDS		270	270			289		bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
	632286..632362	aga		15	15				15
comp	632378..632997	CDS						207		tyrosine-type recombinase/integrase
	733188..734363	CDS		153	153			392	153	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
comp	734517..734591	cag	+	37		37
comp	734629..734703	cag	2 cag	48		48
comp	734752..734828	atgj	2 atgj	15		15
comp	734844..734918	caa	2 caa	34		34
comp	734953..735027	caa		23		23
comp	735051..735135	cta		10		10
comp	735146..735222	atgj		380	380
comp	735603..737267	CDS						555		asparagine synthase B
	807377..808169	CDS		164	164			264	164	Pseudo, cell division protein CpoB
	808334..808409	aaa	+	35		35
	808445..808520	gta	5 aaa	2		2
	808523..808598	aaa	2 gta	51		51
	808650..808725	gta		3		3
	808729..808804	aaa		48		48
	808853..808928	aaa		33		33
	808962..809037	aaa		277	277
	809315..810358	CDS						348		quinolinate synthase NadA
	950069..952345	CDS		343	343			759	343	ATP-dependent Clp protease ATP-binding subunit ClpA
comp	952689..952776	tcc		253	253
comp	953030..953248	CDS						73		translation initiation factor IF-1
comp	1047224..1047883	CDS		206	206			220	206	FtsH protease modulator YccA
comp	1048090..1048177	tca		426	426
	1048604..1049722	CDS						373		hydrogenase 1 small subunit
	1183656..1184018	CDS		463	463			121		hp
	1184482..1184558	aga		278	278				278
> comp	1184837..1185786	CDS						317		Pseudo, IS4 family transposase
	1213982..1214809	CDS		165	165			276	165	DUF4942 domain-containing protein
comp	1214975..1215062	tcc		233	233
	1215296..1216234	CDS						313		glyoxylate/hydroxypyruvate reductase GhrA
	1216817..1217098	CDS		165	165			94	165	DUF4942 domain-containing protein
comp	1217264..1217351	tcc		234	234
	1217586..1218524	CDS						313		glyoxylate/hydroxypyruvate reductase GhrA
	1457038..1458129	CDS		16	16			364	16	acyl-CoA desaturase
comp	1458146..1458277	ncRNA		46				44		RtT sRNA
comp	1458324..1458408	tac	+	33		33
comp	1458442..1458526	tac	2 tac	159	159
comp	1458686..1459528	CDS						281		formyltetrahydrofolate deformylase
comp	1829066..1830322	CDS		307	307			419		hp
	1830630..1830706	gtc	+	4		4
	1830711..1830787	gtc	2 gtc	6	6				6
<	1830794..1831177	CDS	@4					128		Pseudo, multidrug efflux MATE transporter MdtK
comp	1831218..1832474	CDS		307	307			419		hp
	1832782..1832858	gtc	+	4		4
	1832863..1832939	gtc	2 gtc	8	8				8
<	1832948..1833280	CDS						111		Pseudo, MATE family efflux transporter
comp	1833321..1834577	CDS		307	307			419		hp
	1834885..1834961	gtc	+	4		4
	1834966..1835042	gtc	2 gtc	108	108				108
	1835151..1835456	CDS						102		monooxygenase
comp	2115794..2116459	CDS		195	195			222		UPF0149 family protein YecA
comp	2116655..2116741	tta		12		12
comp	2116754..2116827	tgc		53		53
comp	2116881..2116956	ggc		151	151				151
comp	2117108..2117656	CDS						183		CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
comp	2191451..2192287	CDS		278	278			279		hp
comp	2192566..2192655	tcg		93	93				93
	2192749..2193546	CDS		100	100			266	100	DgsA anti-repressor MtfA
	2193647..2193722	aac		161	161
	2193884..2195146	CDS						421		tyrosine-type recombinase/integrase
	2232607..2233323	CDS		453	453			239		YebC/PmpR family DNA-binding transcriptional regulator
comp	2233777..2233852	acc		326	326				326
	2234179..2235096	CDS						306		nitrogen assimilation transcriptional regulator
	2235198..2236148	CDS		37	37			317		HTH-type transcriptional regulator Cbl
comp	2236186..2236261	aac		4	4				4
	2236266..2237909	CDS		100	100			548	100	toxic metabolite efflux MATE transporter YeeO
	2238010..2238085	aac		161	161
	2238247..2239518	CDS						424		tyrosine-type recombinase/integrase
	2546968..2548728	CDS		74	74			587	74	cardiolipin transport protein PbgA
	2548803..2548879	ccc		101	101
comp	2548981..2549136	CDS						52		autotransporter outer membrane beta-barrel domain-containing protein
	2717780..2718712	CDS		75	75			311	75	formate/nitrite transporter family protein
	2718788..2718862	agg		437	437
comp	2719300..2719830	CDS						177		OmpH family outer membrane protein
comp	2768744..2770933	CDS		206	206			730	206	sensor domain-containing phosphodiesterase
comp	2771140..2771215	gcc	+	39		39
comp	2771255..2771330	gcc	2 gcc	220	220
	2771551..2771910	CDS						120		putative DNA-binding transcriptional regulator
comp	2772355..2773770	CDS		258	258			472		glutamate--tRNA ligase
	2774029..2774104	gta	+	43		43
	2774148..2774223	gta	3 gta	46		46
	2774270..2774345	gta		4		4
	2774350..2774425	aaa		110	110				110
comp	2774536..2775420	CDS						295		LysR family transcriptional regulator
comp	2959205..2960503	CDS		323	323			433	323	alpha-ketoglutarate permease
comp	2960827..2960942	5s		83				116
comp	2961026..2965477	23s		184				4452
comp	2965662..2965737	gaa		431
comp	2966169..2967720	16s		441	441			1552
comp	2968162..2970735	CDS						858		ATP-dependent chaperone ClpB
comp	3027207..3027773	CDS		280	280			189	280	fructose-1-phosphate/6-phosphogluconate phosphatase
comp	3028054..3028130	cgt	+	63		63
comp	3028194..3028270	cgt	5 cgt	62		62
comp	3028333..3028409	cgt		62		62
comp	3028472..3028548	cgt		64		64
comp	3028613..3028689	cgt		3		3
comp	3028693..3028785	agc		315	315
comp	3029101..3029286	CDS						62		carbon storage regulator CsrA
comp	3157337..3158434	CDS		208	208			366	208	murein transglycosylase A
	3158643..3158719	atgf	+	33		33
	3158753..3158829	atgf	3 atgf	33		33
	3158863..3158939	atgf		635	635
	3159575..3160075	CDS						167		type VI secretion system contractile sheath small subunit
	3230172..3231401	CDS		316	316			410		HAAAP family serine/threonine permease
comp	3231718..3231791	ggg		78	78				78
comp	3231870..3232625	CDS						252		peptidoglycan DD-metalloendopeptidase family protein
	3341048..3341755	CDS		105	105			236	105	DUF554 domain-containing protein
	3341861..3341936	ttc		197	197
	3342134..3343399	CDS						422		integrase arm-type DNA-binding domain-containing protein
comp	3569308..3569814	CDS		124	124			169		G/U mismatch-specific DNA glycosylase
	3569939..3570014	atgi		53	53				53
comp	3570068..3570832	CDS						255		NADPH-dependent ferric chelate reductase
comp	3670227..3670679	CDS		206	206			151	206	ribosome maturation factor RimP
comp	3670886..3670962	atgf		347	347
>	3671310..3672155	CDS						282		Pseudo, argininosuccinate synthase
comp	3673935..3674387	CDS		206	206			151	206	ribosome maturation factor RimP
comp	3674594..3674670	atgf		347	347
>	3675018..3675869	CDS						284		Pseudo, argininosuccinate synthase
comp	3677794..3678246	CDS		206	206			151	206	ribosome maturation factor RimP
comp	3678453..3678529	atgf		347	347
>	3678877..3679722	CDS						282		Pseudo, argininosuccinate synthase
comp	3681532..3681984	CDS		206	206			151	206	ribosome maturation factor RimP
comp	3682191..3682267	atgf		347	347
	3682615..3683958	CDS						448		argininosuccinate synthase
comp	3683966..3685591	CDS		456	456			542		phosphoethanolamine transferase
comp	3686048..3686134	ctc		14	14				14
comp	3686149..3686481	CDS						111		preprotein translocase subunit SecG
	3784553..3785311	CDS		62	62			253	62	amino acid ABC transporter ATP-binding protein
comp	3785374..3785489	5s	@3	39				116
comp	3785529..3785605	acc		14
comp	3785620..3785735	5s		777				116
comp	3786513..3786588	acc		14
comp	3786603..3786718	5s		1834				116
comp	3788553..3788628	gaa		1360	1360
	3789989..3790543	CDS						185		gamma carbonic anhydrase family protein
comp	4078635..4080242	CDS		743	743			536		dipeptide ABC transporter substrate-binding protein DppA
comp	4080986..4081062	ccg		91	91				91
comp	4081154..4082845	CDS						564		kdo(2)-lipid A phosphoethanolamine 7-transferase
comp	4205966..4207348	CDS		292	292			461	292	glycoside-pentoside-hexuronide family transporter
	4207641..4207735	tga		300	300
>	4208036..4208857	CDS						274		Pseudo, DUF4102 domain-containing protein
comp	4338643..4339335	CDS		479	479			231		FadR family transcriptional regulator
	4339815..4341342	16s		73				1528
	4341416..4341491	gaa		184
	4341676..4344286	23s		83				2611
	4344370..4344485	5s		53				116
	4344539..4344615	gac		8
	4344624..4344699	tgg		95	95				95
comp	4344795..4345634	CDS						280		HTH-type transcriptional regulator HdfR
	4377681..4379066	CDS		102	102			462	102	amino acid permease
	4379169..4379245	cgg		58		58
	4379304..4379379	cac		20		20
	4379400..4379486	ctg		42		42
	4379529..4379605	cca		146	146
	4379752..4380987	CDS						412		anaerobic sulfatase maturase
	4460971..4461516	CDS		377	377			182		menaquinone-dependent protoporphyrinogen IX dehydrogenase
	4461894..4463631	16s		56				1738
	4463688..4463764	atc		42			42
	4463807..4463882	gca		165
	4464048..4467338	23s		83				3291
	4467422..4467537	5s		104	104			116	104
comp	4467642..4468169	CDS						176		molybdopterin-guanine dinucleotide biosynthesis protein B
	4605577..4606434	CDS		374	374			286		glutamate racemase
	4606809..4608362	16s		363				1554
	4608726..4608801	gaa		1112
	4609914..4610029	5s		136	136			116	136
	4610166..4611194	CDS						343		UDP-N-acetylenolpyruvoylglucosamine reductase
comp	4612185..4613135	CDS		361	361			317		type I pantothenate kinase
	4613497..4613572	aca		8		8
	4613581..4613665	tac		116		116
	4613782..4613856	gga		6		6
	4613863..4613938	acc		114	114				114
	4614053..4615237	CDS						395		elongation factor Tu
comp	4642984..4644573	CDS		616	616			530		bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
	4645190..4646378	16s’	@1	83	83			1189	83
	4646462..4648150	CDS		436	436			563		bifunctional isocitrate dehydrogenase kinase/phosphatase
	4648587..4648662	gaa		185
	4648848..4651319	23s		83				2472
	4651403..4651518	5s		76	76			116	76
	4651595..4651978	CDS						128		hypothetical protein
< comp	4834504..4834961	CDS		197	197			153		pseudo, integrase
comp	4835159..4835234	ttc		106	106				106
comp	4835341..4835916	CDS						192		transcriptional regulator
	4864628..4865173	CDS		210	210			182	210	oligoribonuclease
	4865384..4865459	ggc	+	36		36
	4865496..4865571	ggc	3 ggc	35		35
	4865607..4865682	ggc		233	233
	4865916..4865969	CDS						18		hp
comp	4974178..4975197	CDS		195	195			340		NADPH-dependent aldehyde reductase Ahr
	4975393..4975477	ttg		39	39				39
<> comp	4975517..4976055	CDS						180		pseudo, IS630 family transposase
	5042527..5042763	CDS		38	38			79	38	DUF1435 domain-containing protein
comp	5042802..5042888	ctg	+	34		34
comp	5042923..5043009	ctg	3 ctg	28		28
comp	5043038..5043124	ctg		290	290
comp	5043415..5044446	CDS						344		16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
comp	5079375..5079581	CDS		117	117			69	117	AlpA family transcriptional regulator
	5079699..5081218	16s		73				1520
	5081292..5081368	gaa		12			12
	5081381..5081454	gca		366	366
	5081821..5082018	CDS		524	524			66		hypothetical protein
comp	5082543..5082754	CDS						71		hypothetical protein
comp	5090325..5090876	CDS		1808	1808			184		MarR family transcriptional regulator
comp	5092685..5092760	gaa		588	588				588
< comp	5093349..5093474	CDS		592	592			42		sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
	5094067..5094142	gaa	+	1472			1472
	5095615..5095691	atc	3 gaa	42			42
	5095734..5095809	atc	2 atc	1130			1130
	5096940..5097015	gaa		1145			1145
	5098161..5098236	gaa		185
	5098422..5100893	23s		83				2472
	5100977..5101092	5s		76	76			116	76
	5101169..5101552	CDS		63	63			128		hypothetical protein
comp	5101616..5102059	CDS						148		acetyltransferase
	5124754..5125197	CDS		63	63			148		acetyltransferase
comp	5125261..5125644	CDS		76	76			128		hypothetical protein
comp	5125721..5125836	5s		83				116
comp	5125920..5128366	23s’	@2	-10	-10			2447	-10
<	5128357..5128479	CDS						41		pilus assembly protein
comp	5252659..5253870	CDS		300	300			404		tyrosine-type recombinase/integrase
comp	5254171..5254249	tga		292	292				292
>	5254542..5255171	CDS						210		pseudo, glycoside-pentoside-hexuronide family transporter
> comp	5305902..5306228	CDS		0	0			109	0	pseudo, hp
comp	5306229..5306302	atc		1096	1096
	5307399..5308450	CDS						351		pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
comp	5321144..5321869	CDS		206	206			242	206	pseudo, histidine kinase
comp	5322076..5322151	gcc	+	39		39
comp	5322191..5322266	gcc	3 gcc	39		39
comp	5322306..5322381	gcc		220	220
	5322602..5322961	CDS						120		putative DNA-binding transcriptional regulator
comp	5323406..5324821	CDS		258	258			472		glutamate--tRNA ligase
	5325080..5325155	gta	+	44		44
	5325200..5325275	gta	2 gta	0	0				0
<	5325276..5325389	CDS						38		pseudo, putative DNA-binding transcriptional regulator
>	5375524..5376270	CDS		891	891			249	891	pseudo, AI-2E family transporter
	5377162..5377237	gaa		1047	1047
comp	5378285..5379589	CDS						435		isocitrate lyase
comp >	5341397..5341492	CDS		-2	-2			32	-2	ABC transporter ATP-binding protein
comp	5341491..5344303	23s		174				2813
comp	5344478..5344553	gca		42			42
comp	5344596..5344672	atc		56
comp	5344729..5346282	16s		1063				1554
comp	5347346..5347421	gca		42			42
comp	5347464..5347540	atc		56
comp	5347597..5349150	16s		365	365			1554
comp	5349516..5350088	CDS		187	187			191		D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
>	5350276..5350914	CDS						213		methionine ABC transporter ATP-binding protein MetN
> comp	5359583..5360512	CDS		120	120			310		tyrosine-type recombinase/integrase
comp	5360633..5360708	gca		42
comp	5360751..5360827	atc		56
comp	5360884..5362138	16s’		1	1			1255	1
< comp	5362140..5363543	CDS						468		IS66 family transposase
	5425965..5426201	CDS		38	38			79	38	DUF1435 domain-containing protein
comp	5426240..5426325	ctg	+	26		26				a disparu le 20.12.19
comp	5426352..5426438	ctg	3 ctg	28		28
comp	5426467..5426553	ctg		63	63
< comp	5426617..5427150	CDS						178		pseudo, IS630-like element IS630 family transposase
>	5433568..5433687	CDS		39	39			40	39	pseudo, nicotinamide-nucleotide amidase
comp	5433727..5433814	tcc		253	253
comp	5434068..5434286	CDS						73		translation initiation factor IF-1

ecoN cumuls

• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.ecoN. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.
• Lien tableur: ecoN cumuls

cumuls. Escherichia coli Nissle 1917

opérons			Fréquences intercalaires tRNAs			Fréquences intercalaires cds				Fréquences aas cds
		effectif	gammes	sans rRNAs	avec rRNAs	gammes	cds	gammes	cdsd	gammes	cdsa	gammes	cdsa 300
avec rRNA	opérons	12	1	0		1	5	1	5	100	16	1	0
	16 23 5s	0	20	13	2	50	11	40	10	200	34	30	1
	16 atc gca	2	40	17		100	17	80	7	300	29	60	6
	16 gaa 235	2	60	9	4	150	16	120	16	400	18	90	8
	max a	5	80	4		200	15	160	3	500	18	120	8
	a doubles	1	100	0		250	14	200	4	600	8	150	7
	spéciaux	8	120	1		300	14	240	9	700	0	180	11
	total aas	27	140	0		350	12	280	2	800	2	210	11
sans	opérons	50	160	0		400	7	320	2	900	1	240	6
	1 aa	32	180	0		450	4	360	3	1000	0	270	9
	max a	7	200	0		500	4	400	0	1100	0	300	12
	a doubles	15		0			11		2		0		0
	total aas	94		44	6		130		63		126		79
total aas		121
remarques		4
avec jaune			moyenne	33	32		253		142		272		172
			variance	23	15		258		145		162		79
sans jaune			moyenne	31			178		127		260
			variance	19			109		91		142

ecoN blocs

• Lien tableur: ecoN blocs
• Légende:

  - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.

  - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.

  - Protéines en vert, sont hypothétiques ou typées, gc anhydrase. Voir les noms longs.

ecoNb Escherichia coli Nissle 1917, ecoN blocs

ecoNb1 Escherichia coli Nissle 1917, ecoN blocs gène interca pbs cdsa protéine cds 365 191 D-glycero 16s 73 1520 gaa 12 gca 174 23s 83 2588 5s 54 116 gac 162 cds 268 gluDkgB cds 323 433 glutarate pm 5s 83 116 23s 184 4452 gaa 431 16s 441 1552 cds 858 ClpB dep cds 616 530 AICAR2 16s’ 83 1189 cds 436 563 kinase isocit gaa 185 23s 83 2472 5s 76 116 cds 128 hp-128 cds 62 253 pu-ABC 5s 39 116 acc 14 5s 777 116 acc 14 5s 1834 116 gaa 1360 cds 185 gc anhydrase cds 377 182 porphyrine M 16s 56 1738 atc 42 gca 165 23s 83 3291 5s 104 116 cds 176 Mlb pB cds 479 231 FadR tr 16s 73 1528 gaa 184 23s 83 2611 5s 53 116 gac 8 tgg 95 cds 280 HdfR HTH

ecoNb2 Escherichia coli Nissle 1917, ecoN blocs gène interca pbs cdsa protéine cds 374 286 Glu race 16s 363 1554 gaa 1112 5s 136 116 cds 343 UDP-N cds 117 69 tr AlpA 16s 73 1520 gaa 12 gca 366 cds 524 66 hp-66 cds 71 hp-71 cds -2 32 ABC 32 23s 174 2813 gca 42 atc 56 16s 1063 1554 gca 42 atc 56 16s 365 1554 cds 187 191 D-glycero cds 213 ABC MetN cds 120 310 Tyr recb 310 gca 42 atc 56 16s’ 1 1255 cds 468 IS66 cds 63 148 transferase cds 76 128 hp-128 5s 83 116 23s’ -10 2447 cds 41 pilus cds 1808 184 MarR gaa 588 cds 592 42 sn-glycerol gaa 1472 atc 42 atc 1130 gaa 1145 gaa 185 23s 83 2472 5s 76 116 cds 63 128 hp-128 cds 148 transferase

ecoNb3 ecoN rRNAs rRNAs pbs 16s 1189 1255 1520 1520 1528 1552 1554 1554 1554 1738   23s 2447 2472 2472 2588 2611 2813 3291 4452   5s 116 x 11

ecoN remarques

• Remarques: ecoN opérons

  Beaucoup de blocs à rRNAs incomplets, 7 sur 12. Parmi les 5 complets 1 est semi-complet puisqu’il manque le 5s peu important. Les 5 blocs complets sont conformes au typage des gamma, avec y atcgca gaagca gaa et avec z sans gactgg gac.

  1. @1

     - Deux 16s aux extrémités non conformes, 16s’, adresses 4645190..4646378 et 5360884..5362138 .

     - Il n’y a pas de 16s° ou de 23s° courts, apparemment ils n’ont pas laissé de traces.

     - C’est ce qui expliquerait les 7 blocs incomplets et le nombre élevé de 32 des clusters sans rRNAs et à 1 seul tRNA.

  2. @2

     - Un 23s aux extrémités non comforme, 23s’, adresse 5125920..5128366 .

     - Même remarque que pour les 16s’, mais en plus je peux attribuer le grand nombre de petits cds aux remaniements qu’ont du subir ces blocs incomplets, voir ecoN blocs.

       5128357..5128479  -10 cp 23s'

       5341397..5341492  atcgca -2

       5360884..5362138  16s’ 1

  3. @3

     - Les 5s se comportent en typage gamma même pour ceux qui sont dans un bloc incomplet. Parmi ces derniers la plupart n’ont pas de z mais dans le cluster comportant 3 5s, adresse 3785374..3785489 , on peut distinguer avec des intercalaires faibles un 5s-acc-5s et un 5s-acc, où les 5s du début appartiendraient à un bloc complet.

  4. @4

     - Parmi les 6 clusters sans rRNA et à 2 tRNAs tous sont doubles et 3 sont identiques même en intercalaires, les 3 gtc. Les 3 autres sont gta tac et gcc.

     - Parmi les 6 clusters sans rRNA et à 3 tRNAs 5 sont des triples dont 2 à cgt ont même 2 intercalaires identiques, adresses. Les tRNAs de ces triplets sont atgf ggc gcc et 2 fois cgt. Le 6ème cluster à 3 tRNAs n’ a pas de doubles.

• Séquences des doubles:

aas	clusters	doubles	séquences					
1	32		-					
2	6		6	2 tac	2 gtc*3  2 gcc	2 gta	
3	6		5	3 atgf	3 ctg*2  3 ggc	3 gcc	
4	3		1	3 gta				
5	0						
6	1		1	5 cgt				
7	2		2	5 aaa 2 gta    2 cag 2 atgj 2 caa

ecoN distribution

• Lien tableur: ecoN distribution
• Notes:

  - 3gtc2 gta2+3 2ctg3 gcc2+3 tac2 aaa3 atgf3 ggc3

  - atc: 4 16s, atc2, 1aa

  - gaa: 7 16s, 5s, 4 1aa

  - acc: 2 5s, >1aa, 1aa

  - gac: 2 5s, 1aa

  - Séquences: (aaa gta)2 aaa3

  - Adresse 5098422: ce bloc est compté dans « avec rRNA » dans cumuls. Mais ici je compte

  1 gaa avec rRNA

  2 gaa 1aa

  2 atc >1aa

Gm5 ecoN, Escherichia coli Nissle 1917. gama

g1		t1
a atgi	1	a tct		tat		atgf	7
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	2	b tcc		tac	3	tgc	1
f atc	7	j acc	4	aac	3	agc	1
g ctc	1	f ccc	4	cac	1	cgt	5
h gtc	6	n gcc	1	gac	3	ggc	4
i tta	1	c tca	5	taa		tga	2
j ata		k aca	1	aaa	6	aga	2
k cta	1	g cca	1	caa	2	cga
l gta	7	o gca	1	gaa	12	gga	1
m ttg	1	d tcg	6	tag		tgg	1
n atgj	2	l acg	1	aag		agg	1
o ctg	7	h ccg	1	cag	2	cgg	1
p gtg		p gcg	1	gag		ggg	1
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
ecoN	64	34		6		17	121

ecoN eco

ecoN eco tableaux

• Lien tableur: ecoN eco tableaux
• Légende: eco 435, la recherche de isocitrate, voir noms longs, se trouve à l'adresse 4217109..4218413 chez eco.

  - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.

  - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.

  - Colonne cdsa

  . en clair la longueur de la protéine en aas

  . en orange 1542, longueur des rRNAs en pbs.

  - Colonne cds, les noms courts des cds

  . en clair

  . en vert D glycero, protéine identique entre eco et ecoN, à peu près en longueur et par le nom.

  . en bleu YdiA, protéine complètement différente en nom et/ou en longueur, entre ecoN et eco

  . en turquoise hp-419, protéine identique par la longueur mais différente par le nom, entre ecoN et eco

  . en gris clair D glycero, dans le tableau E13, protéine transposée par complement (colonne sens) entre ecoN et eco alors qu'il y a transposition des intercalaires (colonne interca), 365.

  . en gris foncé ABC 32, dans le tableau E13, protéine non transposée par complement (colonne sens) entre ecoN et eco alors qu'il n'y a pas transposition des intercalaires (colonne interca), 174.

  . en vert très foncé, dans le tableau E13, Tyr recb 404,protéine existant dans ecoN mais non trouvée dans eco.

• Notes: Les dates de prélèvements des blocs de eco sont ceux de eco opérons du 10.3.19 alors que les cds de eco ont été prélevés le 19.12.19, qu'on voit dans le tableur ecoN eco tableaux. Pour ecoN la date de prélèvement est celle de ecoN opérons.

E1. Comparaison eco ecoN

E11. Clusters eco cluster sens gènes interca cdsa cds eco1 222833..223408 cds 362 192 D-glycero 223771..225312 16s 68 1542 225381..225457 atc 42 225500..225575 gca 183 225759..228662 23s 93 2904 228756..228875 5s 52 120 228928..229004 gac 162 229167..229970 cds 268 metDkgB   eco2 236067..236798 cds 132 244 DNAIIIe 236931..237007 gac 327 237335..238120 cds 262 lipo YafT   eco3 261503..262756 cds 114 418 glu5dH 262871..262946 acg 203 comp 263150..263212 cds 21 YdiA 262898..297205 phage 11436 pp CP4-6   eco4 comp 563848..564480 cds 242 211 put FimZ 564723..564799 aga 15 comp 564815..565978 cds 388 put DLP12 564755..586056 phage 7101 pp DLP12   eco5 695101..696276 cds 31 392 octaprenyl comp 696308..696378 rpr 51 71 rpt71 comp 696430..696504 cag 37 comp 696542..696616 cag 47 comp 696664..696740 atg 15 comp 696756..696830 caa 34 comp 696865..696939 caa 23 comp 696963..697047 cta 9 comp 697057..697133 atg 379 comp 697513..699177 cds 555 Asn B   eco6 779598..780389 cds 164 264 cell CpoB 780554..780629 aaa 135 780765..780840 gta 2 780843..780918 aaa 149 781068..781143 gta 3 781147..781222 aaa 146 781369..781444 aaa 132 781577..781652 aaa 432 782085..783128 cds 348 quino   eco7 923264..925540 cds 343 759 ATP ClpA comp 925884..925971 tcc 253 comp 926225..926443 cds 73 tif IF-1   eco8 comp 1030759..1031418 cds 206 220 FtsH comp 1031625..1031712 tca 426 1032139..1033257 cds 373 Hnase1   eco9 *****aga*****     eco10 1095843..1096829 cds 735 329 un-YcdU comp 1097565..1097652 tcc 233 1097886..1098824 cds 313 glyoxylate A   eco11 *****tcc*****     eco12 1286709..1286984 cds 81 92 p-un-YchS comp 1287066..1287236 ncRNA -150 171 RttR sRNA comp 1287087..1287176 cds 67 30 tpr comp 1287244..1287328 tac 209 comp 1287538..1287622 tac 159 comp 1287782..1288624 cds 281 fTHF   eco13 ***** gtc ***** gtc     eco14 ***** gtc ***** gtc     eco15 comp 1744871..1746127 cds 307 419 adhes YdhQ 1746435..1746511 gtc 4 1746516..1746592 gtc 107 1746700..1747005 cds 102 pu-YdhR   eco16 comp 1990954..1991619 cds 195 222 UPF0149 YecA comp 1991815..1991901 tta 12 comp 1991914..1991987 tgc 54 comp 1992042..1992117 ggc 151 comp 1992269..1992817 cds 183 glycerolP   eco17 2042368..2042898 cds 569 177 pu-cytochrom comp 2043468..2043557 tcg 93 2043651..2044448 cds 100 266 Mtf 2044549..2044624 aac 313 2044938..2052014 cds 2359 Inv-adhesin   eco18 2056858..2057574 cds 452 239 pu-tr-YeeN comp 2058027..2058102 aac 100 comp 2058203..2059846 cds 4 548 exporter 2059851..2059926 aac 37 comp 2059964..2060914 cds 101 317 tact Cbl comp 2061016..2061933 cds 326 306 tr-Nac 2062260..2062335 aac 55 comp 2062391..2063323 cds 311 ErfK   eco19 2284376..2286136 cds 74 587 pu-cardiolip 2286211..2286287 ccc 102 comp 2286390..2288914 cds 842 adhes YejO   eco20 2465301..2466233 cds 75 311 YfdC 2466309..2466383 agg 161 2466545..2467702 cds 386 KpLE1 2466369..2476583 phage 3405 pp CPS-53   eco21 comp 2515643..2517832 cds 208 730 pu-sensor comp 2518041..2518116 gcc 39 comp 2518156..2518231 gcc 235 2518467..2518811 cds 115 pu- YfeC   eco22 comp 2519257..2520672 cds 258 472 Glu ligase 2520931..2521006 gta 44 2521051..2521126 gta 46 2521173..2521248 gta 4 2521253..2521328 aaa 210 2521539..2521567 rpr 25 29 rpt-29 comp 2521593..2522477 cds 295 XapR   eco23 comp 2724448..2725746 cds 322 433 glutarate sm comp 2726069..2726188 5s 92 120 comp 2726281..2729184 23s 184 2904 comp 2729369..2729444 gaa 171 comp 2729616..2731157 16s 442 1542 comp 2731600..2734173 cds 858 ClpB   eco24 comp 2784529..2785011 cds 750 161 DUF5507 comp 2785762..2785837 atgi 559 2786397..2788649 cds 751 pu-unYgaQ   eco25 comp 2816937..2817503 cds 280 189 fructose comp 2817784..2817860 cgt 198 comp 2818059..2818135 cgt 62 comp 2818198..2818274 cgt 198 comp 2818473..2818549 cgt 3 comp 2818553..2818645 agc 315 comp 2818961..2819146 cds 62 Csr   eco26 comp 2946081..2947178 cds 208 366 murein lytic 2947387..2947463 atgf 33 2947497..2947573 atgf 33 2947607..2947683 atgf 73 comp 2947757..2949010 cds 418 Ala C   eco27 comp 2998034..2998828 cds 155 265 YgeQ comp 2998984..2999057 ggg 78 comp 2999136..2999891 cds 252 pu-LysM   eco28 3109553..3110260 cds 105 236 DUF554 3110366..3110441 ttc 148 comp 3110590..3111126 cds 179 pu-ssM   eco29 comp 3214967..3215473 cds 124 169 G/U station 3215598..3215673 atgi 53 comp 3215727..3216491 cds 255 ferric   eco30       eco31       eco32       eco33 comp 3317554..3318006 cds 206 151 RimP comp 3318213..3318289 atgf 347 3318637..3319980 cds 448 Arg-suc   eco34 comp 3319988..3321613 cds 458 542 pu-hydrolase comp 3322072..3322158 ctc 14 comp 322173..3322505 cds 111 SecG-t   eco35 3422436..3423194 cds 228 253 pu-YhdZ comp 3423423..3423542 5s 37 120 comp 3423580..3423655 acc 12 comp 3423668..3423787 5s 92 120 comp 3423880..3426783 23s 174 2904 comp 3426958..3427033 gca 42 comp 3427076..3427152 atc 68 comp 3427221..3428762 16s 473 1542 3429236..3429790 cds 185 protein YrdA   eco36 comp 3706098..3707705 cds 567 536 dip ABC comp 3708273..3708306 rpr 16 34 rpt-34 3708323..3708358 rpr 257 36 rpt-36 comp 3708616..3708692 ccg 91 comp 3708784..3710475 cds 564 kdo2   eco37 comp 3834547..3835929 cds 292 461 pu-YicJ 3836222..3836316 tga 108 3836425..3836556 pseudo 396 132 p-yicT 3836953..3838137 cds 395 pu-arabi   eco38 comp 3940635..3941327 cds 480 231 pu-tr YieP 3941808..3943349 16s 85 1542 3943435..3943510 gaa 193 3943704..3946607 23s 92 2904 3946700..3946819 5s 52 120 3946872..3946948 gac 8 3946957..3947032 tgg 95 comp 3947128..3947967 cds 280 HdfR   eco39 3980887..3982272 cds 102 462 pu-YifK 3982375..3982451 cgg 57 3982509..3982585 cac 20 3982606..3982692 ctg 42 3982735..3982811 cca 146 3982958..3984193 cds 412 pu-AslB   eco40 4034608..4035153 cds 377 182 porphyrine O 4035531..4037072 16s 68 1542 4037141..4037217 atc 42 4037260..4037335 gca 183 4037519..4040423 23s 93 2905 4040517..4040636 5s 228 120 4040865..4040900 rpr 5 36 rpt-36 comp 4040906..4041433 cds 176 Mlb adapt   eco41 4165428..4166285 cds 373 286 Glu race 4166659..4168200 16s 171 1542 4168372..4168447 gaa 193 4168641..4171544 23s 92 2904 4171637..4171756 5s 300 120 4172057..4173085 cds 343 UDP-N   eco42 comp 4174076..4175026 cds 361 317 B5 kinase 4175388..4175463 aca 8 4175472..4175556 tac 116 4175673..4175747 gga 6 4175754..4175829 acc 114 4175944..4177128 cds 229 395 tufb 4177358..4177741 cds 128 SecE   eco43 comp 4205943..4207532 cds 614 530 AICAR1 4208147..4209688 16s 85 1542 4209774..4209849 gaa 193 4210043..4212946 23s 93 2904 4213040..4213159 5s 74 120 4213234..4213617 cds 128 stress   eco44 comp 4360396..4361934 cds 256 513 CadC comp 4362191..4362353 pseudo 197 163 yjdQ comp 4362551..4362626 ttc 106 comp 4362733..4363308 cds 192 pu-tr YjdC   eco45 4391604..4392149 cds 210 182 oligo-rnase 4392360..4392435 ggc 36 4392472..4392547 ggc 35 4392583..4392658 ggc 233 4392892..4392945 cds 18 un-YjeV   eco46 comp 4495190..4496209 cds 195 340 NADPH- Ah 4496405..4496489 ttg 260 4496750..4497940 cds 397 pu-KpLE2 4496675..4497940 phage 422 pp PR-Y   eco47 4605804..4606040 cds 38 79 protein YjjZ comp 4606079..4606165 ctg 34 comp 4606200..4606286 ctg 28 comp 4606315..4606401 ctg 157 4606559..4606594 rpr 22 36 rpt 36 comp 4606617..4606650 rpr 18 34 rpt 34 comp 4606669..4607700 cds 344 G1207

E12. Clusters ecoN alignés sur les clusters de eco cluster sens gènes interca cdsa cds ecoN1 231864..232436 CDS 365 191 D-glycero 232802..234321 16s 73 1520 234395..234471 gaa 12 234484..234557 gca 174 234732..237319 23s 83 2588 237403..237518 5s 54 116 237573..237649 gac 162 237812..238615 CDS 268 gluDkgB   ecoN2 244934..245665 CDS 132 244 DNAIIIe 245798..245874 gac 120 comp 245995..246852 CDS 286 DUF4942   ecoN3 367329..368582 CDS 114 418 glu5dH 368697..368772 acg 154 368927..369265 CDS 113 DUF4102     ecoN4 comp 631149..632015 CDS 270 289 cyclo FolD 632286..632362 aga 15 comp 632378..632997 CDS 207 Tyr recb 207     ecoN5 733188..734363 CDS 153 392 octaprenyl comp 734517..734591 cag 37 comp 734629..734703 cag 48 comp 734752..734828 atgj 15 comp 734844..734918 caa 34 comp 734953..735027 caa 23 comp 735051..735135 cta 10 comp 735146..735222 atgj 380 comp 735603..737267 CDS 555 Asn B     ecoN6 807377..808169 CDS 164 264 p-cell CpoB 808334..808409 aaa 35 808445..808520 gta 2 808523..808598 aaa 51 808650..808725 gta 3 808729..808804 aaa 48 808853..808928 aaa 33 808962..809037 aaa 277 809315..810358 CDS 348 quino NadA   ecoN7 950069..952345 CDS 343 759 ATP ClpA comp 952689..952776 tcc 253 comp 953030..953248 CDS 73 tif IF-1   ecoN8 comp 1047224..1047883 CDS 206 220 FtsH YccA comp 1048090..1048177 tca 426 1048604..1049722 CDS 373 Hnase1   ecoN9 1183656..1184018 CDS 463 121 hp-121 1184482..1184558 aga 278 > comp 1184837..1185786 CDS 317 p-IS4   ecoN10 1213982..1214809 CDS 165 276 DUF4942 comp 1214975..1215062 tcc 233 1215296..1216234 CDS 313 glyoxyl GhrA   ecoN11 1216817..1217098 CDS 165 94 DUF4942 comp 1217264..1217351 tcc 234 1217586..1218524 CDS 313 glyoxyl GhrA   ecoN12 1457038..1458129 CDS 16 364 acyl-CoA comp 1458146..1458277 ncRNA 46 44 RtT sRNA comp 1458324..1458408 tac 33 comp 1458442..1458526 tac 159 comp 1458686..1459528 CDS 281 fTHF   ecoN13 comp 1829066..1830322 CDS 307 419 hp-419 1830630..1830706 gtc 4 1830711..1830787 gtc 6 < 1830794..1831177 CDS 128 p-MdtK   ecoN14 comp 1831218..1832474 CDS 307 419 hp-419 1832782..1832858 gtc 4 1832863..1832939 gtc 8 < 1832948..1833280 CDS 111 p-MATE   ecoN15 comp 1833321..1834577 CDS 307 419 hp-419 1834885..1834961 gtc 4 1834966..1835042 gtc 108 1835151..1835456 CDS 102 mono-O2   ecoN16 comp 2115794..2116459 CDS 195 222 UPF0149 YecA comp 2116655..2116741 tta 12 comp 2116754..2116827 tgc 53 comp 2116881..2116956 ggc 151 comp 2117108..2117656 CDS 183 CDP-diacyl   ecoN17 comp 2191451..2192287 CDS 278 279 hp-279 comp 2192566..2192655 tcg 93 2192749..2193546 CDS 100 266 MtfA 2193647..2193722 aac 161 2193884..2195146 CDS 421 Tyr recb-421   ecoN18 2232607..2233323 CDS 453 239 tr-YebC comp 2233777..2233852 acc 326 2234179..2235096 CDS 101 306 tr-nitrogen 2235198..2236148 CDS 37 317 tr-Cbl comp 2236186..2236261 aac 4 2236266..2237909 CDS 100 548 trp-YeeO 2238010..2238085 aac 161 2238247..2239518 CDS 424 Tyr recb 424   ecoN19 2546968..2548728 CDS 74 587 cardiolipine 2548803..2548879 ccc 101 comp 2548981..2549136 CDS 52 barrel   ecoN20 2717780..2718712 CDS 75 311 nitrite 2718788..2718862 agg 437 comp 2719300..2719830 CDS 177 OmpH   ecoN21 comp 2768744..2770933 CDS 206 730 sensor comp 2771140..2771215 gcc 39 comp 2771255..2771330 gcc 220 2771551..2771910 CDS 120 pu-tr 120     ecoN22 comp 2772355..2773770 CDS 258 472 Glu ligase 2774029..2774104 gta 43 2774148..2774223 gta 46 2774270..2774345 gta 4 2774350..2774425 aaa 110 comp 2774536..2775420 CDS 295 LysR     ecoN23 comp 2959205..2960503 CDS 323 433 glutarate pm comp 2960827..2960942 5s 83 116 comp 2961026..2965477 23s 184 4452 comp 2965662..2965737 gaa 431 comp 2966169..2967720 16s 441 1552 comp 2968162..2970735 CDS 858 ClpB dep   ecoN24 ****atgi***** ecoN25 comp 3027207..3027773 CDS 280 189 fructose 6 comp 3028054..3028130 cgt 63 comp 3028194..3028270 cgt 62 comp 3028333..3028409 cgt 62 comp 3028472..3028548 cgt 64 comp 3028613..3028689 cgt 3 comp 3028693..3028785 agc 315 comp 3029101..3029286 CDS 62 CsrA   ecoN26 comp 3157337..3158434 CDS 208 366 murein 3158643..3158719 atgf 33 3158753..3158829 atgf 33 3158863..3158939 atgf 635 3159575..3160075 CDS 167 sscs VI   ecoN27 3230172..3231401 CDS 316 410 HAAAP comp 3231718..3231791 ggg 78 comp 3231870..3232625 CDS 252 glycan DD   ecoN28 3341048..3341755 CDS 105 236 DUF554 3341861..3341936 ttc 197 3342134..3343399 CDS 422 arm-type   ecoN29 comp 3569308..3569814 CDS 124 169 G/U 3569939..3570014 atgi 53 comp 3570068..3570832 CDS 255 ferric   ecoN30 comp 3670227..3670679 CDS 206 151 RimP comp 3670886..3670962 atgf 347 > 3671310..3672155 CDS 282 p-Arg-sc 282   ecoN31 comp 3673935..3674387 CDS 206 151 RimP comp 3674594..3674670 atgf 347 > 3675018..3675869 CDS 284 p-Arg-sc 284   ecoN32 comp 3677794..3678246 CDS 206 151 RimP comp 3678453..3678529 atgf 347 > 3678877..3679722 CDS 282 p-Arg-sc 282   ecoN33 comp 3681532..3681984 CDS 206 151 RimP comp 3682191..3682267 atgf 347 3682615..3683958 CDS 448 Arg-suc   ecoN34 comp 3683966..3685591 CDS 456 542 Pet comp 3686048..3686134 ctc 14 comp 3686149..3686481 CDS 111 SecG-p   ecoN35 3784553..3785311 CDS 62 253 pu-ABC comp 3785374..3785489 5s 39 116 comp 3785529..3785605 acc 14 comp 3785620..3785735 5s 777 116 comp 3786513..3786588 acc 14 comp 3786603..3786718 5s 1834 116 comp 3788553..3788628 gaa 1360 3789989..3790543 CDS 185 gc anhydrase         ecoN36 comp 4078635..4080242 CDS 743 536 DppA comp 4080986..4081062 ccg 91 comp 4081154..4082845 CDS 564 kdo2     ecoN37 comp 4205966..4207348 CDS 292 461 glycoside-p5 4207641..4207735 tga 300 > 4208036..4208857 CDS 274 p-DUF4102   ecoN38 comp 4338643..4339335 CDS 479 231 FadR tr 4339815..4341342 16s 73 1528 4341416..4341491 gaa 184 4341676..4344286 23s 83 2611 4344370..4344485 5s 53 116 4344539..4344615 gac 8 4344624..4344699 tgg 95 comp 4344795..4345634 CDS 280 HdfR HTH   ecoN39 4377681..4379066 CDS 102 462 aa permease 4379169..4379245 cgg 58 4379304..4379379 cac 20 4379400..4379486 ctg 42 4379529..4379605 cca 146 4379752..4380987 CDS 412 ans maturase   ecoN40 4460971..4461516 CDS 377 182 porphyrine M 4461894..4463631 16s 56 1738 4463688..4463764 atc 42 4463807..4463882 gca 165 4464048..4467338 23s 83 3291 4467422..4467537 5s 104 116 comp 4467642..4468169 CDS 176 Mlb pB     ecoN41 4605577..4606434 CDS 374 286 Glu race 4606809..4608362 16s 363 1554 4608726..4608801 gaa 1112 4609914..4610029 5s 136 116 4610166..4611194 CDS 343 UDP-N   ecoN42 comp 4612185..4613135 CDS 361 317 B5 kinase I 4613497..4613572 aca 8 4613581..4613665 tac 116 4613782..4613856 gga 6 4613863..4613938 acc 114 4614053..4615237 CDS 395 tuf   ecoN43 comp 4642984..4644573 CDS 616 530 AICAR2 4645190..4646378 16s’ 83 1189 4646462..4648150 CDS 436 563 kinase isocit 4648587..4648662 gaa 185 4648848..4651319 23s 83 2472 4651403..4651518 5s 76 116 4651595..4651978 CDS 128 hp-128   ecoN44 < comp 4834504..4834961 CDS 197 153 pu-integrase comp 4835159..4835234 ttc 106 comp 4835341..4835916 CDS 192 tr 192     ecoN45 4864628..4865173 CDS 210 182 oligo-rnase 4865384..4865459 ggc 36 4865496..4865571 ggc 35 4865607..4865682 ggc 233 4865916..4865969 CDS 18 hp-18   ecoN46 comp 4974178..4975197 CDS 195 340 NADPH- Ahr 4975393..4975477 ttg 39 <> comp 4975517..4976055 CDS 180 p-IS630         ecoN47 5042527..5042763 CDS 38 79 DUF1435 comp 5042802..5042888 ctg 34 comp 5042923..5043009 ctg 28 comp 5043038..5043124 ctg 290 comp 5043415..5044446 CDS 344 G1207 RsmC

E13. Clusters ecoN au-delà de eco ecoN suite sens gènes interca cdsa cds EcoN 48 comp 5079375..5079581 CDS 117 69 tr AlpA ok 5079699..5081218 16s 73 1520 5081292..5081368 gaa 12 5081381..5081454 gca 366 5081821..5082018 CDS 524 66 hp-66 comp 5082543..5082754 CDS 71 hp-71   eco1 222833..223408 cds 362 192 D-glycero 223771..225312 16s 68 1542 225381..225457 atc 42 225500..225575 gca 183 225759..228662 23s 93 2904 228756..228875 5s 52 120 228928..229004 gac 162 229167..229970 cds 268 metDkgB EcoN 56 comp > 5341397..5341492 CDS -2 32 ABC 32 ok comp 5341491..5344303 23s 174 2813 comp 5344478..5344553 gca 42 comp 5344596..5344672 atc 56 comp 5344729..5346282 16s 1063 1554 comp 5347346..5347421 gca 42 comp 5347464..5347540 atc 56 comp 5347597..5349150 16s 365 1554 comp 5349516..5350088 CDS 187 191 D-glycero > 5350276..5350914 CDS 213 ABC MetN eco35 eco 3422436..3423194 cds 228 253 pu-YhdZ comp 3423423..3423542 5s 37 120 comp 3423580..3423655 acc 12 comp 3423668..3423787 5s 92 120 comp 3423880..3426783 23s 174 2904 comp 3426958..3427033 gca 42 comp 3427076..3427152 atc 68 comp 3427221..3428762 16s 473 1542 3429236..3429790 cds 185 protein YrdA ecoN35 3784553..3785311 CDS 62 253 pu-ABC comp 3785374..3785489 5s 39 116 comp 3785529..3785605 acc 14 comp 3785620..3785735 5s 777 116 comp 3786513..3786588 acc 14 comp 3786603..3786718 5s 1834 116 comp 3788553..3788628 gaa 1360 3789989..3790543 CDS 185 gc anhydrase     EcoN 59 > 5433568..5433687 CDS 39 40 p-Nam ok comp 5433727..5433814 tcc 253 comp 5434068..5434286 CDS 73 tif IF-1                                                                                                                                   ecoN EcoN 53 comp 5321144..5321869 CDS 206 242 p-His kinase ok comp 5322076..5322151 gcc 39 comp 5322191..5322266 gcc 39 comp 5322306..5322381 gcc 220 5322602..5322961 CDS 120 pu-tr 120     ecoN EcoN 54 comp 5323406..5324821 CDS 258 472 Glu ligase ok 5325080..5325155 gta 44 5325200..5325275 gta 0 < 5325276..5325389 CDS 38 p-pu-tr 38                                                                                                                                                           EcoN 51 comp 5252659..5253870 CDS 300 404 Tyr recb 404 ok comp 5254171..5254249 tga 292 > 5254542..5255171 CDS 210 p-glycoside                   EcoN 52 > comp 5305902..5306228 CDS 0 109 p-hp comp 5306229..5306302 atc 1096 ecoN ? 5307399..5308450 CDS 351 p-Ada   EcoN 57 > comp 5359583..5360512 CDS 120 310 Tyr recb 310 comp 5360633..5360708 gca 42 ecoN40 comp 5360751..5360827 atc 56 comp 5360884..5362138 16s’ 1 1255 < comp 5362140..5363543 CDS 468 IS66   EcoN 55 > 5375524..5376270 CDS 891 249 p-AI-2E 5377162..5377237 gaa 1047 eco 435 ecoN ? comp 5378285..5379589 CDS 435 isocitrate   EcoN 49 comp 5090325..5090876 CDS 1808 184 MarR comp 5092685..5092760 gaa 588 ecoN ? < comp 5093349..5093474 CDS 592 42 sn-glycerol 5094067..5094142 gaa 1472 5095615..5095691 atc 42 5095734..5095809 atc 1130 5096940..5097015 gaa 1145 ok ecoN43 5098161..5098236 gaa 185 5098422..5100893 23s 83 2472 5100977..5101092 5s 76 116 5101169..5101552 CDS 63 128 hp-128 comp 5101616..5102059 CDS 148 transferase   EcoN 50 5124754..5125197 CDS 63 148 transferase comp 5125261..5125644 CDS 76 128 hp-128 ecoN40 comp 5125721..5125836 5s 83 116 comp 5125920..5128366 23s’ -10 2447 < 5128357..5128479 CDS 41 pilus                                                   EcoN 58 5425965..5426201 CDS 38 79 DUF1435 ok comp 5426240..5426325 ctg 26 comp 5426352..5426438 ctg 28 comp 5426467..5426553 ctg 63 < comp 5426617..5427150 CDS 178 p-IS630

ecoN eco noms cds

• Lien tableur: ecoN eco noms cds
• Légende

ecoN eco. Liste des noms longs et courts, et des fonctions

fonction	Noms courts	Noms longs
tr-regulator	XapR	DNA-binding transcriptional activator XapR
permease	aa permease	amino acid permease
ABC bind	ABC 32	ABC transporter ATP-binding protein
ABC bind	ABC MetN	methionine ABC transporter ATP-binding protein MetN
desaturase	acyl-CoA	acyl-CoA desaturase
adhesin	adhes YdhQ	adhesin-like autotransporter YdhQ
adhesin	adhes YejO	adhesin-like autotransporter YejO, gene fragment 2 of yejO, misc_feature
hydrolase	AICAR1	bifunctional AICAR transformylase/IMP cyclohydrolase
hydrolase	AICAR2	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
amidase	Ala C	N-acetylmuramoyl-L-alanine amidase C
maturase	ans maturase	anaerobic sulfatase maturase
synthetase	Arg-suc	argininosuccinate synthetase
integrase	arm-type	integrase arm-type DNA-binding domain-containing protein
synthetase	Asn B	asparagine synthetase B
protease b	ATP ClpA	ATP-dependent Clp protease ATP-binding subunit ClpA
kinase	B5 kinase	pantothenate kinase
kinase	B5 kinase I	type I pantothenate kinase
transporter	barrel	autotransporter outer membrane beta-barrel domain-containing protein
tr-regulator	CadC	DNA-binding transcriptional activator CadC
cardiolipin	cardiolipine	cardiolipin transport protein PbgA
transferase	CDP-diacyl	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
division	cell CpoB	cell division coordinator CpoB
chaperone	ClpB	ClpB chaperone
chaperone	ClpB dep	ATP-dependent chaperone ClpB
storage	Csr	carbon storage regulator
storage	CsrA	carbon storage regulator CsrA
hydrolase	cyclo FolD	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD
phosphatase	D-glycero	D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase
ABC bind	dip ABC	dipeptide ABC transporter periplasmic binding protein
polymerase	DNAIIIe	DNA polymerase III subunit epsilon
ABC bind	DppA	dipeptide ABC transporter substrate-binding protein DppA
DUF	DUF1435	DUF1435 domain-containing protein
DUF	DUF4102	DUF4102 domain-containing protein
DUF	DUF4942	DUF4942 domain-containing protein
DUF	DUF5507	DUF5507 domain-containing protein YpjC
DUF	DUF554	DUF554 domain-containing protein
DUF	DUF554 Yqg	DUF554 domain-containing protein YqgA
peptidase	ErfK	L,D-transpeptidase ErfK
exporter	exporter	FMN/FAD exporter
tr-regulator	FadR tr	FadR family transcriptional regulator
reductase	ferric	NADPH-dependent ferric chelate reductase
phosphatase	fructose	fructose-1-phosphatase
phosphatase	fructose 6	fructose-1-phosphate/6-phosphogluconate phosphatase
deformylase	fTHF	formyltetrahydrofolate deformylase
protase	FtsH	modulator of FtsH protease
protease	FtsH YccA	FtsH protease modulator YccA
glycosylase	G/U	G/U mismatch-specific DNA glycosylase
glycosylase	G/U station	stationary phase mismatch/uracil DNA glycosylase
transferase	G1207	16S rRNA m(2)G1207 methyltransferase
transferase	G1207 RsmC	16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC
anhydrase	gc anhydrase	gamma carbonic anhydrase family protein
ligase	Glu ligase	glutamate--tRNA ligase
racemase	Glu race	glutamate racemase
dehydrogenase	glu5dH	glutamate-5-semialdehyde dehydrogenase
reductase	gluDkgB	2,5-didehydrogluconate reductase DkgB
permease	glutarate pm	alpha-ketoglutarate permease
symporter	glutarate sm	alpha-ketoglutarate:H(+) symporter
peptidase	glycan DD	peptidoglycan DD-metalloendopeptidase family protein
synthetase	glycerolP	phosphatidylglycerophosphate synthase
transporter	glycoside-p5	glycoside-pentoside-hexuronide family transporter
reductase	glyoxyl A	glyoxylate/hydroxypyruvate reductase A
reductase	glyoxyl GhrA	glyoxylate/hydroxypyruvate reductase GhrA
permease	HAAAP	HAAAP family serine/threonine permease
tr-regulator	HdfR	DNA-binding transcriptional dual regulator HdfR
tr-regulator	HdfR HTH	HTH-type transcriptional regulator HdfR
hydrogenase	Hnase1	hydrogenase 1 small subunit
hp	hp-121	hp-121
hp	hp-128	hypothetical protein
hp	hp-18	hp-18
adhesin	Inv-adhesin	inverse autotransporter adhesin
transposase	IS66	IS66 family transposase
lyase	isocitrate	isocitrate lyase
transferase	kdo2	kdo(2)-lipid A phosphoethanolamine 7-transferase
kinase/Pase	kinase isocit	bifunctional isocitrate dehydrogenase kinase/phosphatase
prophage	KpLE1	CPS-53 (KpLE1) prophage; prophage CPS-53 integrase
lipoprotein	lipo YafT	lipoprotein YafT
tr-regulator	LysR	LysR family transcriptional regulator
tr-regulator	MarR	MarR family transcriptional regulator
reductase	metDkgB	methylglyoxal reductase DkgB
GDP	Mlb adapt	molybdopterin-guanine dinucleotide biosynthesis adaptor protein
GDP	Mlb pB	molybdopterin-guanine dinucleotide biosynthesis protein B
oxygenase	mono-O2	monooxygenase
titration	Mtf	Mlc titration factor
tr-regulator	MtfA	DgsA anti-repressor MtfA
glycosylase	murein	murein transglycosylase A
glycosylase	murein lytic	membrane-bound lytic murein transglycosylase A
reductase	NADPH- Ah	aldehyde reductase, NADPH-dependent
reductase	NADPH- Ahr	NADPH-dependent aldehyde reductase Ahr
transporter	nitrite	formate/nitrite transporter family protein
hydroxylase	octaprenyl	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
rnase	oligo-rnase	oligoribonuclease
protein	OmpH	OmpH family outer membrane protein
transferase	p-Ada	pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
transporter	p-AI-2E	pseudo, AI-2E family transporter
synthetase	p-Arg-sc 282	Pseudo, argininosuccinate synthase
synthetase	p-Arg-sc 284	Pseudo, argininosuccinate synthase
division	p-cell CpoB	Pseudo, cell division protein CpoB
DUF	p-DUF4102	Pseudo, DUF4102 domain-containing protein
transporter	p-glycoside	pseudo, glycoside-pentoside-hexuronide family transporter
kinase	p-His kinase	pseudo, histidine kinase
hp	p-hp	pseudo, hp 109
integrase	p-integrase	pseudo, integrase
transposase	p-IS4	Pseudo, IS4 family transposase
transposase	p-IS630	pseudo, IS630 family transposase
transporter	p-MATE	Pseudo, MATE family efflux transporter
transporter	p-MdtK	Pseudo, multidrug efflux MATE transporter MdtK
amidase	p-Nam	pseudo, nicotinamide-nucleotide amidase
tr-regulator	p-pu-tr 38	pseudo, putative DNA-binding transcriptional regulator
protein	p-un-YchS	putative uncharacterized protein YchS
gene	p-yicT	p-yicT
transferase	Pet	phosphoethanolamine transferase
protein	pilus	pilus assembly protein
dehydrogenase	porphyrine M	menaquinone-dependent protoporphyrinogen IX dehydrogenase
oxidase	porphyrine O	protoporphyrinogen oxidase
prophage	pp CP4-6	note="cryptic prophage CP4-6" misc_feature
prophage	pp CPS-53	cryptic prophage CPS-53, misc_feature
prophage	pp DLP12	note="cryptic prophage DLP12" misc_feature
prophage	pp PR-Y	cryptic prophage PR-Y
protein	protein YjjZ	protein YjjZ
protein	protein YrdA	protein YrdA
tr-regulator	pu- YfeC	putative DNA-binding transcriptional regulator YfeC
ABC bind	pu-ABC	amino acid ABC transporter ATP-binding protein
exporter	pu-arabi	putative arabinose exporter
sulfatase	pu-AslB	putative anaerobic sulfatase maturation enzyme AslB
cardiolipin	pu-cardiolip	putative cardiolipin transport protein
cytochrome	pu-cytochrom	putative cytochrome
hydrolase	pu-hydrolase	putative hydrolase, inner membrane
integrase	pu-KpLE2	KpLE2 phage-like element; putative integrase
peptidase	pu-LysM	LysM domain-containing putative peptidase lipoprotein YgeR
GMP	pu-sensor	putative c-di-GMP phosphodiesterase PdeA
protein	Pu-ssM	putative type II secretion system M-type protein
tr-regulator	pu-tr 120	putative DNA-binding transcriptional regulator
tr-regulator	pu-tr YieP	putative transcriptional regulator YieP
tr-regulator	pu-tr YjdC	putative DNA-binding transcriptional regulator YjdC
tr-regulator	pu-tr-YeeN	putative transcriptional regulator YeeN
protein	pu-unYgaQ	putative uncharacterized protein YgaQ
oxygenase	pu-YdhR	putative monooxygenase YdhR
ABC bind	pu-YhdZ	putative ABC transporter ATP-binding subunit YhdZ
transporter	pu-YicJ	putative xyloside transporter YicJ
transporter	pu-YifK	putative transporter YifK
prophage	put DLP12	DLP12 prophage; putative integrase
tr-regulator	put FimZ	putative LuxR family transcriptional regulator FimZ
synthetase	quino	quinolinate synthase
synthetase	quino NadA	quinolinate synthase NadA
ribosome	RimP	ribosome maturation factor RimP
rpt	rpt-29	rpt-29
rpt	rpt-34	rpt_type=other
rpt	rpt-36	rpt_type=other
rpt	rpt71	rpt_type=other 71
sRNA	RttR sRNA	small RNA RttR
translocase	SecE	Sec translocon subunit SecE
translocase	SecG-p	preprotein translocase subunit SecG
translocase	SecG-t	Sec translocon subunit SecG
esterase	sensor	sensor domain-containing phosphodiesterase
ABC bind	sn-glycerol	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB
protein	sscs VI	type VI secretion system contractile sheath small subunit
protein	stress	stress response protein
tr-regulator	tact Cbl	DNA-binding transcriptional activator Cbl
translation	tif IF-1	translation initiation factor IF-1
protein	tpr	protamine-like protein
tr-regulator	tr 192	transcriptional regulator
tr-regulator	tr AlpA	AlpA family transcriptional regulator
tr-regulator	tr-Cbl	HTH-type transcriptional regulator Cbl
tr-regulator	tr-Nac	DNA-binding transcriptional dual regulator Nac
tr-regulator	tr-nitrogen	nitrogen assimilation transcriptional regulator
tr-regulator	tr-YebC	YebC/PmpR family DNA-binding transcriptional regulator
transferase	transferase	acetyltransferase
transporter	trp-YeeO	toxic metabolite efflux MATE transporter YeeO
translation	tuf	elongation factor Tu
translation	tufb	tufb, translation elongation factor Tu 2
integrase	Tyr recb 207	tyrosine-type recombinase/integrase
integrase	Tyr recb 404	tyrosine-type recombinase/integrase
integrase	Tyr recb 421	tyrosine-type recombinase/integrase
integrase	Tyr recb 424	tyrosine-type recombinase/integrase
reductase	UDP-N	UDP-N-acetylenolpyruvoylglucosamine reductase
protein	un-YcdU	uncharacterized protein YcdU
protein	un-YjeV	uncharacterized protein YjeV
protein	UPF0149 YecA	UPF0149 family protein YecA
protein	YdiA	YdiA family protein
protein	YfdC	inner membrane protein YfdC
protein	YgeQ	protein YgeQ
gene	yjdQ	gene="yjdQ"
DUF	DUF1435	DUF1435 domain-containing protein
transposase	p-IS630	pseudo, IS630-like element IS630 family transposase

ecoN. Intergen51

Intergen51. ecoN. Le génome

• ecoN Le prélèvement: gama
• Le nom et le lien NCBI: ecoN, Escherichia coli Nissle 1917 chromosome, NCBI [71], date 11.5.21.
• ecoN La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
ecoN	646,219		5,441,200	11.9	

ecoN données intercalaires

• Lien tableur: ecoN données intercalaires
• Lien sauvegarde NCBI:gama

ecoN données intercalaires 200

• Lien tableur: données intercalaires 200.

ecoN autres intercalaires aas

• Lien tableur: ecoN autres intercalaires aas
• Lien sauvegarde NCBI:gama

Intergen51. ecoN. Les différents types d'intercalaires

• Lien au tableur: Intergen51. ecoN les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 ecoN les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 2,793 782 29 3,604 2.4 84 13 97 x 1,364 105 18 1,487 0 4 4 t 4,157 887 47 5,091 84 17 101 % 81.7 17.4 0.9

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 56 0 2 58 1.3 tRNA-CDS 104 48 x 46 0 0 46 RNA-RNA 84 39 t 102 0 2 104 CDS-rRNA 17 8 % 98.1 0.0 1.9 non RNA 12 6 - total 217 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 4.4 12.1 1.3 32.7 5.2 65 0.8 3.4 x 10.3 15.2 4.8 6.4 4.3 47 1.2 0.0

Intergen51. ecoN. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  ecoN présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	ecoN
R2	x3		x2		x		c		Inflexion poly3	x	c
0.561	1.45E-06	-8.87E-04	5.65E-02	35.30	fx1	abscisse	261.5	434.8
0.853	-6.60E-06	5.18E-03	-1.32E+00	119.0	fc1	ordonnée	15.7	5.2
								
0.784	-2.46E-06	1.93E-03	-5.54E-01	72.6	fx41			
0.959	-8.05E-07	1.05E-03	-4.48E-01	67.7	fc41					

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	ecoN		calculs			poly3	ecoN
effect	2822		R2.21	814		abscis	250
xm	37		pte	12,85		flexa	123
ym	10		cste	4,02		flexo	2,71
x1m	235		r400l	165		xm	35
y1m	1		restp	136,07		sup4	103,6
rfin	44,29		%sd	22,42		sup4t	327,4
bornf	116		lond	198		%	31,7
supd	112,3		%sf	25,49		long	88
supdt	500,7		lonf	79			
xmp	363,22		sf/lf	0,99			
r400	91,78		sr/lr	0,29			
supf	77,9		sd/ld	0,57			
supft	305,8		i.r400	0,56											

Intergen51. ecoN. Les CDS-CDS négatifs

Sous-totaux	ecoN			totale	
fréquence	x-	c-		x-	c-
 - 1		2	173		4	4140
 - 2		4	5		85	11
 - 3		2	0		3	12
 - 4		39	328		717	10938
 - 5		2	2		5	19
sp6		56	274		1642	8424
total		105	782		2,456	23,544
reste		5	10		264	420
s6		18	5		361	41
s7		10	51		321	1438
s8		23	208		696	6525
rappot s1-5						
4/2/1		9.75	1.9		8.4	2.6
% / sp6						
s6/sp6		32.1	1.8		22.0	0.5
s7/sp6		17.9	18.6		19.5	17.1
s8/sp6		41.1	75.9		42.4	77.5
reste/sp6	8.9	3.6		16.1	5.0
						
total s1-5	49	508		814	15120
% / total						
%s1-5		46.7	65.0		33.1	64.2
%sp6		53.3	35.0		66.9	35.8

Intergen51. ecoN. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		7			CDS 16s		6	2
16s 23s					5s CDS		5	2
16s tRNA	9			16 CDS			
tRNA 23s	7			CDS 5s			
5s tRNA		4			23s CDS		2	
tRNA in		4			CDS 23s			
tRNA contig	5			5s 16s			
tRNA hors	43			16s16s			
tRNA 16s		1						
23s tRNA								
tRNA 5s		4						
16s 5s								
5s 23s								
5s 5s								
total		84	0		total		13	4

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. ecoN. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. ecoN. Les intercalaires tRNA-tRNA extra bloc
• ecoN. Les intercalaires tRNA-tRNA contigus aux blocs

inter	aa
8	gac
**	tgg
1472	°gaa
42	°atc
2351	$atc
**	$gaa
42	gca
**	atc

Int51.31 ecoN. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa
37	cag		4	gtc		58	cgg
48	cag		**	gtc		20	cac
15	atgj		12	tta		42	ctg
34	caa		53	tgc		**	cca
23	caa		**	ggc		8	aca
10	cta		39	gcc		116	tac
**	atgj		**	gcc		6	gga
35	aaa		43	gta		**	acc
2	gta		46	gta		36	ggc
51	aaa		4	gta		35	ggc
3	gta		**	aaa		**	ggc
48	aaa		63	cgt		34	ctg
33	aaa		62	cgt		28	ctg
**	aaa		62	cgt		**	ctg
33	tac		64	cgt		39	gcc
**	tac		3	cgt		39	gcc
4	gtc		**	agc		**	gcc
**	gtc		33	atgf		44	gta
4	gtc		33	atgf		**	gta
**	gtc		**	atgf		28	ctg
						**	ctg

Vibrio campbellii

vha opérons

• Liens: gtRNAdb [72], NCBI chr1 [73], NCBI chr2 [74], génome [75]
• Lien tableur: vha opérons

vha1. Vibrio campbellii ATCC BAA-1116

45.4%GC	26.7.19 Paris	121	doubles	interca	cds	aa	avec aa	cdsa	cdsd
Chromosome I
comp	1..1384	16s	@1	103	103
comp	1488..1604	cds		102507				39
	104112..105239	cds		529	529			376	529
comp	105769..105845	atgf	+	158		158
comp	106004..106079	ggc	7 ggc	35		35
comp	106115..106190	ggc	5 atgf	35		35
comp	106226..106301	ggc		18		18
comp	106320..106396	atgf		39		39
comp	106436..106511	ggc		90		90
comp	106602..106678	atgf		39		39
comp	106718..106793	ggc		18		18
comp	106812..106888	atgf		39		39
comp	106928..107003	ggc		18		18
comp	107022..107098	atgf		39		39
comp	107138..107213	ggc		156	156				156
comp	107370..107915	cds		81764				182
	189680..190715	cds		101	101			345	101
comp	190817..190933	5s		107
comp	191041..193955	23s		290
comp	194246..194321	gca		43			43
comp	194365..194441	atc		97
comp	194539..196096	16s	@2	371
comp	196468..196584	5s		77
comp	196662..199576	23s		290
comp	199867..199942	gca		43			43
comp	199986..200062	atc		97
comp	200160..201717	16s		853	853				853
comp	202571..204706	cds		29595				712
comp	234302..235486	cds		101	101			395	101
comp	235588..235663	acc		13		13
comp	235677..235751	gga		35		35
comp	235787..235871	tac		52		52
comp	235924..235999	aca		206	206
	236206..237129	cds		4144				308
comp	241274..242467	cds		546	546			398	546
comp	243014..243090	tgg		68			68
comp	243159..243235	gac		32
comp	243268..243384	5s		117
comp	243502..246404	23s		310
comp	246715..246790	gta		30			30
comp	246821..246896	aaa		2			2
comp	246899..246974	gaa		122
comp	247097..248654	16s		554	554				554
	249209..249664	cds		60596				152
	310261..311296	cds		121	121			345	121
comp	311418..311508	tca		91
comp	311600..311716	5s		108
comp	311825..314739	23s		289
comp	315029..315104	gca		43			43
comp	315148..315224	atc		56
comp	315281..316842	16s		471	471				471
comp	317314..318027	cds		40242				238
	358270..359305	cds		147	147			345
comp	359453..359529	gac		31
comp	359561..359677	5s		108
comp	359786..362700	23s		310
comp	363011..363086	gta		30			30
comp	363117..363192	aaa		2			2
comp	363195..363270	gaa		82
comp	363353..364914	16s		83	83				83
comp	364998..365133	cds		84252				45
	449386..449521	cds		83	83			45	83
	449605..451162	16s		122
	451285..451360	gaa		2			2
	451363..451438	aaa		9			9
	451448..451523	gca		37			37
	451561..451636	gta		51	51				51
comp	451688..451873	cds		16	16			62	16
	451890..454804	23s		77
	454882..454998	5s		32
	455031..455107	gac		162	162
comp	455270..455533	cds		11718				88
comp	467252..467665	cds		361	361			138
	468027..468103	cgg		35		35
	468139..468214	cac		76		76
	468291..468367	cca		46		46
	468414..468489	cac		64		64
	468554..468630	cca		194	194				194
comp	468825..469550	cds		365688				242
comp	835239..835550	cds		138	138			104	138
comp	835689..835764	atgi		145	145
comp	835910..837772	cds		182191				621
	1019964..1020128	cds		119	119			55
	1020248..1021805	16s		129
	1021935..1022010	gcc		41			41
	1022052..1022127	gaa		55	55				55
comp	1022183..1022368	cds		16	16			62	16
	1022385..1025299	23s		111
	1025411..1025527	5s		31
	1025559..1025635	gac		35			35
	1025671..1025747	tgg		3	3				3
comp	1025751..1025933	cds		225465				61
	1251399..1252574	cds		158	158			392
comp	1252733..1252817	cta	+	54		54
comp	1252872..1252946	caa	5 cta	46		46
comp	1252993..1253077	cta	3 atgj	21		21
comp	1253099..1253183	cta	2 caa	18		18
comp	1253202..1253278	atgj		23		23
comp	1253302..1253386	cta		70		70
comp	1253457..1253533	atgj		79		79
comp	1253613..1253687	caa		31		31
comp	1253719..1253803	cta		39		39
comp	1253843..1253919	atgj		26	26				26
comp	1253946..1254157	cds		14564				71
comp	1268722..1268862	cds		260	260			47
	1269123..1269199	cca		243	243				243
comp	1269443..1269628	cds		16361				62
	1285990..1286571	cds		88	88			194
comp	1286660..1286736	agg		68	68				68
comp	1286805..1287938	cds		116753				378
comp	1404692..1405552	cds		204	204			287	204
	1405757..1405833	aga		244	244
	1406078..1407685	cds		49950				536
	1457636..1458508	cds		407	407			291
comp	1458916..1459000	tac	+	100		100
comp	1459101..1459185	tac	4 tac	100		100
comp	1459286..1459370	tac	@7	100		100
comp	1459471..1459555	tac		282	282				282
	1459838..1460935	cds		170368				366
	1631304..1631753	cds		144	144			150	144
	1631898..1631985	tcc		312	312
	1632298..1632684	cds		550413				129
	2183098..2183436	cds		179	179			113
	2183616..2183692	gtc	+	46		46
	2183739..2183815	gtc	2 gtc	149	149				149
	2183965..2185344	cds		578546				460
comp	2763891..2766782	cds		763	763			964	763
comp	2767546..2767621	ggc	+	11		11
comp	2767633..2767719	tta	2 ggc	78		78
comp	2767798..2767873	ggc		37		37
comp	2767911..2767984	tgc		400	400				400
comp	2768385..2768942	cds		82481				186
	2851424..2851855	cds		62	62			144	62
	2851918..2851992	gga		333	333
	2852326..2852970	cds		133282				215
comp	2986253..2986402	cds		1	1			50	1
	2986404..2986479	aac		372	372
	2986852..2989149	cds		60873				766
	3050023..3051831	cds		139	139			603	139
	3051971..3052061	tca		321	321
	3052383..3053693	cds		384243				437
comp	3437937..3438392	cds		233	233			152
comp	3438626..3438702	atgf		56		56
comp	3438759..3438842	ctc		18	18				18
comp	3438861..3439199	cds		113972				113
comp	3553172..3554167	cds		189	189			332	189
comp	3554357..3554433	cgt	+	59		59
comp	3554493..3554569	cgt	7 cgt	57		57
comp	3554627..3554703	cgt	2 agc	57		57
comp	3554761..3554837	cgt		57		57
comp	3554895..3554971	cgt		57		57
comp	3555029..3555105	cgt		85		85
comp	3555191..3555282	agc		29		29
comp	3555312..3555388	cgt		31		31
comp	3555420..3555511	agc		243	243
comp	3555755..3555952	cds		83212				66
	3639165..3640295	cds		108	108			377	108
	3640404..3640479	ttc	+	51		51
	3640531..3640606	aca	3 ttc	7		7
	3640614..3640689	ttc	2 aca	43		43
	3640733..3640808	aac	2 aac	69		69
	3640878..3640953	aca		10		10
	3640964..3641039	ttc		42		42
	3641082..3641158	aac		292	292
	3641451..3643076	cds		233	233			542
	3643310..3643385	ttc		51		51
	3643437..3643512	aca	+	21		21
	3643534..3643609	aac	2 aca	39		39
	3643649..3643724	aca	2 aac	15		15
	3643740..3643815	aac		156	156				156
comp	3643972..3645405	cds		561	561			478	561
comp	3645967..3646043	gac		31
comp	3646075..3646191	5s		57
comp	3646249..3646324	acc		100
comp	3646425..3646541	5s		111
comp	3646653..3649567	23s		-13	-13				-13
comp	3649555..3649797	cds	@3	35	35			81	35
comp	3649833..3649908	gca		43			43
comp	3649952..3650028	atc		97
comp	3650126..3651683	16s		557	557				557
comp	3652241..3653491	cds		9514				417
comp	3663006..3663598	cds		181	181			198
comp	3663780..3663864	ttg		177	177				177
comp	3664042..3664707	cds		93515				222
	3758223..3759258	cds		578	578			345	578
comp	3759837..3759913	gac		68
comp	3759982..3760098	5s		111
comp	3760210..3763124	23s		290
comp	3763415..3763490	gca		43			43
comp	3763534..3763610	atc		97
comp	3763708..3765265	16s		86
comp	3765351	16s	début
Chromosome II
comp	673782..674186	cds		358	358			135
comp	674545..674635	tca		329	329				329
	674965..675645	cds		205537				227
	881183..882640	cds		244	244			486	244
	882885..882958	tgc		302	302
	883261..883725	cds		1229				155
	884955..886649	cds		245	245			565	245
	886895..886981	tta		97		97
	887079..887154	ggc		5		5
	887160..887233	tgc		317	317
	887551..889074	cds		465				508
comp	889540..890328	cds		386	386			263
	890715..890801	tta	+	53		53
	890855..890928	tgc	2 tgc	181		181
	891110..891183	tgc		366	366				366
	891550..891891	cds		443950				114
	1335842..1336042	cds		17	17				17
	1336060..1336134	gga		272	272
comp	1336407..1337222	cds		505333				272
	1842556..1842741	cds		-36	-36			62	-36
	1842706..1842789	ctc		29	29				29
	1842819..1843430	cds		77699				204
	1921130..1921561	cds		62	62			144	62
	1921624..1921698	gga		337	337
comp	1922036..1922209	cds		15660				58
comp	1937870..1939129	cds		84	84			420
comp	1939214..1939304	tca		90
comp	1939395..1939511	5s		77
comp	1939589..1942503	23s		306
comp	1942810..1942885	gta		35			35
comp	1942921..1942996	gca		24			24
comp	1943021..1943096	aaa		2			2
comp	1943099..1943174	gaa		114
comp	1943289..1944850	16s		83	83				83
comp	1944934..1945071	cds						46

vha cumuls

• Lien tableur: vha cumuls
• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.vha. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

cumuls. Vibrio campbellii ATCC BAA-1116

opérons			Fréquences intercalaires tRNAs			Fréquences intercalaires cds				Fréquences aas cds
		effectif	gammes	sans rRNAs	avec rRNAs	gammes	cds	gammes	cdsd	gammes	cdsa
avec rRNA	opérons	11	1	0	0	1	3	1	1	100	17
	16 aas 23 5s	3	20	10	5	50	8	20	5	200	17
	16 atc gca	4	40	17	6	100	10	40	3	300	10
	16 cds 23 5s	3	60	16	6	150	12	60	2	400	13
	max a	5	80	6	1	200	9	80	3	500	6
	a doubles	0	100	6	0	250	9	100	3	600	4
	spéciaux	1	120	0	0	300	4	120	3	700	2
	total aas	37	140	0	0	350	7	140	3	800	2
sans	opérons	27	160	1	0	400	6	160	4	900	0
	1 aa	14	180	0	0	450	1	180	1	1000	1
	max a	12	200	1	0	500	1	200	2	1100	0
	a doubles	10		0	0		8		8		0
	total aas	84		57	18		78		38		72
total aas		121
remarques		3
avec jaune			moyenne		30						266
			variance		19						199
sans jaune			moyenne	46			183		86		240
			variance	25			114		59		178

vha tRNA-cds

• Note: intercalaires prélevés de la colonne cds de vha opérons dans un bloc de tRNAs uniquement. Le début du bloc est dans l'ordre des adresses, deb intercalaire entre le cds et le 1er tRNA dd bloc, fin entre le dernier tRNA et le cds terminal. J'ai procédé, dans les colonnes petit et grand, à la réorientation des blocs d'après la constatation que les blocs à rRNA ont leurs cds de début et de fin sont orientés du cds-16s au 5s-tRNAs-cds, l'intercalaire cds-16s étant plus grands que l'intercalaire avec le cds terminal. En tête de colonne est le % du nombre des intercalaires inférieurs à 201 pbs.

vha	56			37			22			70
deb	fin		deb	fin		grand	petit		grand	petit
-36	29		233	18		29	-36		29	-36
1	372		158	26		88	68		372	1
17	272		-36	29		145	138		272	17
62	333		88	68		158	26		233	18
62	337		138	145		179	149		158	26
88	68		179	149		181	177		333	62
101	206		233	156		206	101		337	62
108	292		529	156		233	18		88	68
138	145		181	177		233	156		206	101
139	321		361	194		243	189		292	108
144	312		101	206		244	204		145	138
158	26		189	243		260	243		321	139
179	149		260	243		272	17		312	144
181	177		204	244		292	108		179	149
189	243		17	272		302	244		233	156
204	244		407	282		312	144		529	156
233	18		108	292		317	245		181	177
233	156		244	302		321	139		243	189
244	302		144	312		333	62		361	194
245	317		245	317		337	62		244	204
260	243		139	321		358	329		260	243
358	329		358	329		361	194		302	244
361	194		62	333		372	1		317	245
386	366		62	337		386	366		407	282
407	282		386	366		407	282		358	329
529	156		1	372		529	156		386	366
763	400		763	400		763	400		763	400

• Comparaison cds-cds tRNA-cds: deb fin, c'est l'ordre des adresses et grand petit l'ordre après réorientation. Leur pourcentage est calculé par rapport à la colonne, c'est à dire la moitié du total des tRNA-cds.

gama	cds total	total	<0	0-200	201-370	371-600	>600	deb	fin	grand	petit
vha	5,432		54	1	24	23	5	1	14	10	6	18
‰				19	444	426	93	19	519	370	222	667

vha blocs

• Lien tableur: vha blocs

vha1. Vibrio campbellii ATCC BAA-1116, blocs à rRNA.

cds	853	cds	471	cds	103
16s	97	16s	56	16s	86
atc	43	atc	43	16s	97
gca	290	gca	289	atc	43
23s	77	23s	108	gca	290
5s	371	5s	91	23s	111
16s	97	tca	121	5s	68
atc	43	cds		gac	578
gca	290			cds
23s	107
5s	101
cds
cds	554	cds	83	cds	119
16s	122	16s	82	16s	129
gaa	2	gaa	2	gcc	41
aaa	30	aaa	30	gaa	55
gta	310	gta	310	cds	16
23s	117	23s	108	23s	111
5s	32	5s	31	5s	31
gac	68	gac	147	gac	35
tgg	546	cds		tgg	3
cds				cds
cds	83	cds	83	cds	557
16s	114	16s	122	16s	97
gaa	2	gaa	2	atc	43
aaa	24	aaa	9	gca	35
gca	35	gca	37	cds	-13
gta	306	gta	51	23s	111
23s	77	cds	16	5s	100
5s	90	23s	77	acc	57
tca	84	5s	32	5s	31
cds		gac	162	gac	561
		cds		cds

vha remarques

• A faire, en comparaison avec vpb
• Note du 4.10.20: contrôle des cds, 0/3 cds dans NCBI du 1.8.20

vha distribution

• Lien tableur: vha distribution
• Notes:

  - gtc2 cta2 tac4 tgc2 cgt6 ggc3

  - acc: 5s + >1aa

  - tca: 2 5s+ 2 1aa

  - gga: 1>a + 3 1aa

  - Séquences:

  (cac cca)2

  cgt5 (cgt agc)2

  ttc (aca aac)2

  (atgf ggc) ggc2 (atgf ggc)4

  ttc aca (ttc aac) aca (ttc aac)

Gm6 vha, Vibrio campbellii ATCC BAA-1116. gama

g1		t1
a atgi	1	a tct		tat		atgf	8
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	4	b tcc	1	tac	5	tgc	5
f atc	5	j acc	2	aac	5	agc	2
g ctc	2	f ccc		cac	2	cgt	7
h gtc	2	n gcc	1	gac	6	ggc	8
i tta	3	c tca	4	taa		tga
j ata		k aca	5	aaa	4	aga	1
k cta	5	g cca	3	caa	2	cga
l gta	4	o gca	7	gaa	5	gga	4
m ttg	1	d tcg		tag		tgg	2
n atgj	3	l acg		aag		agg	1
o ctg		h ccg		cag		cgg	1
p gtg		p gcg		gag		ggg
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
vha	70	14		11		26	121

vha1. Intergen51

Intergen51. vha1. Le génome

• vha1 Le prélèvement: gama
• Le nom et le lien NCBI: vha1, Vibrio campbellii ATCC BAA-1116 chromosome I, NCBI [76], date 12.12.21.
• vha1 La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
vha1	499,733		3,765,351	13.3	

vha1 données intercalaires

• Lien tableur: vha1 données intercalaires
• Lien sauvegarde NCBI: gama

vha1 données intercalaires 200

• Lien tableur: données intercalaires 200.

vha1 autres intercalaires aas

• Lien tableur: vha1 autres intercalaires aas
• Lien sauvegarde NCBI: gama

Intergen51. vha1. Les différents types d'intercalaires

• Lien au tableur: Intergen51. vha1 les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 vha1 les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 1,936 402 9 2,347 2.4 104 8 112 x 931 25 3 959 0 3 3 t 2,867 427 12 3,306 104 11 115 % 86.7 12.9 0.4

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 29 0 0 29 1.6 tRNA-CDS 47 25 x 18 0 0 18 RNA-RNA 104 55 t 47 0 0 47 CDS-rRNA 11 6 % 100.0 0.0 0.0 non RNA 28 15 - total 190 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 7.5 13.8 0.0 27.5 3.4 60 0.4 0.0 x 13.4 22.2 0.0 4.6 0.0 36 0.3 0.0

Intergen51. vha1. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  vha1 présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	vha1
R2	x3		x2		x		c		Inflexion poly3	x	c
0.625	4.79E-06	-3.09E-03	4.70E-01	15.50	fx1	abscisse	82.7	189.0
0.796	-5.34E-06	4.01E-03	-1.01E+00	96.9	fc1	ordonnée	40.9	20.1
								
0.736	8.54E-07	-2.12E-04	-1.61E-01	55.2	fx41			
0.929	1.23E-06	-7.00E-04	-8.87E-04	37.0	fc41			

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	vha1		calculs			poly3	vha1
effect	1945		R2.21	757		abscis	400
xm	45		pte	8,98		flexa	179
ym	5		cste	2,97		flexo	2,08
x1m	220		r400l	180		xm	43
y1m	1		restp	203,08		sup4	150,2
rfin	75,06		%sd	38,71		sup4t	407,2
bornf	158		lond	175		%	36,9
supd	181,5		%sf	39,67		long	136
supdt	468,9		lonf	113			
xmp	328,02		sf/lf	1,25			
r400	128,02		sr/lr	0,65			
supf	141,3		sd/ld	1,04			
supft	356,3		i.r400	0,71						

Intergen51. vha1. Les CDS-CDS négatifs

Sous-totaux	vha1			totale	
fréquence	x-	c-		x-	c-
 - 1		0	98		4	4140
 - 2		0	0		85	11
 - 3		0	2		3	12
 - 4		9	141		717	10938
 - 5		0	1		5	19
sp6		16	160		1642	8424
total		25	402		2,456	23,544
reste		0	0		264	420
s6		7	0		361	41
s7		1	27		321	1438
s8		8	133		696	6525
rappot s1-5						
4/2/1		-	1.4		8.4	2.6
% / sp6						
s6/sp6		43.8	0.0		22.0	0.5
s7/sp6		6.3	16.9		19.5	17.1
s8/sp6		50.0	83.1		42.4	77.5
reste/sp6	0.0	0.0		16.1	5.0
						
total s1-5	9	242		814	15120
% / total						
%s1-5		36.0	60.2		33.1	64.2
%sp6		64.0	39.8		66.9	35.8

Intergen51. vha1. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		9			CDS 16s		6	2
16s 23s					5s CDS			1
16s tRNA	9			16 CDS			
tRNA 23s	9			CDS 5s			
5s tRNA		8			23s CDS			
tRNA in		13			CDS 23s			
tRNA contig	2			5s 16s		1	
tRNA hors	53			16s16s		1	
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		104	0		total		8	3

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. vha1. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. vha1. Les intercalaires tRNA-tRNA extra bloc

contig	aa
68	tgg
**	gac
35	gac
**	tgg

Int51.31 vha1. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa
158	atgf		54	cta		59	cgt
35	ggc		46	caa		57	cgt
35	ggc		21	cta		57	cgt
18	ggc		18	cta		57	cgt
39	atgf		23	atgj		57	cgt
90	ggc		70	cta		85	cgt
39	atgf		79	atgj		29	agc
18	ggc		31	caa		31	cgt
39	atgf		39	cta		**	agc
18	ggc		**	atgj		51	ttc
39	atgf		100	tac		7	aca
**	ggc		100	tac		43	ttc
13	acc		100	tac		69	aac
35	gga		**	tac		10	aca
52	tac		46	gtc		42	ttc
**	aca		**	gtc		**	aac
35	cgg		11	ggc		51	ttc
76	cac		78	tta		21	aca
46	cca		37	ggc		39	aac
64	cac		**	tgc		15	aca
**	cca		56	atgf		**	aac
			**	ctc

vha2. Intergen51

Intergen51. vha2. Le génome

• vha2 Le prélèvement: gama
• Le nom et le lien NCBI: vha2, Vibrio campbellii ATCC BAA-1116 chromosome II, NCBI [77], date 12.12.21.
• vha2 La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
vha2	317,649		2,204,018	14.4		

vha2 données intercalaires

• Lien tableur: vha2 données intercalaires
• Lien sauvegarde NCBI: gama

vha2 données intercalaires 200

• Lien tableur: données intercalaires 200.

vha2 autres intercalaires aas

• Lien tableur: vha2 autres intercalaires aas
• Lien sauvegarde NCBI: gama

Intergen51. vha2. Les différents types d'intercalaires

• Lien au tableur: Intergen51. vha2 les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 vha2 les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 1,059 227 16 1,302 1.8 11 1 12 x 688 25 1 714 0 0 0 t 1,747 252 17 2,016 11 1 12 % 86.7 12.5 0.8

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 9 1 0 10 2.0 tRNA-CDS 15 45 x 5 0 0 5 RNA-RNA 11 33 t 14 1 0 15 CDS-rRNA 1 3 % 93.3 6.7 0.0 non RNA 6 18 - total 33 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 7.8 10.0 0.0 25.1 10.0 62 1.2 0.0 x 13.9 0.0 0.0 6.1 0.0 20 0.1 0.0

Intergen51. vha2. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  vha2 présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	vha2
R2	x3		x2		x		c		Inflexion poly3	x	c
0.661	4.10E-06	-2.65E-03	3.97E-01	17.80	fx1	abscisse	155.6	197,2	
0.763	-3.90E-06	3.05E-03	-8.11E-01	85.8	fc1	ordonnée	28.4	19,4
								
0.742	1.39E-06	-6.49E-04	-4.87E-02	46.5	fx41	
0.800	2,02E-06	-1,19E-03	9,37E-02	31.8	fc31		

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	vha2		calculs			poly3	vha2
effect	1075		R2.21	577		abscis	400
xm	35		pte	0,02		flexa	191
ym	1,08		cste	1,01		flexo	1,96
x1m	238		r400l	162		xm	35
y1m	1		restp	201,86		sup4	196,1
rfin	78,14		%sd	66,00		sup4t	448,4
bornf	158		lond	203		%	43,7
supd	343,8		%sf	70,46		long	156
supdt	520,9		lonf	123			
xmp	277,21		sf/lf	2,24			
r400	123,72		sr/lr	0,85			
supf	276,0		sd/ld	1,69			
supft	391,6		i.r400	0,76									

Intergen51. vha2. Les CDS-CDS négatifs

Sous-totaux	vha2			totale	
fréquence	x-	c-		x-	c-
 - 1		0	62		4	4140
 - 2		2	0		85	11
 - 3		0	0		3	12
 - 4		3	77		717	10938
 - 5		0	1		5	19
sp6		20	87		1642	8424
total		25	227		2,456	23,544
reste		0	0		264	420
s6		7	0		361	41
s7		1	12		321	1438
s8		12	75		696	6525
rappot s1-5						
4/2/1		1.5	1.2		8.4	2.6
% / sp6						
s6/sp6		35.0	0.0		22.0	0.5
s7/sp6		5.0	13.8		19.5	17.1
s8/sp6		60.0	86.2		42.4	77.5
reste/sp6	0.0	0.0		16.1	5.0
						
total s1-5	5	140		814	15120
% / total						
%s1-5		20.0	61.7		33.1	64.2
%sp6		80.0	38.3		66.9	35.8

Intergen51. vha2. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		1			CDS 16s		1	
16s 23s					5s CDS			
16s tRNA	1			16 CDS			
tRNA 23s	1			CDS 5s			
5s tRNA		1			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig				5s 16s			
tRNA hors	4			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s								
16s 5s								
5s 23s								
5s 5s								
total		11	0		total		1	0

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. vha2. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. vha2. Les intercalaires tRNA-tRNA extra bloc

hors b	aa
97	tta
5	ggc
**	tgc
53	tta
181	tgc°
**	tgc°

Aeromonas media WS

amed opérons

• Liens: gtRNAdb [78], NCBI [79], génome [80]
• Lien tableur: amed opérons

amed1. Aeromonas media WS

61.2%GC	25.7.19 Paris	126	doubles	interca	cds	aa	avec aa	cdsa	cdsd
	6590..7159	cds		3				190
comp	7163..8359	cds		512	512			399
	8872..10421	16s		66
	10488..10564	atc		10			10
	10575..10650	gca		231
	10882..13800	23s		98
	13899..14013	5s		386	386				386
	14400..14717	cds		102422				106
	117140..117850	cds		47	47			237	47
	117898..117973	ttc		52		52
	118026..118101	aca		3		3
	118105..118180	ttc		45		45
	118226..118301	aac		252	252
	118554..119573	cds		50489				340
comp	170063..170329	cds		103	103			89	103
comp	170433..170518	ctg	+	71		71
comp	170590..170675	ctg	5 ctg	46		46
comp	170722..170807	ctg		46		46
comp	170854..170939	ctg		51		51
comp	170991..171076	ctg		116	116
comp	171193..172653	cds		146173				487
	318827..320692	cds		190	190			622	190
	320883..320959	atgi		244	244
comp	321204..323780	cds		62601				859
	386382..386732	cds		514	514			117
	387247..388802	16s		268
	389071..389146	gaa		245
	389392..392312	23s		104
	392417..392531	5s		268	268				268
comp	392800..394413	cds		81847				538
	476261..476482	cds		64	64			74	64
comp	476547..476622	aac		5		5
comp	476628..476703	ttc		622	622
	477326..477547	cds		22721				74
	500269..500814	cds		177	177			182	177
	500992..501067	ggc	+	24		24
	501092..501167	ggc	6 ggc	29		29
	501197..501272	ggc		38		38
	501311..501386	ggc		25		25
	501412..501487	ggc		23		23
	501511..501586	ggc		363	363
comp	501950..502159	cds		4810				70
	506970..507110	cds		236	236			47	236
	507347..507422	gcc	+	28		28
	507451..507526	gcc	5 gcc	66		66
	507593..507668	gcc		58		58
	507727..507802	gcc		40		40
	507843..507918	gcc		471	471
	508390..508473	riboswitch	@1	134002				28
	642476..642802	cds		9	9			109	9
	642812..642896	ctc		91		91
	642988..643064	atgf		166	166
	643231..643689	cds		128528				153
	772218..774050	cds		195	195			611	195
comp	774246..774329	cta	+	8		8
comp	774338..774414	atg	3 atg	38		38
comp	774453..774527	caa	4 caa	47		47
comp	774575..774649	caa		17		17
comp	774667..774743	atg		35		35
comp	774779..774853	caa		47		47
comp	774901..774975	caa		13		13
comp	774989..775065	atg		235	235
comp	775301..776392	cds		3148				364
comp	779541..780557	cds		104	104			339	104
comp	780662..780736	caa		-21	-21				-21
comp	780716..781612	cds		373301				299
comp	1154914..1155384	cds		131	131			157	131
comp	1155516..1155592	ccc		226	226
comp	1155819..1157162	cds		67691				448
comp	1224854..1226290	cds		301	301			479
comp	1226592..1226667	aac		2		2
comp	1226670..1226744	gga		164	164				164
comp	1226909..1227181	cds		13604				91
comp	1240786..1241733	cds		350	350			316
comp	1242084..1242156	aac	+	2		2
comp	1242159..1242234	aac	2 aac	49	49				49
	1242284..1242496	cds		294				71
	1242791..1244527	cds		181	181			579	181
	1244709..1244796	tcc		407	407
	1245204..1246064	cds		161293				287
comp	1407358..1408338	cds		410	410			327
comp	1408749..1408836	tcc		177	177				177
comp	1409014..1409631	cds		34595				206
	1444227..1444688	cds		146	146			154
	1444835..1444922	tcc		127	127				127
	1445050..1446834	cds		14349				595
comp	1461184..1462401	cds		163	163			406	163
comp	1462565..1462640	cac		124		124
comp	1462765..1462838	aga		240	240
comp	1463079..1464389	cds		61984				437
comp	1526374..1527606	cds		151	151			411	151
comp	1527758..1527833	cac		123		123
comp	1527957..1528033	aga		36		36
comp	1528070..1528146	cca		203	203
	1528350..1529207	cds		60230				286
	1589438..1589644	cds		138	138			69
comp	1589783..1589858	aac		132	132				132
	1589991..1592003	cds		57434				671
	1649438..1651867	cds		104	104			810	104
comp	1651972..1652048	gtc	+	36		36
comp	1652085..1652161	gtc	5 gtc	26		26
comp	1652188..1652264	gtc		15		15
comp	1652280..1652356	gtc		11		11
comp	1652368..1652444	gtc		170	170
comp	1652615..1653994	cds		277443				460
comp	1931438..1932934	cds		145	145			499	145
comp	1933080..1933156	atgf	+	110		110
comp	1933267..1933343	atgf	9 atgf	102		102
comp	1933446..1933522	atgf	@2	101		101
comp	1933624..1933700	atgf		101		101
comp	1933802..1933877	atgf		103		103
comp	1933981..1934057	atgf		102		102
comp	1934160..1934236	atgf		102		102
comp	1934339..1934415	atgf		92		92
comp	1934508..1934584	atgf		268	268
comp	1934853..1935572	cds		490897				240
comp	2426470..2427675	cds		350	350			402
comp	2428026..2428112	tta		40		40
comp	2428153..2428226	tgc		35		35
comp	2428262..2428337	ggc		181	181				181
comp	2428519..2429073	cds		117921				185
comp	2546995..2547534	cds		271	271			180	271
	2547806..2547882	ccc		1103	1103
	2548986..2550593	cds		107760				536
	2658354..2659094	cds		87	87			247	87
	2659182..2659257	acg		108	108
< comp	2659366..2659705	cds		198821				113
comp	2858527..2859036	cds		126	126			170
	2859163..2859247	tac	+	30		30
	2859278..2859362	tac	2 tac	121	121				121
comp	2859484..2863335	cds		115303				1284
	2978639..2979358	cds		119	119			240	119
comp	2979478..2979552	gga		104		104
comp	2979657..2979730	ggg		201	201
	2979932..2981701	cds		41492				590
	3023194..3023487	cds		75	75			98	75
comp	3023563..3023636	tgc		57		57
comp	3023694..3023769	ggc		248	248
	3024018..3027455	cds		17375				1146
	3044831..3045361	cds		133	133			177	133
comp	3045495..3045584	tcg		380	380
	3045965..3046882	cds		221147				306
comp	3268030..3268398	cds		318	318			123
comp	3268717..3268804	tca		198	198				198
	3269003..3269752	cds		20717				250
	3290470..3291624	cds		50	50			385	50
	3291675..3291751	agg		126	126
comp	3291878..3292804	cds		41865				309
	3334670..3335758	cds		230	230			363
	3335989..3336073	tac	+	32		32
	3336106..3336190	tac	3 tac	45		45
	3336236..3336320	tac		135	135				135
	3336456..3336731	cds		169091				92
comp	3505823..3506272	cds		275	275			150	275
comp	3506548..3506662	5s		101
comp	3506764..3509682	23s		229
comp	3509912..3509987	gaa		218
comp	3510206..3511760	16s		592	592
	3512353..3515220	cds		161083				956
comp	3676304..3677323	cds		113	113			340
comp	3677437..3677521	ttg		49	49				49
	3677571..3678182	cds		9862				204
	3688045..3688872	cds		369	369			276
comp	3689242..3689318	cgt	+	25		25
comp	3689344..3689420	cgt	5 cgt	25		25
comp	3689446..3689522	cgt		26		26
comp	3689549..3689625	cgt		98		98
comp	3689724..3689800	cgt		4		4
comp	3689805..3689897	agc		213	213				213
comp	3690111..3690299	cds		196546				63
	3886846..3887601	cds		302	302			252	302
comp	3887904..3887980	gac		98
comp	3888079..3888193	5s		105
comp	3888299..3891217	23s		231
comp	3891449..3891524	gca		10			10
comp	3891535..3891611	atc		66
comp	3891678..3893232	16s		420	420
comp	3893653..3894195	cds		18750				181
comp	3912946..3913317	cds		60	60			124
comp	3913378..3913454	tgg		52	52				52
comp	3913507..3914691	cds	@3	171	171			395	171
comp	3914863..3914937	gga		38		38
comp	3914976..3915060	tac		263	263
	3915324..3916262	cds		45900				313
comp	3962163..3963533	cds		306	306			457
comp	3963840..3963916	tgg		202	202				202
	3964119..3964703	cds		59641				195
comp	4024345..4026816	cds		658	658			824
comp	4027475..4027551	ccg		140	140				140
comp	4027692..4028417	cds		80995				242
	4109413..4111986	cds		99	99			858
comp	4112086..4112200	5s		101
comp	4112302..4115220	23s		231
comp	4115452..4115527	gaa		192
comp	4115720..4117273	16s		94	94				94
comp	4117368..4117547	cds		32227				60
comp	4149775..4150248	cds		204	204			158	204
comp	4150453..4150529	cca		58		58
comp	4150588..4150673	ctg		20		20
comp	4150694..4150769	cac		49		49
comp	4150819..4150895	cgg		258	258
	4151154..4151744	cds		74862				197
	4226607..4227725	cds		428	428			373
	4228154..4229708	16s		192
	4229901..4229976	gaa		229
	4230206..4233124	23s		104
	4233229..4233343	5s		106
	4233450..4233525	acc		23
	4233549..4233663	5s		164	164				164
	4233828..4234793	cds		119351				322
comp	4354145..4355686	cds		622	622			514
	4356309..4357863	16s		268
	4358132..4358207	gaa		230
	4358438..4361364	23s		102
	4361467..4361581	5s		106
	4361688..4361763	acc		233	233				233
	4361997..4363241	cds		71363				415
	4434605..4435198	cds		465	465			198
	4435664..4437217	16s		219
	4437437..4437512	gaa		229
	4437742..4440657	23s		103
	4440761..4440875	5s		98
	4440974..4441050	gac		167	167				167
	4441218..4442054	cds		39919				279
comp	4481974..4482513	cds		477	477			180
	4482991..4484545	16s		513
	4485059..4485549	23s°		37
comp	4485587..4486115	23s°		229
comp	4486345..4486419	gaa		218
comp	4486638..4488193	16s		94	94				94
comp	4488288..4488509	cds		72132				74
comp	4560642..4561676	cds		192	192			345
comp	4561869..4561944	gta	+	18		18
comp	4561963..4562038	aaa	7 gta	34		34
comp	4562073..4562148	gta	5 aaa	18		18
comp	4562167..4562242	aaa	2 aag	23		23
comp	4562266..4562341	gta		18		18
comp	4562360..4562435	aaa		23		23
comp	4562459..4562534	gta		18		18
comp	4562553..4562628	aaa		34		34
comp	4562663..4562738	gta		22		22
comp	4562761..4562836	aag		46		46
comp	4562883..4562958	gta		22		22
comp	4562981..4563056	aag		46		46
comp	4563103..4563178	gta		32		32
comp	4563211..4563286	aaa		174	174				174
comp	4563461..4564276	cds		70895				272
comp	4635172..4636173	cds		275	275			334	275
comp	4636449..4636525	gac		95
comp	4636621..4636735	5s		101
comp	4636837..4639756	23s		231
comp	4639988..4640063	gca		10			10
comp	4640074..4640150	atc		66
comp	4640217..4641771	16s		512	512
	4642284..4643480	cds		3				399
comp	4643484..4644053	cds						190

amed cumuls

• Lien tableur: amed cumuls
• Note: Les statistiques sur les intercalaires entre tRNA ne sont pas correctes. Se reporter à intergen51.amed. Il n'y a aucun commentaire sur les CDS. J'ai réduit le tableau aux clusters à rRNA. L'intitulé opéron doit d'être compris dans le sens cluster ou bloc de RNA, rRNA ou tRNA.

cumuls. Aeromonas media WS

opérons			Fréquences intercalaires tRNAs			Fréquences intercalaires cds				Fréquences aas cds
		effectif	gammes	sans rRNAs	avec rRNAs	gammes	cds	gammes	cdsd	gammes	cdsa
avec rRNA	opérons	10	1	0	-	1	1	40	1	100	14
	16 gaa 23 5s	6	20	15		50	5	60	5	200	21
	16 atc gca	3	40	27		100	8	80	2	300	15
	16 23 5s	0	60	14		150	19	100	3	400	18
	max a	3	80	2		200	17	120	4	500	11
	a doubles	0	100	3		250	13	140	7	600	6
	spéciaux	1	120	8		300	8	160	2	700	3
	total aas	18	140	2		350	6	180	8	800	0
sans	opérons	38	160	0		400	4	200	5	900	4
	1 aa	16	180	0		450	4	220	3	1000	1
	max a	14	200	0		500	3	240	2	1100	0
	a doubles	12		0			8		6		2
	total aas	109		71	0		96		48		95
total aas		127
remarques		3
avec jaune			moyenne	49					156
			variance	34					77
sans jaune			moyenne				214				274
			variance				122				157

amed blocs

• Lien tableur: amed blocs

A1. Aeromonas media WS, blocs à rRNA.

cds	512	cds	302	cds	275
16s	66	gac	98	gac	95
atc	10	5s	105	5s	101
gca	231	23s	231	23s	231
23s	98	gca	10	gca	10
5s	386	atc	66	atc	66
		16s	420	16s	512
cds	514	275	99
16s	268	101	101
gaa	245	229	231
23s	104	218	192
5s	268	592	94
cds	428	cds	622	cds	465
16s	192	16s	268	16s	219
gaa	229	gaa	230	gaa	229
23s	104	23s	102	23s	103
5s	106	5s	106	5s	98
acc	23	acc	233	gac	167
5s	164

amed remarques

• A faire

amed distribution

• Lien tableur: amed distribution
• Notes:

  - gtc5 ctg5 gcc5 tac3+2 aac2 caa2+2 atgf9 cgt5 ggc6

  - Séquences

  (atgj caa2)2

  (gta aaa)4 (gta aag)2 gta aaa

Gm7 amed, Aeromonas media WS. gama

g1		t1
a atgi	1	a tct		tat		atgf	10
b att		i act		aat		agt
c ctt		e cct		cat		cgc
d gtt		m gct		gat		ggt
e ttc	3	b tcc	3	tac	6	tgc	2
f atc	3	j acc	2	aac	6	agc	1
g ctc	1	f ccc	2	cac	3	cgt	5
h gtc	5	n gcc	5	gac	3	ggc	8
i tta	1	c tca	1	taa		tga
j ata		k aca	1	aaa	5	aga	2
k cta	1	g cca	2	caa	5	cga
l gta	7	o gca	3	gaa	7	gga	3
m ttg	1	d tcg	1	tag		tgg	2
n atgj	3	l acg	1	aag	2	agg	1
o ctg	6	h ccg	1	cag		cgg	1
p gtg		p gcg		gag		ggg	1
gama	>1aa	=1aa	-5s	+5s	-16s	+16s	total
amed	93	16		5		13	127

amed autres intercalaires

• Lien tableur: amed autres intercalaires
• Voir la méthode pour le formatage des autres intercalaires

amed. Intergen51

Intergen51. amed. Le génome

• amed Le prélèvement: alpha gama
• Le nom et le lien NCBI: amed, Aeromonas media WS chromosome, NCBI [81], date 15.1.22.
• amed La longueur totale des intercalaires, longueur du génome et taux intercalaires/génome:

Nom	intercals	génome		taux en %			
amed	601,332		4,777,154	12.6

amed données intercalaires

• Lien tableur: amed données intercalaires
• Lien sauvegarde NCBI:alpha gama

amed données intercalaires 200

• Lien tableur: données intercalaires 200.

amed autres intercalaires aas

• Lien tableur: amed autres intercalaires aas
• Lien sauvegarde NCBI:alpha gama

Intergen51. amed. Les différents types d'intercalaires

• Lien au tableur: Intergen51. amed les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

Int51.2 amed les différents types d'intercalaires entre gène

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 2,370 444 12 2,826 2.0 106 8 114 x 1,341 42 2 1,385 0 8 8 t 3,711 486 14 4,211 106 16 122 % 88.1 11.5 0.3

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 53 1 0 54 2.2 tRNA-CDS 79 33 x 25 0 0 25 RNA-RNA 106 44 t 78 1 0 79 CDS-rRNA 16 7 % 98.7 1.3 0.0 non RNA 38 16 - total 239 100

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - type S+ R+ S- S+ R+ S- S+ R+ c 4.6 11.1 1.4 21.1 1.9 68 0.4 0.0 x 8.2 4.0 9.5 6.0 0.0 21 0.1 0.0

Intergen51. amed. Les diagrammes CDS-CDS positifs

• Lien tableur: Les diagrammes
• Diagrammes des gamma:  amed présente 2 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41	amed
R2	x3		x2		x		c		Inflexion poly3	x	c
0.603	4.21E-06	-2.73E-03	3.91E-01	23.20	fx1	abscisse	366.7	185.9
0.856	-1.07E-06	1.09E-03	-4.42E-01	71.9	fc1	ordonnée	7.2	23.7
								
0.777	-1.00E-06	1.10E-03	-4.62E-01	78.0	fx41			
0.902	2.15E-06	-1.20E-03	-4.04E-02	43.9	fc41			

• Moyennes glissantes fc+400, diagonale. Voir le détail des calculs dans abs.

données	amed		calculs			poly3	amed
effect	2382		R2.21	760		abscis	400
xm	45		pte	10,48		flexa	162
ym	7		cste	3,41		flexo	2,68
x1m	230		r400l	170		xm	45
y1m	1		restp	166,67		sup4t	150,3
rfin	45,76		%sd	39,58		sup4t	447,5
bornf	138		lond	185		%	33,6
supd	224,2		%sf	41,00		long	117
supdt	566,3		lonf	93			
xmp	267,00		sf/lf	1,68			
r400	120,91		sr/lr	0,74			
supf	155,9		sd/ld	1,21			
supft	380,4		i.r400	0,71									

Intergen51. amed. Les CDS-CDS négatifs

Sous-totaux	amed			totale	
fréquence	x-	c-		x-	c-
 - 1		0	91		4	4140
 - 2		1	0		85	11
 - 3		0	0		3	12
 - 4		8	212		717	10938
 - 5		0	0		5	19
sp6		33	141		1642	8424
total		42	444		2,456	23,544
reste		4	6		264	420
s6		8	0		361	41
s7		9	33		321	1438
s8		12	102		696	6525
rappot s1-5						
4/2/1		8	2.3		8.4	2.6
% / sp6						
s6/sp6		24.2	0.0		22.0	0.5
s7/sp6		27.3	23.4		19.5	17.1
s8/sp6		36.4	72.3		42.4	77.5
reste/sp6	12.1	4.3		16.1	5.0
						
total s1-5	9	303		814	15120
% / total						
%s1-5		21.4	68.2		33.1	64.2
%sp6		78.6	31.8		66.9	35.8

Intergen51. amed. Les intercalaires des blocs

• Le détail

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		9			CDS 16s		5	6
16s 23s					5s CDS		3	2
16s tRNA	10			16 CDS			
tRNA 23s	9			CDS 5s			
5s tRNA		5			23s CDS			
tRNA in		3			CDS 23s			
tRNA contig				5s 16s			
tRNA hors	69			16s16s			
tRNA 16s								
23s tRNA								
tRNA 5s		1						
16s 5s								
5s 23s								
5s 5s								
total		106	0		total		8	8

• Les rares voir gamma pour la longueur des intercalaires
• Les tRNA-CDS compris, comparaison dans le clade et dans l'étude.

Intergen51. amed. Les intercalaires tRNA-tRNA extra bloc

• Lien tableur: Intergen51. amed. Les intercalaires tRNA-tRNA extra bloc

Int51.31 amed. Les intercalaires tRNA-tRNA hors blocs

inter	aa		inter	aa		inter	aa		inter	aa		inter	aa
52	ttc		28	gcc		36	gtc		30	tac		58	cca
3	aca		66	gcc		26	gtc		**	tac		20	ctg
45	ttc		58	gcc		15	gtc		104	gga		49	cac
**	aac		40	gcc		11	gtc		**	ggg		**	cgg
71	ctg		**	gcc		**	gtc		57	tgc		18	gta
46	ctg		91	ctc		110	atgf		**	ggc		34	aaa
46	ctg		**	atgf		102	atgf		32	tac		18	gta
51	ctg		8	cta		101	atgf		45	tac		23	aaa
**	ctg		38	atgj		101	atgf		**	tac		18	gta
5	aac		47	caa		103	atgf		25	cgt		23	aaa
**	ttc		17	caa		102	atgf		25	cgt		18	gta
24	ggc		35	atgj		102	atgf		26	cgt		34	aaa
29	ggc		47	caa		92	atgf		98	cgt		22	gta
38	ggc		13	caa		**	atgf		4	cgt		46	aag
25	ggc		**	atgj		40	tta		**	agc		22	gta
23	ggc		2	aac		35	tgc		38	gga		46	aag
**	ggc		**	gga		**	ggc		**	tac		32	gta
			123	cac								**	aaa
			36	aga
			**	cca

gamma synthèse

• Liens aux indices des clades: alpha bacilli   gamma actino clostridia bacteroide   cyano tener spiro   beta epsilon delta   bactéries
• Liens aux fiches:   spiro    tener    gama    alpha    beta    delta    epsilon    bacilli    clostridia    autres firmicutes    actino    bactero    cyano    archeo

gamma distribution par génome

• Lien tableur: gamma distribution par génome

gamma. distribution par génome

gama	>1aa	1aa	-5s	+5s	-16s	+16s	duplica	1-3aas	total
spl	46	8				6	79	3	142
vpb	60	11				21	22	12	126
vha	51	14				26	19	11	121
amed	47	16				13	46	5	127
eal	25	23				10	23	4	85
eco	20	23				10	29	4	86
ecoN	20	34				17	44	6	121
total	269	129	0	0	0	103	262	45	808

gamma distribution du total

• Lien tableur: gamma distribution du total
• Notes: dans le tableau de droite gaa comprend 33 +16s et 1 +5s.
• Légende:

  - Couleurs du 1er tableau: voir bacilli

  - Couleurs du 2ème tableau: d'après les couleurs du pieds du tableau

  - Tableau des indices, en-tête: total des génomes, total des tRNAs, indice ttt, indice tgt.

Gamma. Distribution du total.

gamma. Distribution du total sans +16s +5s g1    t1          a atgi 11 a tct tat atgf 48 b att i act aat agt c ctt e cct cat cgt d gtt m gct gat ggt e ttc 21 b tcc 14 tac 30 tgc 18 f atc 3 j acc 6 aac 34 agc 11 g ctc 9 f ccc 6 cac 12 cgc 40 h gtc 21 n gcc 16 gac 7 ggc 46 i tta 14 c tca 12 taa tga 4 j ata k aca 19 aaa 33 aga 10 k cta 24 g cca 14 caa 23 cga l gta 34 o gca gaa 17 gga 14 m ttg 7 d tcg 4 tag tgg 4 n atgj 19 l acg 4 aag 2 agg 7 o ctg 21 h ccg 4 cag 6 cgg 7 p gtg p gcg gag ggg 4 gama7 >1aa 1aa -5s +5s -16s +16s total type 531 129 0 0 0 0 660

gamma. Distribution du total. +16s +5s (1-3aas) g1    t1          a atgi a tct tat atgf 0 b att i act aat agt c ctt e cct cat cgt d gtt m gct gat ggt e ttc b tcc tac tgc f atc 23 j acc 9 aac agc g ctc f ccc cac cgc h gtc n gcc 2 gac 23 ggc i tta c tca 4 taa tga j ata k aca aaa 8 aga k cta g cca caa cga l gta 8 o gca 29 gaa 34 gga m ttg d tcg tag tgg 8 n atgj l acg aag agg o ctg h ccg cag cgg p gtg p gcg gag ggg gama7 >1aa 1aa -5s +5s -16s +16s total type 45 103 148

gamma. indices du 27.5.20 1183 génomes g1 t1 1183 86713 1,5  0 a atgi 130 a tct 1,7 tat 1,3 atgf 292 b att 0,1 i act 0,5 aat 0,2 agt c ctt 0,9 e cct cat cgc d gtt 0,5 m gct gat ggt 0,5 e ttc 175 b tcc 152 tac 227 tgc 114 f atc 285 j acc 155 aac 311 agc 106 g ctc 102 f ccc 86 cac 115 cgt 298 h gtc 173 n gcc 167 gac 289 ggc 351 i tta 120 c tca 140 taa 1,0 tga 64 j ata 0,8 k aca 141 aaa 377 aga 151 k cta 128 g cca 141 caa 189 cga 13 l gta 321 o gca 283 gaa 324 gga 114 m ttg 103 d tcg 83 tag 2,7 tgg 113 n atgj 170 l acg 71 aag 24 agg 110 o ctg 252 h ccg 62 cag 102 cgg 100 p gtg 8,3 p gcg 6,9 gag 7,6 ggg 72 inter max min total

gamma distribution par type

• Lien tableur: gamma distribution par type
• Légende: voir bacilli

Gamma. Distribution par type.

gamma. distribution des solitaires g1    t1           a atgi 9 a tct tat atgf 6 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 7 b tcc 14 tac tgc 1 f atc 1 j acc 1 aac 14 agc g ctc 5 f ccc 6 cac cgt h gtc n gcc gac 3 ggc i tta c tca 10 taa tga 4 j ata k aca aaa aga 6 k cta g cca 2 caa 1 cga l gta o gca gaa 4 gga 4 m ttg 7 d tcg 4 tag tgg 2 n atgj l acg 4 aag agg 7 o ctg h ccg 4 cag cgg p gtg p gcg gag ggg 3 gama7 1aa 129

gamma. distribution du type >1aa sans duplicata. g1    t1           a atgi 2 a tct tat atgf 18 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 14 b tcc tac 6 tgc 15 f atc j acc 5 aac 11 agc 11 g ctc 4 f ccc cac 12 cgt 2 h gtc 2 n gcc 2 gac ggc 17 i tta 14 c tca taa tga j ata k aca 19 aaa 15 aga 4 k cta 18 g cca 10 caa 12 cga l gta 13 o gca gaa gga 10 m ttg d tcg tag tgg n atgj 19 l acg aag 2 agg o ctg 4 h ccg cag cgg 7 p gtg p gcg gag ggg 1 gama7 >1aa 269

gamma. distribution du type duplicata g1    t1           a atgi a tct tat atgf 24 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc b tcc tac 24 tgc 2 f atc 2 j acc aac 9 agc g ctc f ccc cac cgt 38 h gtc 19 n gcc 14 gac 4 ggc 29 i tta c tca 2 taa tga j ata k aca aaa 18 aga k cta 6 g cca 2 caa 10 cga l gta 21 o gca gaa 13 gga m ttg d tcg tag tgg 2 n atgj l acg aag agg o ctg 17 h ccg cag 6 cgg p gtg p gcg gag ggg gama7 dupli 262

gamma par rapport au groupe de référence

• Lien tableur: gamma par rapport au groupe de référence
• Le groupe de référence: voir la référence
• Légende:

  - carré ccc, c'est ctc gtc ccc gcc

  - g+cga, c'est gtg xcg xag ggg cga (dans l'hypothèse de la bascule des cgx, cgt/cgc cga/cgg)

Comparaison avec la référence

tRNAs		blocs tRNAs			blocs rRNAs
	gama7	1aa	>1aa	dup	+5s	1-3aas	autres	total
21	faible	37	18	39			2	96
16	moyen	51	104	31		21	52	259
14	fort	41	147	192		24	49	453
		129	269	262		45	103	808
10	g+cga	15	3	6				24
2	agg+cgg	7	7					14
4	carre ccc	11	8	33			2	54
5	autres	4						4
		37	18	39			2	96
		total tRNAs ‰
	gama7	1aa	>1aa	dup	+5s	1-3aas	autres	gama ‰	ref.‰
21	faible	46	22	48			2	119	26
16	moyen	63	129	38		26	64	321	324
14	fort	51	182	238		30	61	561	650
		160	333	324		56	127	808	729
10	g+cga	19	4	7				30	10
2	agg+cgg	9	9					17
4	carre ccc	14	10	41			2	67	16
5	autres	5						5
		46	22	48			2	119
		blocs tRNAs ‰					total colonne %
	gama7	1aa	>1aa	dup	total	ref.‰	1aa	>1aa	dup
21	faible	56	27	59	142	26	29	7	15
16	moyen	77	158	47	282	324	40	39	12
14	fort	62	223	291	576	650	32	55	73
		195	408	397	660	729	129	269	262
10	g+cga	23	5	9	36	10	41		15
2	agg+cgg	11	11		21		19
4	carre ccc	17	12	50	79	16	30		85
5	autres	6			6		11
		56	27	59	142		37		39

gamma, estimation des -rRNAs

• Lien tableur: gamma, estimation des -rRNAs
• Liens fiche:   typage
• Légende: prélèvement de la base gtRNAdb le 22.1.21

  - ttt et tgt sont nuls partout

  - atgi, c'est Ile2, mis à la place de ttt, très rare chez les procaryotes.

  - atgf, c'est Metf, mis à la place de tgt, très rare chez les procaryotes.

  - atgj, c'est Met, remplace le atg standard qui est la somme Ile2 Met fMet.

  - Voir la légende des tris, g1 t1 et des couleurs

gamma, calcul des -rRNAs

• Lien tableur: gamma, calcul des -rRNAs

gam gamma 144 génomes

gam1 cumul des +rRNAs de la fiche gamma pour 144 génomes g1    t1          a atgi a tct tat atgf 3 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 3 b tcc tac 1 tgc f atc 373 j acc 57 aac agc 3 g ctc f ccc cac 10 cgt h gtc n gcc 3 gac 151 ggc i tta 1 c tca 3 taa tga j ata k aca aaa 13 aga k cta g cca 14 caa cga l gta 14 o gca 378 gaa 423 gga m ttg 1 d tcg tag tgg 73 n atgj 1 l acg aag agg o ctg h ccg cag cgg 11 p gtg p gcg gag ggg gama144 inter max min total 900 622 14 1536	gam2 indices du clade gamma du 27.5.20 de gtRNAdb pour 100 génomes g1    t1     1183 1.5  0 a atgi 130 a tct 1.7 tat 1.3 atgf 292 b att 0.1 i act 0.5 aat 0.2 agt c ctt 0.9 e cct cat cgc d gtt 0.5 m gct gat ggt 0.5 e ttc 175 b tcc 152 tac 227 tgc 114 f atc 285 j acc 155 aac 311 agc 106 g ctc 102 f ccc 86 cac 115 cgt 298 h gtc 173 n gcc 167 gac 289 ggc 351 i tta 120 c tca 140 taa 1.0 tga 64 j ata 0.8 k aca 141 aaa 377 aga 151 k cta 128 g cca 141 caa 189 cga 13 l gta 321 o gca 283 gaa 324 gga 114 m ttg 103 d tcg 83 tag 2.7 tgg 113 n atgj 170 l acg 71 aag 24 agg 110 o ctg 252 h ccg 62 cag 102 cgg 100 p gtg 8.3 p gcg 6.9 gag 7.6 ggg 72 gtRNA inter max min total 2517 3550 1254 7321	gam3 cumul des -rRNAs de l'annexe gamma 7 génomes g1    t1          a atgi 11 a tct tat atgf 48 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 21 b tcc 14 tac 30 tgc 18 f atc 3 j acc 6 aac 34 agc 11 g ctc 9 f ccc 6 cac 12 cgt 40 h gtc 21 n gcc 16 gac 7 ggc 46 i tta 14 c tca 12 taa tga 4 j ata k aca 19 aaa 33 aga 10 k cta 24 g cca 14 caa 23 cga l gta 34 o gca gaa 17 gga 14 m ttg 7 d tcg 4 tag tgg 4 n atgj 19 l acg 4 aag 2 agg 7 o ctg 21 h ccg 4 cag 6 cgg 7 p gtg p gcg gag ggg 4 gama7 inter max min total 186 380 94 660
gam4 indices des +rRNAs de la fiche gamma pour 100 génomes g1    t1          a atgi a tct tat atgf 2 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 2 b tcc tac 1 tgc 18 f atc 259 j acc 40 aac agc 2 g ctc f ccc cac 7 cgt 40 h gtc n gcc 2 gac 105 ggc 46 i tta 1 c tca 2 taa tga 4 j ata k aca aaa 9 aga 10 k cta g cca 10 caa cga l gta 10 o gca 263 gaa 294 gga 14 m ttg 1 d tcg tag tgg 51 n atgj 1 l acg aag agg 7 o ctg h ccg cag cgg 8 p gtg p gcg gag ggg 4 gama144 inter max min total 625 432 10 1067	gam5 estimation des -rRNA du clade gamma pour 100 génomes g1    t1          a atgi 130 a tct 1.7 tat 1.3 atgf 290 b att 0.1 i act 0.5 aat 0.2 agt c ctt 0.9 e cct cat cgc d gtt 0.5 m gct gat ggt 0.5 e ttc 173 b tcc 152 tac 226 tgc 114 f atc 26 j acc 115 aac 311 agc 104 g ctc 102 f ccc 86 cac 108 cgt 298 h gtc 173 n gcc 165 gac 184 ggc 351 i tta 119 c tca 138 taa tga 64 j ata 0.8 k aca 141 aaa 368 aga 151 k cta 128 g cca 131 caa 189 cga 13 l gta 311 o gca 21 gaa 30 gga 114 m ttg 102 d tcg 83 tag tgg 62 n atgj 169 l acg 71 aag 24 agg 110 o ctg 252 h ccg 62 cag 102 cgg 92 p gtg 8.3 p gcg 6.9 gag 7.6 ggg 72 -rRNA inter max min total 1892 3118 1244 6254	gam6 indices des -rRNAs de l'annexe archeo pour 100 génomes g1    t1          a atgi 157 a tct tat atgf 686 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt 0.5 e ttc 300 b tcc 200 tac 429 tgc 257 f atc 43 j acc 86 aac 486 agc 157 g ctc 129 f ccc 86 cac 171 cgt 571 h gtc 300 n gcc 229 gac 100 ggc 657 i tta 200 c tca 171 taa tga 57 j ata k aca 271 aaa 471 aga 143 k cta 343 g cca 200 caa 329 cga 13 l gta 486 o gca gaa 243 gga 200 m ttg 100 d tcg 57 tag tgg 57 n atgj 271 l acg 57 aag 29 agg 100 o ctg 300 h ccg 57 cag 86 cgg 100 p gtg p gcg gag ggg 57 gama7 inter max min total 2657 5429 1343 9429

gamma, comparaison clade-annexe des -rRNAs

• Lien tableur: gamma, comparaison clade-annexe des -rRNAs
• Légende

  - gam7. diff, somme des couleurs de gam7. La différence entre tRNAs est faite entre gam5 et gam6 du tableau précédent. Elle est exprimée en % et rapporté à la plus grande valeur des 2 termes de la différence. Ce qui fait quand un tRNA est à zéro la différence en % est égale à 100.

  - gam8. rap, rapport des sommes couleurs gam5/gam2. Le rapport -rRNA/total est celui du tRNA de gam5 sur celui de gam2.

• Fréquences des différences en % du tableau gam7

gamme		0/0	10	20	30	40	50	60	70	80	90	100		total
fréquence	0	7	7	6	8	10	2	1	0	1	6	0	48
tot ≤ 50						38							

• Comparaison avec le nombre de tRNAs de la fiche du clade: L’estimation des -rRNA par l'annexe est 62% au dessus de celle de la fiche des gamma.

tRNAs		fiche		annexe
sans		8335		660
avec		1401		148
genomes		144		7
indice %	58		94

gam gamma 63 génomes

gam7 gamma, différence clade-annexe des -rRNAs g1    t1          a atgi 17 a tct 100 tat 100 atgf 58 b att 100 i act 100 aat 100 agt c ctt 100 e cct cat cgc d gtt 100 m gct gat ggt 100 e ttc 42 b tcc 24 tac 47 tgc 56 f atc 39 j acc 26 aac 36 agc 34 g ctc 21 f ccc 0 cac 37 cgt 48 h gtc 42 n gcc 28 gac 46 ggc 47 i tta 40 c tca 20 taa tga 11 j ata 100 k aca 48 aaa 22 aga 5 k cta 63 g cca 34 caa 42 cga 100 l gta 36 o gca 100 gaa 88 gga 43 m ttg 2 d tcg 31 tag tgg 8 n atgj 38 l acg 20 aag 16 agg 9 o ctg 16 h ccg 8 cag 16 cgg 8 p gtg 100 p gcg 100 gag 100 ggg 21 diff inter max min total 425 656 229 1310

gam8 gamma, rapports -rRNA/total g1    t1          a atgi a tct tat atgf 99 b att i act aat agt c ctt e cct cat cgc d gtt m gct gat ggt e ttc 99 b tcc tac tgc f atc 9 j acc 74 aac agc 98 g ctc f ccc cac 94 cgt h gtc n gcc 99 gac 64 ggc i tta 99 c tca 99 taa tga j ata k aca aaa 98 aga k cta g cca 93 caa cga l gta 97 o gca 7 gaa 9 gga m ttg 99 d tcg tag tgg 55 n atgj l acg aag agg o ctg h ccg cag cgg 92 p gtg p gcg gag ggg rap inter max min total 75 88 99 85

gamma intergen51

Intergen51. Introduction

• Voir les 51 génomes

Intergen51. Historique des pré-études

• Voir les 51 génomes

Intergen51. Formatage des résultats pour 7 génomes

gamma données intercalaires

• Lien tableur: gamma données intercalaires
• L'étendue des intercalaires fc+

	total	max1	reste	max2	un
spl	2482	1016	12	2727	3180
eco	2204	602	11	846	852
ecoN	2822	847	14	1486	1847
eal	2286	1073	11	1791	2324
vpb1	1757	799	9	1347	1605
vpb2	828	1030	4	1427	1439
vha1	1945	821	10	1507	2251
vha2	1075	914	5	1262	2682
amed	2382	815	12	2076	2281

gamma données intercalaires 200

• Lien tableur: gamma données intercalaires 200

Intergen51. Gamma vue de l'ensemble

Intergen51. La longueur totale des intercalaires d'un génome

• Légende: intercals pour longueur totale des intercalaires positifs en pdb et génome pour celle de l'ADN du génome donnée par NCBI
• Note: Les 9 éléments ont un taux autour de 12%

Nom	intercals	génome		taux en %
				
amed	601 332		4 777 154	12,6
eal	594 081		4 701 875	12,6
eco	501 283		4 641 652	10,8
ecoN	646 219		5 441 200	11,9
spl	789 212		5 174 581	15,3
vha1	499 733		3 765 351	13,3
vha2	317 649		2 204 018	14,4
vpb1	403 530		3 297 305	12,2
vpb2	242 529		1 806 219	13,4

Intergen51. Gamma les différents types d'intercalaires

• Lien au tableur: Intergen51. Gamma les différents types d'intercalaires.
• Légende:

  - S pour intercalaire CDS-CDS et R pour tRNA-CDS,

  - c pour intercalaire continu (les 2 gènes sont sur le même brin) et x pour discontinu (les 2 gènes sont sur 2 brins différents, le brin et son complément)

  - %reste = 100*reste/total, le reste étant ce qui reste du total après la fin du diagramme, gamme.

  - %t30 = 100*t30/total, t30 étant le total des fréquences 10 20 30

  - %t5 = 100*t/total, t5 étant le total des fréquences de -1 à -5 dans le diagramme des S-.

• Note:

  - taux des R-: c-/c = 100*2/301 = 0.7 et x-/x = 100*1/208 = 0.5.

Int51.2 Gamma les différents types d'intercalaires entre gène de 7 génomes

Int51.21 Les différents types intercalaires CDS-CDS * autres intercalaires continu S+ S- S0 total c/x RNA-RNA CDS-rRNA total c 17 644 4 048 137 21 829 2,2 695 58 753 x 9 203 450 52 9 705 0 42 42 t 26 847 4 498 189 31 534 695 100 795 % 85,1 14,3 0,6

Int51.22 Détail des * autres intercalaires intercalaires tRNA-CDS récapitulatif des * autres intercalaires continu R+ R- R0 total c/x * autres total % c 297 2 2 301 1,4 tRNA-CDS 509 21 x 207 1 0 208 RNA-RNA 695 29 t 504 3 2 509 CDS-rRNA 100 4 % 99,0 0,6 0,4 non RNA 1 112 46

Int51.23 Les taux remarquables taux %reste %t30 %t5 %0 type S+ R+ S- S+ R+ S- S+ R+ gamme 400 400 6-50 - - - - - c 6,0 15,6 1,3 28,5 3,7 64 0,6 0,7 x 11,3 17,3 7,8 5,6 2,4 39 0,5 0,0

Intergen51. Gamma Détail des intercalaires RNA-RNA et CDS-rRNA

• Lien aux données intercalaires.

RNA-RNA		c	x		CDS-RNA		c	x
23s 5s		62			CDS 16s		37	24
16s 23s		11			5s CDS		14	18
16s tRNA	54			16 CDS			
tRNA 23s	51			CDS 5s			
5s tRNA		36			23s CDS		2	
tRNA in		45			CDS 23s			
tRNA contig	11			5s 16s		4	
tRNA hors	414			16s16s		1	
tRNA 16s	1						
23s tRNA								
tRNA 5s		10						
16s 5s								
5s 23s								
5s 5s								
total		695	0		total		58	42

Intergen51. Gamma Les intercalaires rares

• Lien aux données intercalaires.
• Note: 5 au total

tRNA-CDS			
gen	x-	c-	zéro c
spl	-23		
ecoN			2
vha2		-36	
amed		-21	
16s16s		c+
vha1		0	

Intergen51. Les diagrammes des gamma

Intergen51. Les diagrammes CDS-CDS et tRNA-CDS

Intergen51. Les diagrammes CDS-CDS et tRNA-CDS positifs

• Lien aux données intercalaires.
• Diagrammes des gamma:  tg présente 4 diagrammes

  - fc40, CDS-CDS continu, fréquence unitaire en abscisses et effectif en ordonnées

  - fx%, CDS-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et pourcentage en ‰ par rapport au total, en ordonnées.

  - ftc, tRNA-CDS continu, fréquences regroupées par 10 (freq10) en abscisses et effectif en ordonnées

  - ftx, tRNA-CDS discontinu, fréquences regroupées par 10 (freq10) en abscisses et effectif en ordonnées

• Équations des courbes de tendance en pour 1000: colonnes %fx %fc

Courbes de tendances pour les diagrammes en pour 1000			Calculs des f.41 et autres R2 des f.1	
R2	x3		x2		x		c		Inflexion poly3	x	c
0,790	3,47E-06	-2,26E-03	3,24E-01	22,6	fx1	abscisse	534,8	55,7
0,828	-5,39E-06	4,14E-03	1,06E+00	101,0	fc1	ordonnée	4,7	39,3
									poly3/droite	-12,8	35,3
0,963	-3,16E-07	5,07E-04	-2,86E-01	61,0	fx41			
0,976	5,33E-07	-8,91E-05	-1,60E-01	48,4	fc41	R2 f.1		x	c
									Poly 3		790	828
0,908					-1,12E-01	47,1	fx41	Poly 6		899	970
0,925					-1,09E-01	41,4	fc41	Poly 9		977	986
0,650					-8,30E-02	39,1	fx1			
0,650					-1,68E-01	57,8	fc1			

Intergen51. Gamma CDS-CDS négatifs

Intergen51. Gama comparaison avec la totale

• Lien aux données intercalaires.
• Gamma se distingue de la totale par le 4/1 des négatifs c, avec 1.6 contre 2.6

Sous-totaux	gama			totale	
fréquence	x-	c-		x-	c-
-1		2	1 002		4	4 140
-2		16	5		85	11
-3		2	2		3	12
-4		152	1 572		717	10 938
-5		2	4		5	19
sp6		276	1 463		1 642	8 424
total		450	4 048		2 456	23 544
reste		35	53		264	420
s6		84	5		361	41
s7		44	270		321	1 438
s8		113	1 135		696	6 525
rapport s1-5						
4/2/1		9,5	1,6		8,4	2,6
% / sp6						
s6/sp6		30,4	0,3		22,0	0,5
s7/sp6		15,9	18,5		19,5	17,1
s8/sp6		40,9	77,6		42,4	77,5
reste/sp6	12,7	3,6		16,1	5,0
						
total s1-5	174	2 585		814	15 120
% / total						
%s1-5		38,7	63,9		33,1	64,2
%sp6		61,3	36,1		66,9	35,8

Intergen51. Gama homogénéité des génomes

• Lien aux données intercalaires des génomes
• Grande homogénéité des génomes qui confirme la faiblesse du 4/1 des continus, à part amed avec 2.3 proche de 2.6 la totale.

négatifs x	amed	spl	eco	ecoN	eal	vpb1	vpb2	vha1	vha2	total
total		42	12	95	105	119	13	14	25	25	450
s1-5		9	7	45	49	43	2	5	9	5	174
sp6		33	5	50	56	76	11	9	16	20	276
rapport s1-5											
4/2		8.0	2.5	21.5	9.8	9.8	-	4.0	-	1.5	9.5
% / sp6											
s6		24	20	28	32	30	27	33	44	35	30
s7		27	0	12	18	21	9	0	6	5	16
s8		36	60	34	41	39	55	56	50	60	41
reste		12	20	26	9	9	9	11	0	0	13
% / total											
s1-5		21	58	47	47	36	15	36	36	20	39
sp6		79	42	53	53	64	85	64	64	80	61
											
											
négatifs c	amed	spl	eco	ecoN	eal	vpb1	vpb2	vha1	vha2	total
total		444	414	647	782	617	344	171	402	227	4048
s1-5		303	262	422	508	407	198	103	242	140	2585
sp6		141	152	225	274	210	146	68	160	87	1463
rapport s1-5											
4/1		2.3	1.1	1.6	1.9	1.6	1.4	1.1	1.4	1.2	1.6
% / sp6											
s6		0	0	0	2	0	0	0	0	0	0
s7		23	20	21	19	20	14	9	17	14	18
s8		72	77	68	76	78	86	91	83	86	78
reste		4	3	11	4	2	0	0	0	0	4
% / total											
s1-5		68	63	65	65	66	58	60	60	62	64
sp6		32	37	35	35	34	42	40	40	38	36

Intergen51. Gama Les grands négatifs inférieurs à -120

• Voir intergen51

Intergen51. Les diagrammes CDS-rRNA

Intergen51. Gamma. Les diagrammes CDS-16s

• Lien au tableur: Intergen51. Gamma. Les diagrammes CDS-16s.
• Lien aux données intercalaires.
• Les diagrammes CDS-16s

gama		CDS16sc		CDS16sx		5sCDSc		5sCDSx
R2		-		-		-		-
moyenne		473,0		533,2		186,8		221,5
plage		360-690		450-630		30-390		60-480
total-p		31		17		12		14
%		84		71		86		78
queue		4		3		2		2
%		11		12,5		14		11
tête		2		4		0		0
%		5,4		16,7		0		0
max		390;9		480;4		90;4		120;6
total7		37		24		14		18
freq		30		30		30		30

• Les moyennes CDS-16s par génome

Intergen51.gamma. Moyennes CDS-16s

CDS16sx. discontinu CDS16sx moyenne écart m/e intercalaires haut bas amed 560,3 63,6 8,8 3x481-516 626:627 35,4 72,9 eal 386,8 103,2 3,7 264 339 467:471 209,0 -100,7 eco 522,3 79,5 6,6 473:480 614 73,4 34,9 ecoN 298 256,0 1,2 117 479 297,7 -189,4 spl 821,5 250,6 3,3 614 687:807 1178:*1908 -225,8 334,1 vha1 523,0 43,8 11,9 492 554 72,7 35,6 vha2 vpb1 526,0 42,4 12,4 496 556 69,7 38,6 vpb2 total 541,6 197,1 2,7 595,7 487,4

CDS16sc. continu CDS16sc moyenne écart m/e intercalaires haut bas amed 488,4 72,1 6,8 424:432 469:518 599 63,5 36,8 eal 298,3 119,0 2,5 161 364:370 253,6 -153,2 eco 388,5 36,2 10,7 362 373:377 442 163,4 -63,1 ecoN 435,7 118,9 3,7 4x365-385 441 672 116,2 -15,9 spl 665,6 301,2 2,2 206 611:647 876:988 -113,7 214,0 vha1 584,3 146,6 4,0 4x451-557 631:853 -32,4 132,8 vha2 448 448 103,9 -3,6 vpb1 551,5 136,6 4,0 4x454-504 575:817 0,4 99,9 vpb2 468 468 83,9 16,4 total 501,7 173,5 2,9 551,9 451,6

Intergen51. Les diagrammes 5s-CDS

• Lien aux données intercalaires.
• Comparaison avec les tRNA-CDS

  - Les équations des polynômes de d°3

  fct    f(x) = 1.16E-06 x3 – 9,33E-04 x2 + 1,98E-01 x – 2,05

  fxt    f(X) = -2.37E-07 x3 + 7.01E-05 x2 + 6.66E-03 x +3.00E+00

  - Les caractéristiques des courbes: xs abscisse calculée du maximum de la courbe en pbs, plage des effectifs forts et max de l'effectif maximum et son abscisse.

gama		fct		fxt		5sCDSc		5sCDSx
R2		0,509		0,105		-		-
xs		145,7		236,8		186,8		221,5
plage		80-240		40-370		30-390		60-480
total-p		170		162		12		14
%		56		78		86		78
queue		103		40		2		2
%		34		19		14		11
tête		24		5		0		0
%		8,0		2,4		0		0
max		160;18		100;10		90;4		120;6
total7		301		208		14		18
freq		10		10		30		30

Intergen51.gamma. Comparaison 5s-CDS tRNA-CDS CDS-CDS

• Lien tableur: Intergen51.gamma. Comparaison 5s-CDS tRNA-CDS CDS-CDS.
• Légende:

  - Inf40, Sup700: nombre d'intercalaires du génome inférieurs à 41 et supérieurs à 700. Dans les tableaux 5sCDS ils sont notés en gras avec un *. A voir aux données intercalaires du génome.

  - moyenne: elle est calculée pour tous les intercalaires compris entre inf40 et sup700, 40 exclu. Et son écart est la fonction ecartype.

  - haut, bas: pour estimer que la moyenne du génome est très élevée ou trop basse par rapport à celle du total des alpha.

  + la référence du haut est égale à (total + total/10), indiquée sur la ligne total.

  + la référence du bas est égale à (total - total/10), indiquée sur la ligne total.

  + Pour un génome le haut est égal à (haut référence - sa moyenne): si cette différence est négative la moyenne est considérée trop élevée.

  + Pour un génome le bas est égal à (sa moyenne - haut référence): si cette différence est négative la moyenne est considérée trop basse.

  + pour les tableaux 5sCDS les références sont sur la ligne du total précédés du signe ++

  - Les colonnes f*t-f* représentent la différence entre les 2 moyennes.

  - intercalaires: pour les tableaux 5sCDS où les effectifs sont très faibles. Une plage continue de plus de 2 effectifs est représentée par un tiret, inférieur - supérieur. S'il n'y a que 2 intercalaires, ils sont séparés par 2 points, :.

• Note: Sommes des différences f*t-f*, positives et négatives, dans les tableaux correspondants

fct-fc	509,0
fct-fc	-0
	
fxt-fx	804,9
fxt-fx	-0

Intergen51.gamma Comparaison 5s-CDS tRNA-CDS CDS-CDS

fxt. tRNA-CDS discontinu fxt moyenne écart m/e Inf 40 Sup 700 haut bas amed 215,8 114,5 1,9 0 0 71,6 -19,3 eal 213,1 140,6 1,5 2 0 74,3 -22,1 eco 243,8 133,8 1,8 3 1 43,5 8,7 ecoN 259,6 117,9 2,2 6 3 27,8 24,4 spl 300,0 140,1 2,1 1 3 -12,6 64,9 vha1 277,3 152,6 1,8 0 0 10,0 42,2 vha2 329,8 40,5 8,1 0 0 -42,4 94,7 vpb1 288,7 166,5 1,7 0 1 -1,3 53,6 vpb2 487,0 141,3 3,4 2 0 -237,7 283,1 total 261,2 141,9 1,8 ++ 287,4 235,1	5sCDSx. 5s-CDS discontinu 5sCDSx moyenne écart m/e intercalaires  - amed 183,5 119,5 1,5 99 268 eal 223,7 204,8 1,1 98:113 460 eco 192,7 98,9 1,9 81 228:269 ecoN 83,0 29,7 2,8 62 104 spl 387,8 77,8 5,0 304:339 2x454 *768:798 vha1 101 101 vha2 vpb1 110 110 vpb2 total 221,5 145,6 1,5 ++ 243,7 199,4 -
fct. tRNA-CDS continu fct moyenne écart m/e Inf 40 Sup 700 haut bas amed 201,0 117,5 1,7 1 2 48,2 -2,9 eal 212,5 133,7 1,6 1 0 36,8 8,5 eco 187,9 105,6 1,8 1 2 61,3 -16,0 ecoN 214,4 127,2 1,7 4 2 34,9 10,4 spl 298,3 187,7 1,6 0 4 -49,1 94,4 vha1 238,1 138,9 1,7 1 1 11,2 34,1 vha2 254,0 125,2 2,0 1 0 -4,7 50,1 vpb1 253,9 138,9 1,8 3 1 -4,6 49,9 vpb2 266,3 77,7 3,4 1 1 -17,1 62,4 total 226,6 137,5 1,6 ++ 249,3 203,9	5sCDSc. 5s-CDS continu 5sCDSc moyenne écart m/e intercalaires  - amed 275,0 111,0 2,5 164 275 386 eal 178,0 172,5 1,0 56 300 eco 187,0 159,8 1,2 74 300 ecoN 137,4 107,0 1,3 3x76 136 323 spl *715 17,0 42,1 *703 *727 vha1 vha2 vpb1 vpb2 total 186,8 121,1 1,5 ++ 205,5 168,2 -
fx. CDS-CDS discontinu fx moyenne écart m/e fxt-fx Sup 700 haut bas amed 183,3 129,6 1,41 32,5 16 36,4 3,5 eal 198,0 142,2 1,39 15,1 26 21,8 18,2 eco 185,9 118,7 1,57 57,9 9 33,8 6,1 ecoN 199,8 138,9 1,44 59,8 35 19,9 20,0 spl 227,7 147,9 1,54 72,3 48 -7,9 47,9 vha1 205,7 144,3 1,43 71,7 26 14,1 25,9 vha2 213,6 152,5 1,40 116,2 20 6,1 33,8 vpb1 195,2 146,0 1,34 93,5 12 24,5 15,4 vpb2 201,0 142,8 1,41 286,0 11 18,7 21,3 total 199,8 138,8 1,44 61,5 219,7 179,8	fc. CDS-CDS continu fc moyenne écart m/e fct-fc Sup 700 haut bas amed 165,4 113,5 1,5 35,6 23 30,3 5,3 eal 175,7 129,9 1,4 36,8 34 20,0 15,6 eco 161,6 111,5 1,4 26,3 3 34,1 1,5 ecoN 164,0 121,1 1,4 50,3 26 31,7 3,9 spl 201,0 142,9 1,4 97,4 58 -5,3 40,8 vha1 189,3 136,6 1,4 48,8 19 6,4 29,1 vha2 188,8 136,8 1,4 65,2 17 6,9 28,7 vpb1 177,7 120,7 1,5 76,2 17 18,0 17,6 vpb2 193,9 131,6 1,5 72,5 12 1,8 33,7 total 177,9 127,5 1,4 48,7 195,7 160,1

Intergen51. Les CDS-rRNA rares

• Lien aux données intercalaires.

23sCDSc	tRNA16sc	16s16sc
331	1063		0
385		

Intergen51. Les diagrammes RNA-RNA

Intergen51. Gamma. Les diagrammes rRNA-rRNA

• Lien au tableur: Intergen51. Gamma. Les diagrammes rRNA-rRNA.
• Lien aux données intercalaires.

gama		16s23s		16stRNA		tRNA23sc	23s5sc
R2		-		-		-		-
moyenne		332,3		118,7		243,8		118,0
plage		280-360		80-140		180-340		80-180
total-p		10		43		49		61
%		91		80		96		98
queue		1		11		2		1
%		9,1		20		4,0		1,6
tête		0		0		0		0
%		0		0		0		0
max		360;7		80;19		200;18		100;27
total7		11		54		51		61
freq		20		20		20		20

Intergen51. Les diagrammes rRNA-RNA

• Lien au tableur: Intergen51. Gamma. Les diagrammes rRNA-RNA.

Intergen51.gamma. Moyennes rRNA-RNA

16s23s. 16s23s moyenne écart m/e intercalaires haut bas amed     eal eco ecoN spl 353,0 12,5 28,2 7x348-349 384 12,5 54,0 vha1 vha2 vpb1 277 3x277 88,5 -22,0 vpb2 total 332,3 37,0 9,0 365,5 299,0

23s5s. 23s5s moyenne écart m/e intercalaires haut bas amed 123,4 2,6 48,3 9x120-127     6,3 17,3 eal 169 7x169 -39,3 62,8 eco 92,4 0,5 172,9 7x92-93 37,3 -13,7 ecoN 95 6x95 *1881 34,7 -11,2 spl 136,3 13,5 10,1 10x132-133 177 -6,5 30,1 vha1 121,0 15,0 8,1 2x95 7x125-135 8,7 14,8 vha2 95 95 34,7 -11,2 vpb1 91 10x91 38,7 -15,2 vpb2 91 91 38,7 -15,2 total 118,0 26,5 4,4 129,7 106,2

16stRNA. 16stRNA moyenne écart m/e intercalaires haut bas amed 183,3 81,0 2,3 3x72 7x198-274 -52,7 76,5 eal 78,3 8,4 9,3 7x68-85 52,3 -28,6 eco 102,3 47,6 2,2 5x68-85 2x171 28,3 -4,6 ecoN 149,4 148,3 1,0 7x68-85 375 443 -18,8 42,6 spl 74 3x74 56,6 -32,8 vha1 105,8 21,3 5,0 65 5x91-102 3x127-134 24,8 -1,1 vha2 123 123 7,6 16,2 vpb1 83,3 12,8 6,5 2x65 5x89 97 47,3 -23,6 vpb2 89 89 41,6 -17,8 total 118,7 79,4 1,5 130,6 106,9

tRNA23s. tRNA23s moyenne écart m/e intercalaires haut bas amed 238,8 5,0 47,3 8x236-238 252 29,4 19,4 eal 192,9 6,4 30,1 3x186 4x198 75,3 -26,5 eco 186,1 7,2 25,8 174 3x183-184 3x193 82,0 -33,3 ecoN 200,0 31,3 6,4 174 5x183-194 269 68,2 -19,4 spl 359,3 20,2 17,8 336 2x371 -91,2 139,9 vha1 290,8 21,0 13,8 3x260-272 6x296-317 -22,6 71,4 vha2 313 313 -44,8 93,6 vpb1 280,0 26,6 10,5 5x264-265 2x319 -11,8 60,6 vpb2 263 263 5,2 43,6 total 243,8 53,8 4,5 268,2 219,4

Intergen51. Gamma. Les diagrammes tRNA-tRNA

• Lien au tableur: Intergen51. Gamma. Les diagrammes tRNA-tRNA.
• Lien aux données intercalaires.

Les diagrammes des tRNA-tRNA

type c		S40	%	R2	diag	total	reste	x+	restes	5stRNA	hors	contig	tRNA 5s
hors		213	51	0,656	260	414	4	-		151	479	1472	777
contig		4	36	-	70	11	2	-			539	2351	1112
in		24	53	-	70	45	0	-			634		1360
5stRNA		14	39	-	120	36	1	-			1172		
tRNA5s		5	50	-	60	10	3	-					

Pourcentage des tRNA-tRNA hors blocs

tRNA h		amed	spl	eco	ecoN	eal	vpb	vha	vpb2	vha2	total	%
20		14	15	12	13	11	9	10	1	1	84	20.3
40		27	27	10	16	8	24	17			129	31.2
60		14	29	6	9	7	21	16		1	102	24.6
80		2	3	1	4	1	9	6	2		26	6.3
100		3	8	0	0	1	3	6		1	21	5.1
120		8	14	1	1	1					25	6.0
140		1	4	2	0	0					7	2
160		0	0	2	0	1		1			4	1
180			1								1	0
200			1	2		1		1		1	5	1
220			1	1		2	1				5	1
240			0								0	0
260			1								1	0
reste			4								4	1
total		69	108	37	43	33	67	57	3	4	414	100
												
repete		8	9	8	13	8	4	5	0	1	55	48
séquence	3	7	2	2	2	4	5	0	0	25	22
sans		9	5	4	3	4	7	3	3	1	35	30
clusters	20	21	14	18	14	15	13	3	2	115	100

Les moyennes des tRNA-tRNA par génome

Intergen51.gamma. Moyennes tRNA-tRNA

5stRNA 5stRNA moyenne écart m/e intercalaires haut bas amed 100,6 5,1 19,8 95 2x98 2x106 -35,2 47,1 eal 52 57,2 1,5 2x52 *151 13,4 -1,5 eco 38,7 23,1 1,7 12 2x52 26,7 -14,8 ecoN 33,8 22,8 1,5 2x14 53:54 31,6 -19,7 spl 89,3 18,5 4,8 68 2x100 -24,0 35,9 vha1 55,0 30,8 1,8 5x31-32 68 91:100 10,4 1,5 vha2 90 90 -24,6 36,5 vpb1 43,8 26,5 1,7 6x30 69 100 21,6 -9,7 vpb2 69 69 -3,6 15,5 total 59,4 31,3 1,9 65,4 53,5

tRNA contigu tRNA cont moyenne écart m/e intercalaires haut bas amed eal 11 11 35,1 -26,7 eco ecoN 30,7 19,6 1,6 8 2x42 *1472:2351 15,4 -7,0 spl vha1 51,5 23,3 2,2 35 68 -5,4 13,8 vha2 vpb1 57,0 19,1 3,0 35 2x68 -10,9 19,3 vpb2 total 41,9 23,0 1,8 46,1 37,7

tRNA intra cluster tRNA in moyenne écart m/e intercalaires haut bas amed 10 3x10 23,7 -17,6 eal 45 3x45 -11,3 17,4 eco 42 3x42 -8,3 14,4 ecoN 42 4x42 -8,3 14,4 spl 65 3x65 -31,3 37,4 vha1 30,5 16,6 1,8 5x43 4x2-9 4x30-41 3,2 2,9 vha2 20,3 16,8 1,2 2 24 35 13,4 -7,2 vpb1 21,8 16,3 1,3 2x41 4x2-14 12,0 -5,8 vpb2 10,7 7,6 1,4 2 14 16 23,0 -16,9 total 30,6 18,5 1,7 33,7 27,6

tRNA hors cluster tRNA hors moyenne écart m/e total S60% sup120 haut bas amed 43,0 29,5 1,5 69 80 1 4,3 4,3 eal 33,6 27,5 1,2 33 79 4 13,7 -5,1 eco 29,8 24,3 1,2 37 76 7 17,5 -8,9 ecoN 33,3 22,9 1,5 43 88 0 14,0 -5,4 spl 52,3 29,9 1,7 108 66 12 -5,0 13,6 vha1 45,8 24,3 1,9 53 77 1 1,6 7,1 vha2 51,7 46,0 1,1 4 50 1 -4,3 13,0 vpb1 43,1 19,6 2,2 64 83 1 4,2 4,4 vpb2 49,7 40,4 1,2 3 100 0 -2,3 11,0 total 43,0 27,2 1,6 414 76 27 47,3 38,7

Intergen51. Les RNA-RNA rares

• Lien aux données intercalaires.
• Les tRNA5sc cités ci-dessus