Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur

Une page de Wikiversité, la communauté pédagogique libre.
Aller à la navigation Aller à la recherche
Atableur
Image logo représentative de la faculté
Annexe 12
Recherche : Les clusters de gènes tRNA et rRNA chez les procaryotes
Précédent :archeo
Suivant :Apmq
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Annexe : Atableur
Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur
 », n'a pu être restituée correctement ci-dessus.



bacilli[modifier | modifier le wikicode]

Bacillus subtilis[modifier | modifier le wikicode]

bsu[modifier | modifier le wikicode]

  • Lien tableau: bsu
Bacillus subtilis subsp. subtilis str. 168;;;;
43.6%GC;7.3.19 Paris;86;doubles;intercal
;;;;
;9810..11364;16s;@2;99
;11464..11540;atc;;11
;11552..11627;gca;;81
;11709..14636;23s;;55
;14692..14810;5s;;
;;;;
; 22292..22384;tca;;
;;;;
;30279..31832;16s;;99
;31932..32008;atc;;11
;32020..32095;gca;;81
;32177..35103;23s;;133
;35237..35355;5s;;
;;;;
;70181..70257;atg;;9
;70267..70338;gaa;;
;;;;
;90536..92089;16s;@1;164
;92254..95181;23s;;55
;95237..95354;5s;;20
;95375..95450;gta;;4
;95455..95530;aca;;36
;95567..95642;aaa;;6
;95649..95731;cta;;40
;95772..95846;ggc;;14
;95861..95946;tta;;9
;95956..96032;cgt;;27
;96060..96136;cca;;9
;96146..96221;gca;;170
;96392..97945;16s;;164
;98110..101037;23s;;55
;101093..101211;5s;;
;;;;
;160893..162445;16s;;164
;162610..165535;23s;;55
;165591..165707;5s;;46
;165754..165825;aac;;4
;165830..165902;acc;;56
;165959..166033;ggc;;30
;166064..166140;cgt;;27
;166168..166244;cca;;8
;166253..166328;gca;;171
;166500..168053;16s;;164
;168218..171141;23s;;55
;171197..171314;5s;;183
;171498..173049;16s;;164
;173214..176141;23s;;55
;176197..176315;5s;;
;;;;
;194205..194279;gaa;;3
;194283..194358;gta;;4
;194363..194435;aca;;22
;194458..194542;tac;;4
;194547..194621;caa;;
;;;;
;528704..528778;aac;;4
;528783..528873;agc;;29
;528903..528974;gaa;;11
;528986..529060;caa;;26
;529087..529162;aaa;;11
;529174..529255;cta;;80
;529336..529422;ctc;;
;;;;
;635110..635186;cgt;;13
;635200..635273;gga;;159
;635433..636987;16s;;167
;637155..640082;23s;;55
;640138..640254;5s;;13
;640268..640344;atgf;;60
;640405..640481;gac;;
;;;;
;946696..948250;16s;;167
;948418..951345;23s;;111
;951457..951572;5s;;9
;951582..951656;aac;;5
;951662..951753;tcc;;34
;951788..951859;gaa;;9
;951869..951944;gta;;9
;951954..952030;atgf;;11
;952042..952118;gac;;12
;952131..952206;ttc;;5
;952212..952284;aca;;22
;952307..952391;tac;;5
;952397..952470;tgg;;24
;952495..952570;cac;;9
;952580..952651;caa;;49
;952701..952775;ggc;;5
;952781..952851;tgc;;7
;952859..952947;tta;@3;265
;953213..953294;ttg;;
;;;;
;967065..967138;gga;;
;;;;
;1262789..1262861;gtc;;
;;;;
comp;2003276..2003348;agg;;
;;;;
;2563889..2563959;caa;;
;;;;
comp;2899816..2899889;aga;;
;;;;
comp;3171879..3171950;gaa;;25
comp;3171976..3172066;agc;;3
comp;3172070..3172144;aac;;10
comp;3172155..3172231;atc;;15
comp;3172247..3172320;gga;;10
comp;3172331..3172406;cac;;17
comp;3172424..3172499;ttc;;12
comp;3172512..3172588;gac;;11
comp;3172600..3172676;atgf;;17
comp;3172694..3172786;tca;;6
comp;3172793..3172869;atgi;;2
comp;3172872..3172948;atgj;;19
comp;3172968..3173040;gca;;5
comp;3173046..3173122;cca;;15
comp;3173138..3173214;cgt;;9
comp;3173224..3173309;tta;;14
comp;3173324..3173398;ggc;;5
comp;3173404..3173490;ctg;;10
comp;3173501..3173576;aaa;;37
comp;3173614..3173689;aca;;32
comp;3173722..3173797;gta;;20
comp;3173818..3173935;5s;;55
comp;3173991..3176918;23s;;167
comp;3177086..3178640;16s;;
;;;;
comp;3194455..3194527;gcc;;
;;;;
comp;3545889..3545964;cgg;;
;;;;
comp;4154787..4154859;ttc;;35
comp;4154895..4154971;gac;;81
comp;4155053..4155124;gaa;;9
comp;4155134..4155209;aaa;;

bsu blocs[modifier | modifier le wikicode]

bsu blocs;;;;;;;;;
Types;;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2;II3
16s;167;167;164;164;;16s;164;164;164
23s;111;55;55;55;;23s;55;55;55
5s;9;20;46;20;;5s;;;
;5;32;4;4;;;;;
;aac;gta;aac;gta;;;;;
;**15aas;**20aas;**5aas;** 8aas;;;;;
III;;;;;;IV;;;
16s;99;99;;;;cgt;13;;
atc;11;11;;;;gga;159;;
gca;81;81;;;;16s;167;;
23s;55;133;;;;23s;55;;
5s;;;;;;5s;13;;
;;;;;;atgf;60;;
;;;;;;gac;;;
Groupes;;;;;;;;;
;16s;164;;;;16s;164;;
I3;23s;55;;;I4;23s;55;;
;5s;46;;;;5s;20;;
;aac;4;;;;gta;4;;
;**4aas;8;;;;** 7aas;9;;
;gca;171;;;;gca;170;;
II1;16s;164;;;II3;16s;164;;
;23s;55;;;;23s;55;;
II2;5s;183;;;;5s;;;
;16s;164;;;;;;;
;23s;55;;;;;;;
;5s;;;;;;;;

bsu données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: bsu données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA tRNA;;reste;Sup 400
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;bsu;long;long
fxt;fct;bsu;fx;fc;bsu;fx40;fc40;bsu;x-;c-;c;x;;;c;aa;c;aa;c;aa;fx;fc
0;0;0;2;25;0;2;25;-1;0;72;134;111;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;hors bloc;401;406
0;0;10;28;231;1;3;41;-2;0;4;168;179;350;349;5* 164;;4;gta;9;atgj;402;411
0;0;20;45;399;2;2;31;-3;0;0;199;82;243;;3* 167;;36;aca;**;gaa;404;412
0;0;30;70;185;3;3;34;-4;14;229;227;333;309;;23s 5s;;6;aaa;3;gaa;406;421
0;0;40;158;121;4;2;27;-5;0;0;122;78;291;;8* 55;;40;cta;4;gta;407;422
0;0;50;81;84;5;3;19;-6;2;0;180;193;5s CDS;;133;;14;ggc;22;aca;407;422
0;1;60;22;92;6;0;21;-7;1;11;52;90;175;36;111;;9;tta;4;tac;408;423
2;0;70;21;119;7;5;16;-8;1;75;130;172;237;;16s tRNA;;27;cgt;**;caa;409;423
1;0;80;32;121;8;3;7;-9;1;0;232;840;767;;2* 99;atc;9;cca;4;aac;410;423
3;0;90;23;111;9;3;16;-10;1;5;107;93;5s 16s;;tRNA 23s;;**;gca;29;agc;410;426
1;0;100;25;91;10;4;19;-11;1;43;383;86;183;;2* 81;gca;4;aac;11;gaa;411;427
1;1;110;24;106;11;0;32;-12;0;0;223;66;;;5s tRNA;;56;acc;26;caa;413;442
1;0;120;39;87;12;2;54;-13;0;6;;63;;;2* 20;gta;30;ggc;11;aaa;413;446
0;2;130;42;85;13;5;46;-14;1;19;;106;;;46;aac;27;cgt;80;cta;415;448
0;1;140;27;66;14;12;47;-15;0;0;;284;;;13;atgf;8;cca;**;ctc;415;463
0;0;150;42;68;15;4;52;-16;1;5;;269;;;9;aac;**;gca;35;ttc;425;463
0;0;160;35;65;16;3;31;-17;0;18;;;;;tRNA tRNA;intra;13;cgt;81;gac;434;465
0;1;170;33;58;17;6;41;-18;0;0;;;;;2* 11;atc gca;**;gga;9;gaa;435;471
2;1;180;29;53;18;5;44;-19;1;4;;;;;tRNA 16s;;60;atgf;**;aaa;438;471
0;0;190;26;33;19;5;23;-20;1;11;;;;;170;gca;**;gac;;;442;480
1;1;200;19;34;20;3;29;-21;0;0;;;;;171;gca;5;aac;;;442;481
0;0;210;28;30;21;2;25;-22;0;2;;;;;159;gga;34;tcc;;;446;482
0;0;220;17;14;22;2;29;-23;0;8;;;;;;;9;gaa;CDS-CDS;inf 50;448;485
0;2;230;24;20;23;3;22;-24;0;0;;;;;;;9;gta;intercalaire;;459;503
0;1;240;16;27;24;7;24;-25;1;1;;;;;;;11;atgf;c-;x-;463;518
0;0;250;16;18;25;4;15;-26;0;8;;;;;;;12;gac;-7616;-361;464;521
0;0;260;12;14;26;13;12;-27;0;0;;;;;;;5;ttc;-500;-127;471;531
1;0;270;19;16;27;12;12;-28;0;0;;;;;;;22;aca;-492;-93;475;544
0;0;280;13;16;28;3;14;-29;0;6;;;;;;;5;tac;-164;-86;482;548
1;0;290;13;6;29;10;17;-30;0;0;;;;;;;24;tgg;-154;-71;484;552
0;0;300;6;9;30;14;15;-31;0;1;;;;;;;9;cac;-143;-69;485;559
0;0;310;8;8;31;9;16;-32;0;2;;;;;;;49;caa;-119;-58;487;560
0;0;320;5;6;32;10;12;-33;0;0;;;;;;;5;ggc;-113;;490;567
0;0;330;1;8;33;16;18;-34;0;1;;;;;;;7;tgc;-101;;494;573
1;0;340;8;9;34;11;7;-35;0;3;;;;;;;265;tta;-95;;495;573
0;0;350;6;5;35;16;11;-36;0;0;;;;;;;**;ttg;-94;;496;582
0;0;360;4;4;36;19;13;-37;0;1;;;;;;;25;gaa;-92;;506;582
0;0;370;4;2;37;13;5;-38;0;2;;;;;;;3;agc;-91;;515;619
0;0;380;4;7;38;17;11;-39;0;0;;;;;;;10;aac;-82;;517;625
0;1;390;5;8;39;26;21;-40;1;1;;;;;;;15;atc;-65;;520;627
0;0;400;1;2;40;21;7;-41;0;8;;;;;;;10;gga;-59;;529;669
1;0;reste;60;49;reste;790;1551;-42;1;0;;;;;;;17;cac;-58;;529;682
16;12;total;1093;2512;total;1093;2512;-43;0;3;;;;;;;12;ttc;total;intercalaires;533;731
15;12;diagr;1031;2438;diagr;301;936;-44;0;2;;;;;;;11;gac;;434,723;538;777
0;0; t30;143;815;;;;-45;0;0;;;;;;;17;atgf;ADN long;4,215,606;546;809
;;;;;;;;-46;0;0;;;;;;;6;tca;%;10.3;550;824
;;Récapitulatif des effectifs;;;;;;-47;0;2;;;;;;;2;atgi;;;555;950
;;>0;<0;zéro;total;*;;-48;0;0;;;;;;;19;atgj;non RNA;190;558;1021
;x;1091;35;2;1128;;;-49;0;1;;;;;;;5;gca;;;572;7511
;c;2487;573;25;3085;;;-50;0;2;;;;;;;15;cca;;;577;
;;;;;4213;324;;reste;7;17;;;;;;;9;cgt;;;584;
;;;;;;4537;;total;35;573;;;;;;;14;tta;;;588;
;;;;;;;;;;;;;;;;;5;ggc;;;594;
;;;;;;;;;;;;;;;;;10;ctg;;;594;
;;;;;;;;;;;;;;;;;37;aaa;;;602;
;;;;;;;;;;;;;;;;;32;aca;;;623;
;;;;;;;;;;;;;;;;;**;gta;;;783;
;;;;;;;;;;;;;;;;;;;;;783;
;;;;;;;;;;;;;;;;;;;;;952;
;;;;;;;;;;;;;;;;;;;;;1306;

bsu autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: bsu autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;bsu;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;6994;9459;350;*;
;;rRNA;9810;11364;99;*;16s
;;tRNA;11464;11540;11;*;atc
;;tRNA;11552;11627;81;*;gca
;;rRNA;11709;14636;55;*;23s
;;rRNA;14692;14810;36;*;5s
fin;comp;CDS;14847;15794;;0;
deb;;CDS;19968;20558;52;*;
;;misc_RNA;20611;20823;56;*;
deb;;CDS;20880;22157;134;*;
;;tRNA;22292;22384;111;*;tca
fin;comp;CDS;22496;23149;;;
deb;;CDS;25852;26337;41;*;
;;misc_RNA;26379;26732;81;*;
fin;;CDS;26814;28505;;;
deb;;CDS;29772;30035;243;*;
;;rRNA;30279;31832;99;*;16s
;;tRNA;31932;32008;11;*;atc
;;tRNA;32020;32095;81;*;gca
;;rRNA;32177;35103;133;*;23s
;;rRNA;35237;35355;175;*;5s
fin;;CDS;35531;35725;;;
deb;;CDS;69626;70012;168;*;
;;tRNA;70181;70257;9;*;atgj
;;tRNA;70267;70338;199;*;gaa
fin;;CDS;70538;73021;;;
deb;;CDS;88727;90226;309;*;
;;rRNA;90536;92089;164;*;16s
;;rRNA;92254;95181;55;*;23s
;;rRNA;95237;95354;20;*;5s
;;tRNA;95375;95450;4;*;gta
;;tRNA;95455;95530;36;*;aca
;;tRNA;95567;95642;6;*;aaa
;;tRNA;95649;95731;40;*;cta
;;tRNA;95772;95846;14;*;ggc
;;tRNA;95861;95946;9;*;tta
;;tRNA;95956;96032;27;*;cgt
;;tRNA;96060;96136;9;*;cca
;;tRNA;96146;96221;170;*;gca
;;rRNA;96392;97945;164;*;16s
;;rRNA;98110;101037;55;*;23s
;;rRNA;101093;101211;237;*;5s
fin;;CDS;101449;101913;;;
deb;;CDS;119111;119809;45;*;
;;misc_RNA;119855;119995;65;*;
fin;;CDS;120061;120561;;;
deb;;CDS;152937;153680;56;*;
;;misc_RNA;153737;153793;48;*;
fin;;CDS;153842;154279;;;
deb;comp;CDS;159779;160543;349;*;
;;rRNA;160893;162445;164;*;16s
;;rRNA;162610;165535;55;*;23s
;;rRNA;165591;165707;46;*;5s
;;tRNA;165754;165825;4;*;aac
;;tRNA;165830;165902;56;*;acc
;;tRNA;165959;166033;30;*;ggc
;;tRNA;166064;166140;27;*;cgt
;;tRNA;166168;166244;8;*;cca
;;tRNA;166253;166328;171;*;gca
;;rRNA;166500;168053;164;*;16s
;;rRNA;168218;171141;55;*;23s
;;rRNA;171197;171314;183;*;5s
;;rRNA;171498;173049;164;*;16s
;;rRNA;173214;176141;55;*;23s
;;rRNA;176197;176315;767;*;5s
fin;;CDS;177083;178519;;;
deb;comp;CDS;193570;194025;179;*;
;;tRNA;194205;194279;3;*;gaa
;;tRNA;194283;194358;4;*;gta
;;tRNA;194363;194435;22;*;aca
;;tRNA;194458;194542;4;*;tac
;;tRNA;194547;194621;227;*;caa
fin;;CDS;194849;195412;;;
deb;;CDS;198497;199843;173;*;
;;misc_RNA;200017;200187;89;*;
fin;;CDS;200277;202079;;;
deb;;CDS;275838;276758;56;*;
;;misc_RNA;276815;277062;97;*;
fin;;CDS;277160;277321;;;
deb;;CDS;473803;474225;103;*;
;comp;misc_RNA;474329;474597;133;*;
fin;;CDS;474731;475540;;0;
deb;;CDS;483845;485956;135;*;
;;misc_RNA;486092;486235;196;*;
fin;;CDS;486432;488255;;;
deb;;CDS;528129;528581;122;*;
;;tRNA;528704;528778;4;*;aac
;;tRNA;528783;528873;29;*;agc
;;tRNA;528903;528974;11;*;gaa
;;tRNA;528986;529060;26;*;caa
;;tRNA;529087;529162;11;*;aaa
;;tRNA;529174;529255;80;*;cta
;;tRNA;529336;529422;82;*;ctc
fin;comp;CDS;529505;530611;;;
deb;;CDS;532292;532552;30;*;
;comp;misc_RNA;532583;532642;115;*;
fin;;CDS;532758;532886;;;
deb;;CDS;559264;559464;67;*;
;comp;misc_RNA;559532;559610;540;*;
fin;comp;CDS;560151;560612;;;
deb;comp;CDS;625125;626291;54;*;
;comp;misc_RNA;626346;626446;175;*;
fin;;CDS;626622;626933;;;
deb;comp;CDS;634651;634776;333;*;
;;tRNA;635110;635186;13;*;cgt
;;tRNA;635200;635273;159;*;gga
;;rRNA;635433;636987;167;*;16s
;;rRNA;637155;640082;55;*;23s
;;rRNA;640138;640254;13;*;5s
;;tRNA;640268;640344;60;*;atgf
;;tRNA;640405;640481;180;*;gac
fin;;CDS;640662;641639;;;
deb;;CDS;692740;694281;143;*;
;;misc_RNA;694425;694527;134;*;
fin;;CDS;694662;695984;;;
deb;;CDS;698092;698289;79;*;
;;misc_RNA;698369;698471;140;*;
fin;;CDS;698612;699100;;;
deb;;CDS;945520;946404;291;*;
;;rRNA;946696;948250;167;*;16s
;;rRNA;948418;951345;111;*;23s
;;rRNA;951457;951572;9;*;5s
;;tRNA;951582;951656;5;*;aac
;;tRNA;951662;951753;34;*;tcc
;;tRNA;951788;951859;9;*;gaa
;;tRNA;951869;951944;9;*;gta
;;tRNA;951954;952030;11;*;atgf
;;tRNA;952042;952118;12;*;gac
;;tRNA;952131;952206;5;*;ttc
;;tRNA;952212;952284;22;*;aca
;;tRNA;952307;952391;5;*;tac
;;tRNA;952397;952470;24;*;tgg
;;tRNA;952495;952570;9;*;cac
;;tRNA;952580;952651;49;*;caa
;;tRNA;952701;952775;5;*;ggc
;;tRNA;952781;952851;7;*;tgc
;;tRNA;952859;952947;265;*;tta
;;tRNA;953213;953294;78;*;ttg
fin;comp;CDS;953373;954149;;0;
deb;;CDS;954893;955585;69;*;
;;misc_RNA;955655;955762;132;*;
fin;;CDS;955895;957667;;0;
deb;comp;CDS;966671;966871;193;*;
;;tRNA;967065;967138;90;*;gga
fin;comp;CDS;967229;967852;;0;
deb;comp;CDS;1178757;1180595;89;*;
;comp;misc_RNA;1180685;1180802;106;*;
fin;comp;CDS;1180909;1181400;;0;
deb;comp;CDS;1218113;1219105;58;*;
;comp;misc_RNA;1219164;1219378;470;*;
fin;;CDS;1219849;1221486;;;
deb;comp;CDS;1233133;1233300;104;*;
;;misc_RNA;1233405;1233543;70;*;
fin;comp;CDS;1233614;1234513;;;
deb;;CDS;1240356;1242200;61;*;
;;misc_RNA;1242262;1242370;78;*;
fin;;CDS;1242449;1243159;;;
deb;comp;CDS;1257414;1258136;167;*;
;;misc_RNA;1258304;1258424;67;*;
fin;;CDS;1258492;1259613;;;
deb;comp;CDS;1261426;1262616;172;*;
;;tRNA;1262789;1262861;840;*;gtc
fin;comp;CDS;1263702;1264931;;0;
deb;;CDS;1375777;1376295;32;*;
;;misc_RNA;1376328;1376439;77;*;
fin;;CDS;1376517;1376855;;;
deb;;CDS;1377243;1378145;87;*;
;;misc_RNA;1378233;1378443;52;*;
fin;;CDS;1378496;1379593;;;
deb;comp;CDS;1383320;1385608;127;*;
;comp;misc_RNA;1385736;1385891;132;*;
fin;comp;CDS;1386024;1386983;;0;
deb;comp;CDS;1391040;1391642;96;*;
;comp;misc_RNA;1391739;1391851;101;*;
fin;;CDS;1391953;1392639;;;
deb;;CDS;1395371;1395508;113;*;
;;misc_RNA;1395622;1395775;237;*;
fin;;CDS;1396013;1397368;;0;
deb;;CDS;1409912;1410577;55;*;
;;misc_RNA;1410633;1410766;-113;*;
fin;;CDS;1410654;1411628;;;
deb;comp;CDS;1423241;1424434;92;*;
;comp;misc_RNA;1424527;1424683;83;*;
fin;comp;CDS;1424767;1425546;;0;
deb;;CDS;1425641;1426837;38;*;
;;misc_RNA;1426876;1426976;84;*;
fin;;CDS;1427061;1428278;;;
deb;;CDS;1438092;1439135;138;*;
;;misc_RNA;1439274;1439318;129;*;
fin;;CDS;1439448;1440107;;;
deb;;CDS;1456092;1456958;46;*;
;;misc_RNA;1457005;1457156;30;*;
fin;;CDS;1457187;1459286;;;
deb;;CDS;1482248;1483471;85;*;
;;misc_RNA;1483557;1483640;476;*;
fin;;CDS;1484117;1484356;;;
deb;comp;CDS;1533327;1533701;368;*;
;;misc_RNA;1534070;1534280;-161;*;
fin;;CDS;1534120;1534239;;0;
deb;;CDS;1568924;1569196;2;*;
;;misc_RNA;1569199;1569319;199;*;
fin;;CDS;1569519;1570073;;;
deb;;CDS;1606560;1607354;12;*;
;;misc_RNA;1607367;1607468;87;*;
fin;;CDS;1607556;1608836;;;
deb;;CDS;1612521;1613015;62;*;
;;misc_RNA;1613078;1613304;52;*;
fin;;CDS;1613357;1616122;;;
deb;;CDS;1617210;1618121;39;*;
;;misc_RNA;1618161;1618277;26;*;
deb;;CDS;1618304;1618849;3;*;
;;misc_RNA;1618853;1618970;52;*;
deb;;CDS;1619023;1620330;0;*;
;;misc_RNA;1620331;1620445;30;*;
fin;;CDS;1620476;1621390;;;
deb;;CDS;1629320;1629970;144;*;
;;misc_RNA;1630115;1630220;161;*;
fin;;CDS;1630382;1631083;;;
deb;;CDS;1675171;1675902;78;*;
;;misc_RNA;1675981;1676022;19;*;
fin;;CDS;1676042;1676389;;;
deb;;CDS;1727133;1731446;10;*;
;;misc_RNA;1731457;1731674;101;*;
fin;;CDS;1731776;1732246;;;
deb;;CDS;1778337;1780220;183;*;
;comp;misc_RNA;1780404;1780554;63;*;
fin;comp;CDS;1780618;1781073;;;
deb;;CDS;1914630;1914995;-4;*;
;comp;misc_RNA;1914992;1915272;-52;*;
fin;;CDS;1915221;1915979;;0;
deb;;CDS;1916955;1917302;198;*;
;;misc_RNA;1917501;1917580;58;*;
fin;comp;CDS;1917639;1918256;;0;
deb;;CDS;2002637;2003182;93;*;
;comp;tRNA;2003276;2003348;52;*;agg
fin;comp;CDS;2003401;2003946;;;
deb;comp;CDS;2024042;2025076;83;*;
;comp;misc_RNA;2025160;2025251;148;*;
fin;;CDS;2025400;2027442;;;
deb;comp;CDS;2069262;2069561;170;*;
;comp;misc_RNA;2069732;2070115;-233;*;
fin;;CDS;2069883;2069975;;0;
deb;;CDS;2076206;2078626;469;*;
;;misc_RNA;2079096;2079203;10;*;
fin;comp;CDS;2079214;2079546;;;
deb;comp;CDS;2094010;2095785;123;*;
;comp;misc_RNA;2095909;2096111;238;*;
fin;comp;CDS;2096350;2096976;;;
deb;comp;CDS;2159981;2161778;-1389;*;
;comp;misc_RNA;2160390;2161194;-630;*;
fin;comp;CDS;2160565;2161086;;;
deb;comp;CDS;2162108;2165614;-2547;*;
;comp;misc_f;2163068;2164222;420;*;
;comp;misc_RNA;2164643;2164894;682;*;
fin;comp;CDS;2165577;2165972;;;
deb;comp;CDS;2208328;2208528;61;*;
;comp;ncRNA;2208590;2208880;-26;*;
fin;comp;CDS;2208855;2208980;;;
deb;comp;CDS;2219514;2219765;-23;*;
;;misc_RNA;2219743;2219849;-66;*;
fin;comp;CDS;2219784;2219960;;;
deb;;CDS;2273594;2273710;-6;*;
;comp;misc_RNA;2273705;2273884;104;*;
fin;comp;CDS;2273989;2274522;;;
deb;comp;CDS;2319440;2320024;88;*;
;comp;misc_RNA;2320113;2320213;141;*;
fin;comp;CDS;2320355;2321860;;;
deb;comp;CDS;2330075;2331232;87;*;
;comp;misc_RNA;2331320;2331720;58;*;
fin;comp;CDS;2331779;2332075;;;
deb;comp;CDS;2410017;2410589;-9;*;
;comp;misc_RNA;2410581;2410888;197;*;
fin;;CDS;2411086;2412663;;0;
deb;comp;CDS;2430258;2431343;129;*;
;comp;misc_RNA;2431473;2431617;119;*;
fin;comp;CDS;2431737;2432081;;;
deb;comp;CDS;2471787;2472746;133;*;
;;misc_RNA;2472880;2473125;25;*;
fin;;CDS;2473151;2473987;;0;
deb;comp;CDS;2548245;2549333;73;*;
;comp;misc_RNA;2549407;2549606;168;*;
fin;;CDS;2549775;2551448;;;
deb;comp;CDS;2562966;2563802;86;*;
;;tRNA;2563889;2563959;66;*;caa
fin;comp;CDS;2564026;2564406;;0;
deb;comp;CDS;2607762;2608649;82;*;
;comp;misc_RNA;2608732;2608906;39;*;
fin;comp;CDS;2608946;2609713;;;
deb;comp;CDS;2624785;2625912;39;*;
;;misc_RNA;2625952;2626042;69;*;
fin;comp;CDS;2626112;2627947;;;
deb;comp;CDS;2646594;2647112;292;*;
;comp;misc_RNA;2647405;2647663;-208;*;
fin;;CDS;2647456;2647614;;0;
deb;;CDS;2678240;2678419;-77;*;
;comp;misc_RNA;2678343;2678565;233;*;
deb;;CDS;2678799;2678888;-13;*;
;comp;misc_RNA;2678876;2679014;127;*;
fin;comp;CDS;2679142;2679585;;;
deb;;CDS;2773356;2773646;136;*;
;;misc_RNA;2773783;2773883;6;*;
fin;comp;CDS;2773890;2777054;;;
deb;comp;CDS;2798174;2800810;79;*;
;comp;misc_RNA;2800890;2801097;43;*;
fin;comp;CDS;2801141;2802202;;0;
deb;comp;CDS;2813643;2814407;83;*;
;comp;misc_RNA;2814491;2814691;51;*;
fin;comp;CDS;2814743;2816521;;;
deb;comp;CDS;2816535;2817809;89;*;
;comp;misc_RNA;2817899;2818131;59;*;
fin;comp;CDS;2818191;2818361;;0;
deb;comp;CDS;2855518;2855826;13;*;
;comp;misc_RNA;2855840;2855915;57;*;
fin;comp;CDS;2855973;2856839;;;
deb;comp;CDS;2866664;2869306;59;*;
;comp;misc_RNA;2869366;2869588;165;*;
fin;;CDS;2869754;2869945;;0;
deb;comp;CDS;2895248;2896972;121;*;
;comp;misc_RNA;2897094;2897340;447;*;
fin;;CDS;2897788;2898123;;;
deb;;CDS;2898931;2899752;63;*;
;comp;tRNA;2899816;2899889;130;*;aga
fin;comp;CDS;2900020;2900529;;;
deb;comp;CDS;2909520;2910746;125;*;
;comp;misc_RNA;2910872;2911051;64;*;
fin;comp;CDS;2911116;2912888;;;
deb;comp;CDS;2952828;2953349;61;*;
;comp;misc_RNA;2953411;2953550;244;*;
fin;;CDS;2953795;2954460;;0;
deb;comp;CDS;2959257;2961188;43;*;
;comp;misc_RNA;2961232;2961479;106;*;
fin;comp;CDS;2961586;2962431;;;
deb;comp;CDS;3033696;3035435;153;*;
;;misc_RNA;3035589;3035721;8;*;
fin;;CDS;3035730;3036332;;0;
deb;comp;CDS;3036603;3037871;23;*;
;comp;misc_RNA;3037895;3038168;44;*;
fin;comp;CDS;3038213;3039931;;0;
deb;comp;CDS;3102629;3105043;109;*;
;comp;misc_RNA;3105153;3105367;102;*;
fin;comp;CDS;3105470;3105805;;0;
deb;comp;CDS;3127825;3129027;167;*;
;comp;misc_RNA;3129195;3129333;196;*;
fin;;CDS;3129530;3131113;;0;
deb;comp;CDS;3169763;3171646;232;*;
;comp;tRNA;3171879;3171950;25;*;gaa
;comp;tRNA;3171976;3172066;3;*;agc
;comp;tRNA;3172070;3172144;10;*;aac
;comp;tRNA;3172155;3172231;15;*;atc
;comp;tRNA;3172247;3172320;10;*;gga
;comp;tRNA;3172331;3172406;17;*;cac
;comp;tRNA;3172424;3172499;12;*;ttc
;comp;tRNA;3172512;3172588;11;*;gac
;comp;tRNA;3172600;3172676;17;*;atgf
;comp;tRNA;3172694;3172786;6;*;tca
;comp;tRNA;3172793;3172869;2;*;atgi
;comp;tRNA;3172872;3172948;19;*;atgj
;comp;tRNA;3172968;3173040;5;*;gca
;comp;tRNA;3173046;3173122;15;*;cca
;comp;tRNA;3173138;3173214;9;*;cgt
;comp;tRNA;3173224;3173309;14;*;tta
;comp;tRNA;3173324;3173398;5;*;ggc
;comp;tRNA;3173404;3173490;10;*;ctg
;comp;tRNA;3173501;3173576;37;*;aaa
;comp;tRNA;3173614;3173689;32;*;aca
;comp;tRNA;3173722;3173797;20;*;gta
;comp;rRNA;3173818;3173935;55;*;5s
;comp;rRNA;3173991;3176918;167;*;23s
;comp;rRNA;3177086;3178640;464;*;16s
;;misc_RNA;3179105;3179206;99;*;
fin;;CDS;3179306;3179884;;0;
deb;;CDS;3187503;3188048;124;*;
;;misc_RNA;3188173;3188341;72;*;
fin;;CDS;3188414;3189082;;;
deb;;CDS;3193863;3194348;106;*;
;comp;tRNA;3194455;3194527;107;*;gcc
fin;comp;CDS;3194635;3195465;;;
deb;;CDS;3335414;3335545;-132;*;
;comp;ncRNA;3335414;3335545;205;*;
fin;comp;CDS;3335751;3336272;;;
deb;comp;CDS;3359995;3360780;156;*;
;comp;misc_RNA;3360937;3361184;-211;*;
fin;comp;CDS;3360974;3361111;;;
deb;comp;CDS;3363266;3364291;105;*;
;comp;misc_RNA;3364397;3364503;114;*;
fin;comp;CDS;3364618;3364962;;;
deb;comp;CDS;3403493;3404437;108;*;
;comp;misc_RNA;3404546;3404676;158;*;
fin;;CDS;3404835;3405626;;0;
deb;comp;CDS;3419656;3421065;103;*;
;comp;misc_RNA;3421169;3421348;116;*;
fin;comp;CDS;3421465;3421605;;0;
deb;comp;CDS;3449732;3450526;185;*;
;comp;misc_RNA;3450712;3451071;176;*;
fin;comp;CDS;3451248;3451718;;;
deb;comp;CDS;3489910;3491253;68;*;
;comp;misc_RNA;3491322;3491557;97;*;
fin;comp;CDS;3491655;3492689;;;
deb;;CDS;3544642;3545604;284;*;
;comp;tRNA;3545889;3545964;269;*;cgg
fin;;CDS;3546234;3546827;;0;
deb;comp;CDS;3854256;3856172;53;*;
;comp;misc_RNA;3856226;3856447;31;*;
;comp;misc_RNA;3856479;3856700;81;*;
fin;comp;CDS;3856782;3856937;;;
deb;;CDS;3946394;3946909;0;*;
;;misc_RNA;3946910;3947116;41;*;
fin;;CDS;3947158;3948399;;;
deb;comp;CDS;3987927;3988763;76;*;
;comp;misc_RNA;3988840;3988942;388;*;
fin;;CDS;3989331;3989873;;0;
deb;;CDS;3997221;3997709;65;*;
;;misc_RNA;3997775;3997881;82;*;
deb;;CDS;3997964;3999097;68;*;
;;misc_RNA;3999166;3999272;77;*;
fin;;CDS;3999350;4000486;;0;
deb;comp;CDS;4004288;4005136;386;*;
;;misc_RNA;4005523;4005625;126;*;
fin;;CDS;4005752;4006945;;0;
deb;comp;CDS;4095915;4096907;89;*;
;;misc_RNA;4096997;4097409;6;*;
fin;;CDS;4097416;4098150;;;
deb;comp;CDS;4153696;4154403;383;*;
;comp;tRNA;4154787;4154859;35;*;ttc
;comp;tRNA;4154895;4154971;81;*;gac
;comp;tRNA;4155053;4155124;9;*;gaa
;comp;tRNA;4155134;4155209;223;*;aaa
fin;comp;CDS;4155433;4156725;;;
deb;comp;CDS;4169166;4169612;189;*;
;comp;misc_RNA;4169802;4169919;125;*;
fin;;CDS;4170045;4171352;;0;

bsu intercalaires entre cds[modifier | modifier le wikicode]

bsu intercalaires positifs S+[modifier | modifier le wikicode]

bsu Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
eco;min20;1003;2130;3133;735;296;440;144;-178;-64;287;;;
bsu;min10;1028;2444;3472;659;8;282;274;152;257;470;;;
rtb;min30;118;402;520;536;-105;148;253;-277;-165;202;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
63;348;0.18;1169;2855;11;6;80;226;126;821;-119;;;
140;333;0.42;1125;3091;2;8;31;186;302;936;-432;;;
51;294;0.17;189;604;5;7;21;162;8;131;-81;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
bsu;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;&-7;-5;-3;1;R2;flex c+;comment.
1 à 400;-6.4;69;-338;67;458;359;max40;&-41;352;-1040;112;790;286;min50
51 à 400;48;-359;711;-11;861;249;2 parties;&12;-27;-230;64;954;75;2 parties
droite;-a;cste;-;R2;note;R2’;;&-a;cste;-;R2;note;R2’;
1 à 400;152;56;-;440;dte;18;max40;&211;68;;617;poly;173;SF
51 à 400;94;40;-;694;poly;167;tF;&145;50;-;850;poly;104;tF
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30 40 50, t30 t50.
  • Corrélations et fréquences faibles
;400;200;250;;;;;corrélation;;;;;;
;coefficient de corrélation fx fc;;;;;;;-0.432;;;;;;
41-n;0.660;0.008;0.283;;;;;;;;;;;
1-n;0.471;0.152;0.258;;;;;;;;;20.2.22;;
bsu;fx;fc;;bsu;fx%;fc%;;fx40;fc40;;x;bsu;Sx-;Sc-
0;2;25;;0;2;10;0;2;25;>0;1088;-1;0;72
10;28;231;;10;27;95;1;3;41;<0;35;-2;0;4
20;46;398;;20;45;163;2;2;31;zéro;2;-3;0;0
30;70;185;;30;68;76;3;3;34;total;1125;-4;14;229
40;158;121;;40;154;50;4;2;27;;c;-5;0;0
50;81;84;;50;79;34;5;3;19;>0;2490;-6;2;0
60;22;92;;60;21;38;6;0;21;<0;573;-7;1;11
70;21;119;;70;20;49;7;5;16;zéro;25;-8;1;75
80;32;121;;80;31;50;8;3;7;;3088;-9;1;0
90;22;112;;90;21;46;9;3;16;;;-10;1;5
100;25;91;;100;24;37;10;4;19;total;4213;-11;1;43
110;24;106;;110;23;43;11;0;32;;;-12;0;0
120;39;87;;120;38;36;12;3;53;;;-13;0;6
130;41;86;;130;40;35;13;5;46;;;-14;1;19
140;27;66;;140;26;27;14;12;47;;;-15;0;0
150;42;68;;150;41;28;15;4;52;;;-16;1;5
160;34;66;;160;33;27;16;3;31;;;-17;0;18
170;33;58;;170;32;24;17;6;41;;;-18;0;0
180;29;53;;180;28;22;18;5;44;;;-19;1;4
190;25;34;;190;24;14;19;5;23;;;-20;1;11
200;19;34;;200;18;14;20;3;29;;;-21;0;0
210;28;30;;210;27;12;21;2;25;;;-22;0;2
220;17;14;;220;17;6;22;2;29;;;-23;0;8
230;24;20;;230;23;8;23;3;22;;;-24;0;0
240;16;27;;240;16;11;24;7;24;;;-25;1;1
250;16;18;;250;16;7;25;4;15;;;-26;0;8
260;13;13;;260;13;5;26;13;12;;;-27;0;0
270;19;16;;270;18;7;27;12;12;;;-28;0;0
280;13;16;;280;13;7;28;3;14;;;-29;0;6
290;13;6;;290;13;2;29;10;17;;;-30;0;0
300;6;9;;300;6;4;30;14;15;;;-31;0;1
310;8;8;;310;8;3;31;9;16;;;-32;0;2
320;5;6;;320;5;2;32;10;12;;;-33;0;0
330;1;8;;330;1;3;33;16;18;;;-34;0;1
340;8;9;;340;8;4;34;11;7;;;-35;0;3
350;5;6;;350;5;2;35;16;11;;;-36;0;0
360;4;4;;360;4;2;36;19;13;;;-37;0;1
370;4;2;;370;4;1;37;13;5;;;-38;0;2
380;4;7;;380;4;3;38;17;11;;;-39;0;0
390;5;8;;390;5;3;39;26;21;;;-40;1;1
400;1;2;;400;1;1;40;21;7;;;-41;0;8
reste;60;49;;;;;reste;786;1555;;;-42;1;0
total;1090;2515;;t30;140;333;total;1090;2515;;;-43;0;3
diagr;1028;2441;;t50;373;417;diagr;302;935;;;-44;0;2
 - t30;884;1627;;;;;;;;;;-45;0;0
 - t50;645;1422;;;;;;;;;;-46;0;0
;;;;;;;;;;;;-47;0;2
;;;;;;;;;;;;-48;0;0
;;;;;;;;;;;;-49;0;1
;;;;;;;;;;;;-50;0;2
;;;;;;;;;;;;reste;7;17
;;;;;;;;;;;;total;35;573

bsu intercalaires négatifs S-[modifier | modifier le wikicode]

bsu;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;;
comp’;;;;10;;2;1;1;1;;1;;;1;;1;;;1;1;;;;;1;;;;;;;;;;;;;;;1;;1;;;;;;;;;7;30
continu;72;4;0;233;0;0;11;75;0;6;43;0;6;19;0;5;18;0;4;11;0;2;8;0;1;8;0;0;6;0;1;2;0;1;3;0;1;2;0;1;8;0;3;2;0;0;2;0;1;2;17;578
  • 14.8.21
14.8.21 Paris;bsu;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;0;0;14;0;2;1;1;1;1;1;0;0;1;0;1;0;0;1;1;0;0;0;0;1;0;0;0;0;0;0;0;0;0;0;0;0;0;0;1;0;1;0;0;0;0;0;0;0;0;7;35
;Sc-;72;4;0;229;0;0;11;75;0;5;43;0;6;19;0;5;18;0;4;11;0;2;8;0;1;8;0;0;6;0;1;2;0;1;3;0;1;2;0;1;8;0;3;2;0;0;2;0;1;2;17;573

bsu autres intercalaires[modifier | modifier le wikicode]

23.2.22;;;;;;;;;;;;;;;;;;;;;;
bsu;autres intercalaires;;adresses1;;;bsu;autres intercalaires;;adresses2;;;bsu;autres intercalaires;;adresses3;;;bsu;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;6994;350;;;deb;°CDS;634651;333;comp;;deb;°CDS;1629320;144;;;deb;°CDS;2909520;125;
;$rRNA;9810;99;;;;&tRNA;635110;13;;;;misc_R;1630115;161;;;;misc_R;2910872;64;
;&tRNA;11464;11;;;;&tRNA;635200;159;;;fin;°CDS;1630382;;;;fin;°CDS;2911116;;
;&tRNA;11552;81;;;;$rRNA;635433;167;;;deb;°CDS;1675171;78;;;deb;°CDS;2952828;61;
;$rRNA;11709;55;;;;$rRNA;637155;55;;;;misc_R;1675981;19;;;;misc_R;2953411;244;
;$rRNA;14692;36;;;;$rRNA;640138;13;;;fin;°CDS;1676042;;;;fin;°CDS;2953795;;
fin;°CDS;14847;;comp;;;&tRNA;640268;60;;;deb;°CDS;1727133;10;;;deb;°CDS;2959257;43;
deb;°CDS;19968;52;;;;&tRNA;640405;180;;;;misc_R;1731457;101;;;;misc_R;2961232;106;
;misc_R;20611;56;;;fin;°CDS;640662;;;;fin;°CDS;1731776;;;;fin;°CDS;2961586;;
deb;°CDS;20880;134;;;deb;°CDS;692740;143;;;deb;°CDS;1778337;183;;;deb;°CDS;3033696;153;
;&tRNA;22292;111;;;;misc_R;694425;134;;;;misc_R;1780404;63;;;;misc_R;3035589;8;
fin;°CDS;22496;;comp;;fin;°CDS;694662;;;;fin;°CDS;1780618;;;;fin;°CDS;3035730;;
deb;°CDS;25852;41;;;deb;°CDS;698092;79;;;deb;°CDS;1914630;-4;;;deb;°CDS;3036603;23;
;misc_R;26379;81;;;;misc_R;698369;140;;;;misc_R;1914992;-52;;;;misc_R;3037895;44;
fin;°CDS;26814;;;;fin;°CDS;698612;;;;fin;°CDS;1915221;;;;fin;°CDS;3038213;;
deb;°CDS;29772;243;;;deb;°CDS;945520;291;;;deb;°CDS;1916955;198;;;deb;°CDS;3102629;109;
;$rRNA;30279;99;;;;$rRNA;946696;167;;;;misc_R;1917501;58;;;;misc_R;3105153;102;
;&tRNA;31932;11;;;;$rRNA;948418;111;;;fin;°CDS;1917639;;;;fin;°CDS;3105470;;
;&tRNA;32020;81;;;;$rRNA;951457;9;;;deb;°CDS;2002637;93;;;deb;°CDS;3127825;167;
;$rRNA;32177;133;;;;&tRNA;951582;5;;;;&tRNA;2003276;52;comp;;;misc_R;3129195;196;
;$rRNA;35237;175;;;;&tRNA;951662;34;;;fin;°CDS;2003401;;comp;;fin;°CDS;3129530;;
fin;°CDS;35531;;;;;&tRNA;951788;9;;;deb;°CDS;2024042;83;;;deb;°CDS;3169763;232;comp
deb;°CDS;69626;168;;;;&tRNA;951869;9;;;;misc_R;2025160;148;;;;&tRNA;3171879;25;comp
;&tRNA;70181;9;;;;&tRNA;951954;11;;;fin;°CDS;2025400;;;;;&tRNA;3171976;3;comp
;&tRNA;70267;199;;;;&tRNA;952042;12;;;deb;°CDS;2069262;170;;;;&tRNA;3172070;10;comp
fin;°CDS;70538;;;;;&tRNA;952131;5;;;;misc_R;2069732;-233;;;;&tRNA;3172155;15;comp
deb;°CDS;88727;309;;;;&tRNA;952212;22;;;fin;°CDS;2069883;;;;;&tRNA;3172247;10;comp
;$rRNA;90536;164;;;;&tRNA;952307;5;;;deb;°CDS;2076206;469;;;;&tRNA;3172331;17;comp
;$rRNA;92254;55;;;;&tRNA;952397;24;;;;misc_R;2079096;10;;;;&tRNA;3172424;12;comp
;$rRNA;95237;20;;;;&tRNA;952495;9;;;fin;°CDS;2079214;;;;;&tRNA;3172512;11;comp
;&tRNA;95375;4;;;;&tRNA;952580;49;;;deb;°CDS;2094010;123;;;;&tRNA;3172600;17;comp
;&tRNA;95455;36;;;;&tRNA;952701;5;;;;misc_R;2095909;238;;;;&tRNA;3172694;6;comp
;&tRNA;95567;6;;;;&tRNA;952781;7;;;fin;°CDS;2096350;;;;;&tRNA;3172793;2;comp
;&tRNA;95649;40;;;;&tRNA;952859;265;;;deb;°CDS;2159981;-1389;;;;&tRNA;3172872;19;comp
;&tRNA;95772;14;;;;&tRNA;953213;78;;;;misc_R;2160390;-630;;;;&tRNA;3172968;5;comp
;&tRNA;95861;9;;;fin;°CDS;953373;;comp;;fin;°CDS;2160565;;;;;&tRNA;3173046;15;comp
;&tRNA;95956;27;;;deb;°CDS;954893;69;;;deb;°CDS;2162108;-2547;;;;&tRNA;3173138;9;comp
;&tRNA;96060;9;;;;misc_R;955655;132;;;;misc_f;2163068;420;;;;&tRNA;3173224;14;comp
;&tRNA;96146;170;;;fin;°CDS;955895;;;;;misc_R;2164643;682;;;;&tRNA;3173324;5;comp
;$rRNA;96392;164;;;deb;°CDS;966671;193;comp;;fin;°CDS;2165577;;;;;&tRNA;3173404;10;comp
;$rRNA;98110;55;;;;&tRNA;967065;90;;;deb;°CDS;2208328;61;;;;&tRNA;3173501;37;comp
;$rRNA;101093;237;;;fin;°CDS;967229;;comp;;;ncRNA;2208590;-26;;;;&tRNA;3173614;32;comp
fin;°CDS;101449;;;;deb;°CDS;1178757;89;;;fin;°CDS;2208855;;;;;&tRNA;3173722;20;comp
deb;°CDS;119111;45;;;;misc_R;1180685;106;;;deb;°CDS;2219514;-23;;;;$rRNA;3173818;55;comp
;misc_R;119855;65;;;fin;°CDS;1180909;;;;;misc_R;2219743;-66;;;;$rRNA;3173991;167;comp
fin;°CDS;120061;;;;deb;°CDS;1218113;58;;;fin;°CDS;2219784;;;;;$rRNA;3177086;464;comp
deb;°CDS;152937;56;;;;misc_R;1219164;470;;;deb;°CDS;2273594;-6;;;;misc_R;3179105;99;
;misc_R;153737;48;;;fin;°CDS;1219849;;;;;misc_R;2273705;104;;;fin;°CDS;3179306;;
fin;°CDS;153842;;;;deb;°CDS;1233133;104;;;fin;°CDS;2273989;;;;deb;°CDS;3187503;124;
deb;°CDS;159779;349;comp;;;misc_R;1233405;70;;;deb;°CDS;2319440;88;;;;misc_R;3188173;72;
;$rRNA;160893;164;;;fin;°CDS;1233614;;;;;misc_R;2320113;141;;;fin;°CDS;3188414;;
;$rRNA;162610;55;;;deb;°CDS;1240356;61;;;fin;°CDS;2320355;;;;deb;°CDS;3193863;106;
;$rRNA;165591;46;;;;misc_R;1242262;78;;;deb;°CDS;2330075;87;;;;&tRNA;3194455;107;comp
;&tRNA;165754;4;;;fin;°CDS;1242449;;;;;misc_R;2331320;58;;;fin;°CDS;3194635;;comp
;&tRNA;165830;56;;;deb;°CDS;1257414;167;;;fin;°CDS;2331779;;;;deb;°CDS;3334646;423;
;&tRNA;165959;30;;;;misc_R;1258304;67;;;deb;°CDS;2410017;-9;;;;ncRNA;3335414;205;
;&tRNA;166064;27;;;fin;°CDS;1258492;;;;;misc_R;2410581;197;;;fin;°CDS;3335751;;
;&tRNA;166168;8;;;deb;°CDS;1261426;172;comp;;fin;°CDS;2411086;;;;deb;°CDS;3359995;156;
;&tRNA;166253;171;;;;&tRNA;1262789;840;;;deb;°CDS;2430258;129;;;;misc_R;3360937;-211;
;$rRNA;166500;164;;;fin;°CDS;1263702;;comp;;;misc_R;2431473;119;;;fin;°CDS;3360974;;
;$rRNA;168218;55;;;deb;°CDS;1375777;32;;;fin;°CDS;2431737;;;;deb;°CDS;3363266;105;
;$rRNA;171197;183;;;;misc_R;1376328;77;;;deb;°CDS;2471787;133;;;;misc_R;3364397;114;
;$rRNA;171498;164;;;fin;°CDS;1376517;;;;;misc_R;2472880;25;;;fin;°CDS;3364618;;
;$rRNA;173214;55;;;deb;°CDS;1377243;87;;;fin;°CDS;2473151;;;;deb;°CDS;3403493;108;
;$rRNA;176197;767;;;;misc_R;1378233;52;;;deb;°CDS;2548245;73;;;;misc_R;3404546;158;
fin;°CDS;177083;;;;fin;°CDS;1378496;;;;;misc_R;2549407;168;;;fin;°CDS;3404835;;
deb;°CDS;193570;179;comp;;deb;°CDS;1383320;127;;;fin;°CDS;2549775;;;;deb;°CDS;3419656;103;
;&tRNA;194205;3;;;;misc_R;1385736;132;;;deb;°CDS;2562966;86;comp;;;misc_R;3421169;116;
;&tRNA;194283;4;;;fin;°CDS;1386024;;;;;&tRNA;2563889;66;;;fin;°CDS;3421465;;
;&tRNA;194363;22;;;deb;°CDS;1391040;96;;;fin;°CDS;2564026;;comp;;deb;°CDS;3449732;185;
;&tRNA;194458;4;;;;misc_R;1391739;101;;;deb;°CDS;2607762;82;;;;misc_R;3450712;176;
;&tRNA;194547;227;;;fin;°CDS;1391953;;;;;misc_R;2608732;39;;;fin;°CDS;3451248;;
fin;°CDS;194849;;;;deb;°CDS;1395371;113;;;fin;°CDS;2608946;;;;deb;°CDS;3489910;68;
deb;°CDS;198497;173;;;;misc_R;1395622;237;;;deb;°CDS;2624785;39;;;;misc_R;3491322;97;
;misc_R;200017;89;;;fin;°CDS;1396013;;;;;misc_R;2625952;69;;;fin;°CDS;3491655;;
fin;°CDS;200277;;;;deb;°CDS;1409912;55;;;fin;°CDS;2626112;;;;deb;°CDS;3544642;284;
deb;°CDS;275838;56;;;;misc_R;1410633;-113;;;deb;°CDS;2646594;292;;;;&tRNA;3545889;269;comp
;misc_R;276815;97;;;fin;°CDS;1410654;;;;;misc_R;2647405;-208;;;fin;°CDS;3546234;;
fin;°CDS;277160;;;;deb;°CDS;1423241;92;;;fin;°CDS;2647456;;;;deb;°CDS;3854256;53;
deb;°CDS;473803;103;;;;misc_R;1424527;83;;;deb;°CDS;2678240;-77;;;;misc_R;3856226;31;
;misc_R;474329;133;;;fin;°CDS;1424767;;;;;misc_R;2678343;233;;;;misc_R;3856479;81;
fin;°CDS;474731;;;;deb;°CDS;1425641;38;;;deb;°CDS;2678799;-13;;;fin;°CDS;3856782;;
deb;°CDS;483845;135;;;;misc_R;1426876;84;;;;misc_R;2678876;127;;;deb;°CDS;3946394;0;
;misc_R;486092;196;;;fin;°CDS;1427061;;;;fin;°CDS;2679142;;;;;misc_R;3946910;41;
fin;°CDS;486432;;;;deb;°CDS;1438092;138;;;deb;°CDS;2773356;136;;;fin;°CDS;3947158;;
deb;°CDS;528129;122;;;;misc_R;1439274;129;;;;misc_R;2773783;6;;;deb;°CDS;3987927;76;comp
;&tRNA;528704;4;;;fin;°CDS;1439448;;;;fin;°CDS;2773890;;;;;misc_R;3988840;388;comp
;&tRNA;528783;29;;;deb;°CDS;1456092;46;;;deb;°CDS;2798174;79;comp;;fin;°CDS;3989331;;
;&tRNA;528903;11;;;;misc_R;1457005;30;;;;misc_R;2800890;43;comp;;deb;°CDS;3997221;65;
;&tRNA;528986;26;;;fin;°CDS;1457187;;;;fin;°CDS;2801141;;comp;;;misc_R;3997775;82;
;&tRNA;529087;11;;;deb;°CDS;1482248;85;;;deb;°CDS;2813643;83;;;deb;°CDS;3997964;68;
;&tRNA;529174;80;;;;misc_R;1483557;476;;;;misc_R;2814491;51;;;;misc_R;3999166;77;
;&tRNA;529336;82;;;fin;°CDS;1484117;;;;fin;°CDS;2814743;;;;fin;°CDS;3999350;;
fin;°CDS;529505;;comp;;deb;°CDS;1533327;368;;;deb;°CDS;2816535;89;;;deb;°CDS;4004288;386;
deb;°CDS;532292;30;;;;misc_R;1534070;-161;;;;misc_R;2817899;59;;;;misc_R;4005523;126;
;misc_R;532583;115;;;fin;°CDS;1534120;;;;fin;°CDS;2818191;;;;fin;°CDS;4005752;;
fin;°CDS;532758;;;;deb;°CDS;1568924;2;;;deb;°CDS;2855518;13;;;deb;°CDS;4095915;89;
deb;°CDS;559264;67;;;;misc_R;1569199;199;;;;misc_R;2855840;57;;;;misc_R;4096997;6;
;misc_R;559532;540;;;fin;°CDS;1569519;;;;fin;°CDS;2855973;;;;fin;°CDS;4097416;;
fin;°CDS;560151;;;;deb;°CDS;1606560;12;;;deb;°CDS;2866664;59;;;deb;°CDS;4153696;383;comp
deb;°CDS;625125;54;;;;misc_R;1607367;87;;;;misc_R;2869366;165;;;;&tRNA;4154787;35;comp
;misc_R;626346;175;;;fin;°CDS;1607556;;;;fin;°CDS;2869754;;;;;&tRNA;4154895;81;comp
fin;°CDS;626622;;;;deb;°CDS;1612521;62;;;deb;°CDS;2895248;121;;;;&tRNA;4155053;9;comp
&emsp*;;;;;;;misc_R;1613078;52;;;;misc_R;2897094;447;;;;&tRNA;4155134;223;comp
&emsp*;;;;;;fin;°CDS;1613357;;;;fin;°CDS;2897788;;;;fin;°CDS;4155433;;comp
&emsp*;;;;;;deb;°CDS;1617210;39;;;deb;°CDS;2898931;63;;;deb;°CDS;4169166;189;
&emsp*;;;;;;;misc_R;1618161;26;;;;&tRNA;2899816;130;comp;;;misc_R;4169802;125;
&emsp*;;;;;;deb;°CDS;1618304;3;;;fin;°CDS;2900020;;comp;;fin;°CDS;4170045;;
&emsp*;;;;;;;misc_R;1618853;52;;;&emsp*;;;;;;&emsp*;;;;
&emsp*;;;;;;deb;°CDS;1619023;0;;;&emsp*;;;;;;&emsp*;;;;
&emsp*;;;;;;;misc_R;1620331;30;;;&emsp*;;;;;;&emsp*;;;;
&emsp*;;;;;;fin;°CDS;1620476;;;;&emsp*;;;;;;&emsp*;;;;

bsu distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;1;tct;;tat;;atgf;2
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
avant 16s;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
cgt;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
gga;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;1;tgc;;;;;;;;;;;;ttc;2;tcc;1;tac;1;tgc;1
;atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;;;;;;;;;;atc;1;acc;1;aac;3;agc;1
après 5s;ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;3
atgf;gtc;1;gcc;1;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;2;ggc;4
gac;tta;;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;1;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;1;aaa;2;aga;;;;;;;;;;;;ata;;aca;3;aaa;2;aga;
;cta;;cca;;caa;1;cga;;;cta;1;cca;;caa;2;cga;;;;;;;;;;;;cta;1;cca;3;caa;1;cga;
;gta;;gca;;gaa;;gga;1;;gta;1;gca;;gaa;4;gga;;;;;;;;;;;;gta;3;gca;3;gaa;2;gga;1
;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;1
;atgj;;acg;;aag;;agg;1;;atgj;1;acg;;aag;;agg;;;;;;;;;;;;atgj;1;acg;;aag;;agg;
;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;1;ccg;;cag;;cgg;
;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;bsu;;8;;;;;8;;bsu;18;;;;;;18;;;;;;;;;;;bsu;;;;52;2;;56
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2   1-3aas;;;

bsu lmo[modifier | modifier le wikicode]

bsu-lmo  comparaison;;10.11.19 Tanger;;;comparaisons internes bsu, lmo;;;;
bsu;intercal;lmo;intercal;diff;bsu;intercal;bsu;intercal;diff
gaa;25;gaa;5;-20;16s;167;16s;167;
agc;3;agc;34;31;23s;55;23s;111;
aac;10;aac;6;-4;5s;20;5s;9;
atc;15;atc;25;10;gta;32;aac;5;
gga;10;gga;23;13;aca;37;tcc;34;
cac;17;cac;28;11;aaa;10;gaa;9;
ttc;12;ttc;4;-8;ctg;5;gta;9;
gac;11;gac;4;-7;ggc;14;atgf;11;0
atgf;17;atgf;42;25;tta;9;gac;12;0
tca;6;tca;22;16;cgt;15;ttc;5;
atgi;2;atgi;11;9;cca;5;aca;22;
atgj;19;atgj;42;23;gca;19;tac;5;
gca;5;gca;22;17;atgj;2;tgg;24;
cca;15;cca;10;-5;atgi;6;cac;9;
cgt;9;cgt;9;0;tca;17;caa;49;
tta;14;tta;14;0;atgf;11;ggc;5;
ggc;5;ggc;15;10;gac;12;tgc;7;
ctg;10;cta;5;-5;ttc;17;tta;265;
aaa;37;aaa;41;4;cac;10;ttg;;
aca;32;aca;8;-24;gga;15;;;
gta;20;gta;13;;atc;10;16s;164;
5s;55;5s;81;;aac;3;23s;55;
23s;167;23s;244;;agc;25;5s;20;
16s;;16s;;;gaa;;gta;4;-28
;;;;;;;aca;36;-1
16s;167;16s;127;;;;aaa;6;-4
23s;111;atc;46;;;;cta;40;35
5s;9;gca;172;;;;ggc;14;0
aac;5;23s;80;;;;tta;9;0
tcc;34;5s;14;;;;cgt;27;12
gaa;9;aac;6;1;;;cca;9;4
gta;9;tcc;33;-1;;;gca;170;
atgf;11;gaa;56;47;;;;;
gac;12;gta;21;12;lmo;intercal;lmo;intercal;diff
ttc;5;atgf;6;-5;16s;244;16s;127;
aca;22;gac;4;-8;23s;81;atc;46;
tac;5;ttc;20;;5s;13;gca;172;
tgg;24;tac;7;2;gta;8;23s;80;
cac;9;tgg;15;-9;aca;41;5s;14;
caa;49;cac;29;20;aaa;5;aac;6;
ggc;5;caa;5;-44;cta;15;tcc;33;
tgc;7;ggc;19;14;ggc;14;gaa;56;
tta;265;tgc;45;;tta;9;gta;21;
ttg;;ttg;;;cgt;10;atgf;6;2
;;;;;cca;22;gac;4;0
16s;164;16s;244;;gca;42;ttc;20;
23s;55;23s;80;;atgj;11;tac;7;
5s;20;5s;13;;atgi;22;tgg;15;
gta;4;gta;8;4;tca;42;cac;29;
aca;36;aca;41;5;atgf;4;caa;5;
aaa;6;aaa;5;-1;gac;4;ggc;19;
cta;40;cta;14;-26;ttc;28;tgc;45;
ggc;14;ggc;21;7;cac;23;ttg;;
tta;9;tta;12;3;gga;25;;;
cgt;27;cgt;10;-17;atc;6;16s;244;
cca;9;cca;19;10;aac;34;23s;80;
gca;170;gca;341;;agc;5;5s;13;
;;;;;gaa;;gta;8;0
;;;;;;;aca;41;0
;;;;;;;aaa;5;0
;;;;;;;cta;14;-1
;;;;;;;ggc;21;7
;;;;;;;tta;12;3
;;;;;;;cgt;10;0
;;;;;;;cca;19;-3
;;;;;;;gca;341;
;;;;;;;;;
bsu;intercal;lmo;intercal;diff;entre génomes;;;intra génome;
gaa;3;gaa;157;;gamme;fréquence;;gamme;fréquence
gta;4;acg;9;;-15;5;;-7;1
aca;22;tac;11;;-14;;;-6;
tac;4;caa;6;;-13;;;-5;
caa;;aaa;;;-12;;;-4;1
;;;;;-11;;;-3;1
aga;;aga;;;-10;;;-2;
;;;;;-9;1;;-1;2
cgg;;cgg;;;-8;2;;0;9
;;;;;-7;1;;1;
gga;;gga;;;-6;;;2;1
;;;;;-5;3;;3;1
gtc;;gtc;;;-4;1;;4;1
;;;;;-3;;;5;
agg;;cgt;;;-2;;;6;
;;;;;-1;2;;7;1
caa;;ctc;;;0;2;;;2
;;;;;1;1;;total;20
gcc;;tcg;;;2;1;; -2+2;11
;;;;;3;1;;;
tca;;;;;4;2;;;
;;;;;5;1;;;
atg;9;aac;3;;6;;;;
gaa;;agc;;;7;1;;;
;;;;;8;;;;
;;gaa;27;;9;1;;;
;;gac;;;10;3;;;
;;;;;11;1;;;
cgt;13;16s;127;;12;1;;;
gga;159;atc;46;;13;1;;;
16s;167;gca;172;;14;1;;;
23s;55;23s;80;;15;;;;
5s;13;5s;14;;;7;;;
atgf;60;aac;24;;total;39;;;
gac;;acc;;; -2+2;6;;;

Listeria monocytogenes[modifier | modifier le wikicode]

lmo[modifier | modifier le wikicode]

  • Lien tableau: lmo
Listeria monocytogenes EGD-e;;;;
37.9%GC;7.3.19 Paris;67;doubles;intercal
;82705..82777;aag;;
;237466..239020;16s;@1;244
;239265..242195;23s;;80
;242276..242385;5s;;13
;242399..242471;gta;;8
;242480..242555;aca;;41
;242597..242669;aaa;;5
;242675..242756;cta;;14
;242771..242842;ggc;;21
;242864..242949;tta;;12
;242962..243035;cgt;;10
;243046..243119;cca;;19
;243139..243214;gca;;341
;243556..245041;16s;;244
;245286..248216;23s;;80
;248297..248406;5s;;
;;;;
;677464..677553;tcg;;
;;;;
;936656..936728;aac;;3
;936732..936819;agc;;
;;;;
;940017..940088;gaa;;27
;940116..940188;gac;;
;;;;
;970867..970937;gga;;
;;;;
;1266675..1266748;aga;;
;;;;
comp;1740916..1740987;gaa;;5
comp;1740993..1741083;agc;;34
comp;1741118..1741190;aac;;6
comp;1741197..1741270;atc;;25
comp;1741296..1741366;gga;;23
comp;1741390..1741462;cac;;28
comp;1741491..1741563;ttc;;4
comp;1741568..1741643;gac;;4
comp;1741648..1741721;atgf;;42
comp;1741764..1741853;tca;;22
comp;1741876..1741949;atgi;;11
comp;1741961..1742034;atgj;;42
comp;1742077..1742149;gca;;22
comp;1742172..1742245;cca;;10
comp;1742256..1742329;cgt;;9
comp;1742339..1742424;tta;;14
comp;1742439..1742513;ggc;;15
comp;1742529..1742610;cta;;5
comp;1742616..1742688;aaa;;41
comp;1742730..1742805;aca;;8
comp;1742814..1742886;gta;;13
comp;1742900..1743009;5s;;81
comp;1743091..1746021;23s;;244
comp;1746266..1747811;16s;;
;;;;
;1776112..1776183;cgt;;
;;;;
comp;1848821..1848930;5s;;81
comp;1849012..1851942;23s;;244
comp;1852187..1853732;16s;;
;;;;
;2162187..2162273;ctc;;
;;;;
;2215375..2215446;gaa;;157
;2215604..2215677;acg;;9
;2215687..2215770;tac;;11
;2215782..2215856;caa;;6
;2215863..2215935;aaa;;
;;;;
comp;2436493..2436576;ttg;;45
comp;2436622..2436695;tgc;;19
comp;2436715..2436786;ggc;;5
comp;2436792..2436863;caa;;29
comp;2436893..2436965;cac;;15
comp;2436981..2437054;tgg;;7
comp;2437062..2437145;tac;;20
comp;2437166..2437238;ttc;;4
comp;2437243..2437318;gac;;6
comp;2437325..2437398;atgf;;21
comp;2437420..2437495;gta;;56
comp;2437552..2437623;gaa;;33
comp;2437657..2437745;tcc;;6
comp;2437752..2437827;aac;;14
comp;2437842..2437951;5s;;80
comp;2438032..2440962;23s;;172
comp;2441135..2441210;gca;;46
comp;2441257..2441330;atc;;127
comp;2441458..2443003;16s;@2;
;;;;
comp;2540230..2540301;cgg;;
;;;;
comp;2672664..2672736;acc;;24
comp;2672761..2672836;aac;;14
comp;2672851..2672960;5s;;80
comp;2673041..2675971;23s;;172
comp;2676144..2676219;gca;;46
comp;2676266..2676339;atc;;127
comp;2676467..2678012;16s;;
;;;;
;2930362..2930434;gtc;;

lmo distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;1;tct;;tat;;atgf;2
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
après 5s;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
acc;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
aac;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;1;tgc;;;;;;;;;;;;ttc;2;tcc;1;tac;1;tgc;1
;atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;;;;;;;;;;atc;1;acc;0;aac;2;agc;1
;ctc;1;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;2
;gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;2;ggc;3
;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;2;tca;1;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;;aaa;1;aga;;;;;;;;;;;;ata;;aca;2;aaa;2;aga;
;cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;;;;;;;;;;cta;2;cca;2;caa;1;cga;
;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;2;gga;;;;;;;;;;;;gta;3;gca;2;gaa;2;gga;1
;ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;1
;atgj;;acg;;aag;1;agg;;;atgj;;acg;1;aag;;agg;;;;;;;;;;;;atgj;1;acg;;aag;;agg;
;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;lmo;;8;;;;;8;;lmo;9;;;;;;9;;;;;;;;;;;lmo;;;;44;;;44
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2   1-3aas;;;

lmo données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: lmo données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
  • Note du 01/12/22: remaniement des tRNAin en 2*46 gca atc seulement. Le reste est mis dans contig.
;CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA tRNA;;tRNA tRNA;;reste;Sup 400
;effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;lmo;long;long
;fxt;fct;lmo;fx;fc;lmo;fx40;fc40;lmo;x-;c-;c;x;c;aa;c;aa;fx;fc
0;;0;0;1;27;0;1;27;-1;;61;87;68;tRNA 16s;;tRNA tRNA;contig;403;401
10;;0;10;10;183;1;1;32;-2;;0;181;940;341;gca;5;gaa;403;402
20;;0;20;20;345;2;2;40;-3;;0;52;370;16s tRNA;;34;agc;408;403
30;;1;30;20;147;3;1;33;-4;3;173;382;73;2* 127;atc;6;aac;422;405
40;;0;40;80;64;4;0;11;-5;;0;197;132;tRNA 23s;;25;atc;424;411
50;2;0;50;79;45;5;2;19;-6;;0;127;49;2* 172;gca;23;gga;427;412
60;1;1;60;21;46;6;0;16;-7;;0;99;333;5s tRNA;;28;cac;440;423
70;1;1;70;12;69;7;0;5;-8;;57;110;118;2* 13;gta;4;ttc;441;425
80;1;0;80;13;69;8;3;5;-9;;0;366;56;2* 14;aac;4;gac;447;428
90;;1;90;10;69;9;1;13;-10;1;3;66;44;tRNA tRNA;intra;42;atgf;447;429
100;;1;100;9;54;10;0;9;-11;2;22;128;;2* 46;gca;22;tca;449;432
110;;1;110;9;88;11;1;26;-12;;0;351;;**;atc;11;atgi;450;440
120;1;1;120;14;74;12;2;52;-13;;3;119;;tRNA tRNA;;42;atgj;454;441
130;;2;130;21;57;13;3;31;-14;;14;152;;3;aac;22;gca;464;451
140;1;0;140;14;52;14;0;36;-15;;0;21;;**;agc;10;cca;478;451
150;;0;150;13;48;15;4;46;-16;1;2;CDS 16s;;27;gaa;9;cgt;484;454
160;;1;160;26;42;16;0;42;-17;;13;445;;**;gac;14;tta;495;456
170;;0;170;15;28;17;2;21;-18;1;0;451;;157;gaa;15;ggc;498;460
180;;0;180;11;30;18;3;43;-19;;2;344;;9;acg;5;cta;502;461
190;;1;190;10;25;19;3;26;-20;;7;364;;11;tac;41;aaa;516;462
200;;1;200;19;35;20;2;22;-21;;0;289;;6;caa;8;aca;534;464
210;;0;210;13;23;21;0;30;-22;;2;16s 23s;;**;aaa;**;gta;536;480
220;;0;220;14;14;22;3;25;-23;;6;4* 244;;;;45;ttg;538;492
230;;0;230;9;16;23;2;16;-24;;0;23s 5s;;;;19;tgc;543;493
240;;0;240;11;16;24;5;18;-25;;1;4* 80;;;;5;ggc;566;500
250;;0;250;11;10;25;1;9;-26;;4;2* 81;;;;29;caa;571;503
260;;0;260;9;16;26;2;10;-27;;0;5s CDS;;;;15;cac;588;554
270;;0;270;6;5;27;1;16;-28;;1;148;;;;7;tgg;602;573
280;;0;280;3;17;28;0;8;-29;;4;130;;;;20;tac;618;580
290;;0;290;1;14;29;1;6;-30;;0;;;;;4;ttc;623;589
300;;0;300;7;12;30;5;9;-31;1;0;;;;;6;gac;659;597
310;;0;310;6;5;31;6;8;-32;;1;;;;;21;atgf;679;600
320;;0;320;5;7;32;7;5;-33;;0;;;;;56;gta;691;634
330;;0;330;5;9;33;2;9;-34;;0;;;;;33;gaa;735;639
340;1;0;340;4;7;34;7;7;-35;;1;;;;;6;tcc;817;666
350;;0;350;2;5;35;6;10;-36;;0;;CDS-CDS;inf 50;;**;aac;833;673
360;;1;360;2;5;36;8;9;-37;;1;;intercalaire;;;8;gta;1083;680
370;1;1;370;3;9;37;7;3;-38;;1;;c-;x-;;41;aca;;684
380;;0;380;1;3;38;14;0;-39;;0;;-161;-71;;5;aaa;;692
390;;1;390;8;6;39;10;6;-40;;1;;-97;;;14;cta;;705
400;;0;400;3;2;40;13;7;-41;;2;;-88;;;21;ggc;;725
reste;1;0;reste;37;51;reste;456;1083;-42;;0;;-71;;;12;tta;;767
;10;15;total;587;1849;total;587;1849;-43;;0;;-59;;;10;cgt;;785
;9;15;diagr;549;1771;diagr;130;739;-44;;2;;-56;;;19;cca;;793
;0;1; t30;50;675;;;;-45;;0;;-52;;;**;gca;;816
;;;;;;;;;-46;;1;;total;intercalaires;;24;acc;;819
;;;Récapitulatif des effectifs;;;;;;-47;;0;;;288,032;;**;aac;;821
;;;>0;<0;zéro;total;*;;-48;;0;;ADN long;2,944,528;;;;;831
;;x;586;10;1;597;;;-49;;1;;%;9.8;;;;;895
;;c;1822;393;27;2242;;;-50;;0;;;;;;;;913
;;;;;;2839;101;;reste;1;7;;non RNA;0;;;;;949
;;;;;;;2940;;total;10;393;;;;;;;;

lmo autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
  • Construction: remarque sur les nombreux regulatory
autres intercalaires;;lmo;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;81661;82617;87;*;
;;tRNA;82705;82777;181;*;aag
fin;;CDS;82959;84437;;;
deb;;CDS;235524;237020;445;*;
;;rRNA;237466;239020;244;*;1555
;;rRNA;239265;242195;80;*;2931
;;rRNA;242276;242385;13;*;110
;;tRNA;242399;242471;8;*;gta
;;tRNA;242480;242555;41;*;aca
;;tRNA;242597;242669;5;*;aaa
;;tRNA;242675;242756;14;*;cta
;;tRNA;242771;242842;21;*;ggc
;;tRNA;242864;242949;12;*;tta
;;tRNA;242962;243035;10;*;cgt
;;tRNA;243046;243119;19;*;cca
;;tRNA;243139;243214;341;*;gca
;;rRNA;243556;245041;244;*;1486
;;rRNA;245286;248216;80;*;2931
;;rRNA;248297;248406;148;*;110
fin;;CDS;248555;249013;;;
deb;;CDS;676802;677395;68;*;
;comp;tRNA;677464;677553;940;*;tcg
fin;;CDS;678494;679123;;;
deb;;CDS;936136;936603;52;*;
;;tRNA;936656;936728;3;*;aac
;;tRNA;936732;936819;382;*;agc
fin;;CDS;937202;937594;;;
deb;;CDS;939106;939819;197;*;
;;tRNA;940017;940088;27;*;gaa
;;tRNA;940116;940188;127;*;gac
fin;;CDS;940316;940696;;;
deb;comp;CDS;969549;970496;370;*;
;;tRNA;970867;970937;99;*;gga
fin;;CDS;971037;972176;;;
deb;;CDS;1266040;1266564;110;*;
;;tRNA;1266675;1266748;366;*;aga
fin;;CDS;1267115;1268473;;0;
deb;comp;CDS;1739674;1740849;66;*;
;comp;tRNA;1740916;1740987;5;*;gaa
;comp;tRNA;1740993;1741083;34;*;agc
;comp;tRNA;1741118;1741190;6;*;aac
;comp;tRNA;1741197;1741270;25;*;atc
;comp;tRNA;1741296;1741366;23;*;gga
;comp;tRNA;1741390;1741462;28;*;cac
;comp;tRNA;1741491;1741563;4;*;ttc
;comp;tRNA;1741568;1741643;4;*;gac
;comp;tRNA;1741648;1741721;42;*;atgf
;comp;tRNA;1741764;1741853;22;*;tca
;comp;tRNA;1741876;1741949;11;*;atgi
;comp;tRNA;1741961;1742034;42;*;atgj
;comp;tRNA;1742077;1742149;22;*;gca
;comp;tRNA;1742172;1742245;10;*;cca
;comp;tRNA;1742256;1742329;9;*;cgt
;comp;tRNA;1742339;1742424;14;*;tta
;comp;tRNA;1742439;1742513;15;*;ggc
;comp;tRNA;1742529;1742610;5;*;cta
;comp;tRNA;1742616;1742688;41;*;aaa
;comp;tRNA;1742730;1742805;8;*;aca
;comp;tRNA;1742814;1742886;13;*;gta
;comp;rRNA;1742900;1743009;81;*;110
;comp;rRNA;1743091;1746021;244;*;2931
;comp;rRNA;1746266;1747811;451;*;1546
fin;comp;CDS;1748263;1748709;;;
deb;;CDS;1774991;1775983;128;*;
;;tRNA;1776112;1776183;73;*;cgt
fin;comp;CDS;1776257;1776829;;;
deb;comp;CDS;1848166;1848690;130;*;
;comp;rRNA;1848821;1848930;81;*;110
;comp;rRNA;1849012;1851942;244;*;2931
;comp;rRNA;1852187;1853732;344;*;1546
fin;comp;CDS;1854077;1854682;;0;
deb;comp;CDS;2161161;2162054;132;*;
;;tRNA;2162187;2162273;49;*;ctc
fin;comp;CDS;2162323;2164011;;;
deb;comp;CDS;2213218;2215041;333;*;
;;tRNA;2215375;2215446;157;*;gaa
;;tRNA;2215604;2215677;9;*;acg
;;tRNA;2215687;2215770;11;*;tac
;;tRNA;2215782;2215856;6;*;caa
;;tRNA;2215863;2215935;118;*;aaa
fin;comp;CDS;2216054;2216743;;0;
deb;comp;CDS;2435023;2436141;351;*;
;comp;tRNA;2436493;2436576;45;*;ttg
;comp;tRNA;2436622;2436695;19;*;tgc
;comp;tRNA;2436715;2436786;5;*;ggc
;comp;tRNA;2436792;2436863;29;*;caa
;comp;tRNA;2436893;2436965;15;*;cac
;comp;tRNA;2436981;2437054;7;*;tgg
;comp;tRNA;2437062;2437145;20;*;tac
;comp;tRNA;2437166;2437238;4;*;ttc
;comp;tRNA;2437243;2437318;6;*;gac
;comp;tRNA;2437325;2437398;21;*;atgf
;comp;tRNA;2437420;2437495;56;*;gta
;comp;tRNA;2437552;2437623;33;*;gaa
;comp;tRNA;2437657;2437745;6;*;tcc
;comp;tRNA;2437752;2437827;14;*;aac
;comp;rRNA;2437842;2437951;80;*;110
;comp;rRNA;2438032;2440962;172;*;2931
;comp;tRNA;2441135;2441210;46;*;gca
;comp;tRNA;2441257;2441330;127;*;atc
;comp;rRNA;2441458;2443003;364;*;1546
fin;comp;CDS;2443368;2444126;;;
deb;;CDS;2539838;2540173;56;*;
;comp;tRNA;2540230;2540301;119;*;cgg
fin;comp;CDS;2540421;2541857;;0;
deb;comp;CDS;2671624;2672511;152;*;
;comp;tRNA;2672664;2672736;24;*;acc
;comp;tRNA;2672761;2672836;14;*;aac
;comp;rRNA;2672851;2672960;80;*;110
;comp;rRNA;2673041;2675971;172;*;2931
;comp;tRNA;2676144;2676219;46;*;gca
;comp;tRNA;2676266;2676339;127;*;atc
;comp;rRNA;2676467;2678012;289;*;1546
fin;comp;CDS;2678302;2679330;;0;
deb;;CDS;2929315;2930340;21;*;
;;tRNA;2930362;2930434;44;*;gtc
fin;comp;CDS;2930479;2932473;;;

lmo blocs[modifier | modifier le wikicode]

lmo blocs;;;;;;;;
Types;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2
16s;;244;;244;;16s;244;244
23s;;81;;80;;23s;80;81
5s;;13;;13;;5s;;
;;8;;8;;;;
;;gta;;gta;;;;
;;**20aas;;**8aas;;;;
III;;;;;;IV;;
16s;127;127;;;;;;
atc;46;46;;;;;;
gca;172;172;;;;;;
23s;80;80;;;;;;
5s;14;14;;;;;;
;6;24;;;;;;
;aac;aac;;;;;;
;**13aas;acc;;;;;;
Groupes;;;;;;;;
;;;;;;16s;244;
;;;;;I4;23s;80;
;;;;;;5s;13;
;;;;;;gta;8;
;;;;;;**7aas;19;
;;;;;;gca;341;
;;;;;;16s;244;
;;;;;II1;23s;80;
;;;;;;5s;;

lam[modifier | modifier le wikicode]

  • Lien tableau: lam
;Lactobacillus amylovorus strain 30SC;;;
38%GC;30.6.19 Paris;63;doubles;intercal
;447399..448972;16s;@1;125
;449098..449172;atc;;52
;449225..449297;gca;;115
;449413..452324;23s;;68
;452393..452509;5s;;4
;452514..452586;gta;;2
;452589..452661;aaa;;13
;452675..452756;cta;;23
;452780..452852;aca;;10
;452863..452934;ggc;;11
;452946..453031;tta;;8
;453040..453113;cgt;;5
;453119..453192;cca;;29
;453222..453295;atg;;12
;453308..453381;atgi;;27
;453409..453482;atgf;;3
;453486..453559;gac;;6
;453566..453638;ttc;;19
;453658..453728;gga;;5
;453734..453808;atc;;2
;453811..453900;agc;;
;;;;
;57091..58664;16s;;125
;58790..58864;atc;;52
;58917..58989;gca;;115
;59105..62016;23s;;68
;62085..62201;5s;;13
;62215..62287;aac;;
;;;;
;469566..471139;16s;@2;9
;471149..471334;cds1; hp 186;-3
;471332..474243;23s;;68
;474312..474428;5s;;13
;474442..474514;aac;;
;;;;
comp;1709284..1709374;tcc;;10
comp;1709385..1709457;aac;;13
comp;1709471..1709587;5s;;68
comp;1709656..1712567;23s;;-3
comp;1712565..1712750;cds2;hp 186;9
comp;1712760..1714333;16s;;
;;;;
comp;79386..79458;aag;;
;;;;
comp;79913..79985;aag;;
;;;;
;193922..193994;acc;;
;;;;
comp;210866..210939;ggg;;
;;;;
;287678..287752;ggc;+;111
;287864..287938;ggc;3 ggc;109
;288048..288122;ggc;;35
;288158..288231;ccg;;
;;;;
;457611..457682;gaa;;35
;457718..457804;tca;;9
;457814..457887;atgf;;3
;457891..457964;gac;;6
;457971..458046;ttc;;4
;458051..458132;tac;;4
;458137..458207;tgg;;12
;458220..458295;cac;;4
;458300..458371;caa;;23
;458395..458465;tgc;;40
;458506..458590;ttg;;
;;;;
;474442..474514;aac;;
;;;;
;507688..507760;acg;;
;;;;
;526886..526957;caa;;
;;;;
;551550..551631;tac;;34
;551666..551737;caa;;
;;;;
;567329..567416;ctt;;
;;;;
;583327..583413;tca;;6
;583420..583493;gac;;7
;583501..583576;cac;;4
;583581..583653;gta;;
;;;;
;642034..642106;agg;;
;;;;
comp;729370..729441;cgg;;
;;;;
;784793..784864;gag;;
;;;;
;917887..917975;tcg;;
;;;;
;1456724..1456800;aga;;
;;;;
;1681218..1681301;ctg;;
;;;;
comp;1707998..1708070;gta;;5
comp;1708076..1708147;gaa;;
;;;;
;1987190..1987263;cgt;;8
;1987272..1987345;cca;;

lam blocs[modifier | modifier le wikicode]

lam blocs;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds1;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;4;117;aac;;
gta;;;;;
;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds2;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;13;117;aac;;
aac;;;;;

lam distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
après 5s;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
3 aac;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
tcc;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;2;tgc;1;;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;;tgc;
;atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;;;atc;1;acc;;aac;;agc;1
>1aa;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;1;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;1
ggc3;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;;;gtc;;gcc;;gac;;ggc;3;;gtc;;gcc;;gac;1;ggc;1
;tta;;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;
;cta;;cca;;caa;1;cga;;;cta;;cca;1;caa;2;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;;cga;
;gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;;;gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;;gga;1
;ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
;atgj;;acg;1;aag;2;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;
;ctg;1;ccg;;cag;;cgg;1;;ctg;;ccg;1;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
;gtg;;gcg;;gag;1;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;lam;;14;;;;;14;;lam;22;;;;;;22;;lam;3;;;;;;3;;lam;;;;16;;;16
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4   1-3aas;;;

lam données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: lam données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA contig;;tRNA tRNA;;reste;Sup 400
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;lam;long;long
fxt;fct;lam;fx;fc;lam;fx40;fc40;lam;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;fx;fc
0;0;0;2;16;0;2;16;-1;;96;222;163;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;hors bloc;403;417
0;0;10;8;202;1;1;30;-2;;0;169;85;562;513;2* 203;;2;gta;111;ggc;404;423
0;0;20;3;162;2;1;38;-3;;0;114;135;744;649;23s 5s;;13;aaa;112;ggc;408;431
0;0;30;12;70;3;2;28;-4;8;49;118;59;;;4* 69;;23;cta;35;ggc;413;442
1;1;40;27;36;4;0;13;-5;;0;139;212;;;16s tRNA;;10;aca;**;ccg;419;453
0;1;50;36;39;5;0;11;-6;;0;71;59;;;2* 133;atc;11;ggc;35;gaa;421;453
3;2;60;39;55;6;0;13;-7;;1;41;39;;;tRNA 23s;;8;tta;9;tca;423;465
0;1;70;29;66;7;2;7;-8;;38;76;117;;;2* 118;gca;5;cgt;3;atgf;429;481
0;3;80;17;56;8;2;16;-9;;0;168;239;;;5s tRNA;;29;cca;6;gac;435;489
3;2;90;12;43;9;0;23;-10;1;2;222;88;;;3* 13;aac;12;atgj;7;ttc;437;495
1;0;100;29;57;10;0;23;-11;1;20;121;129;;;4;gta;27;atgi;4;tac;437;500
0;2;110;13;57;11;0;23;-12;;0;337;150;;;tRNA tRNA;intra;3;atgf;12;tgg;439;505
1;2;120;16;43;12;2;17;-13;;1;57;99;;;2* 52;atc gca;6;gac;7;cac;440;512
1;1;130;15;34;13;0;16;-14;;12;181;82;;;;;19;ttc;23;caa;449;523
1;2;140;14;29;14;0;16;-15;;0;278;58;;;;;5;gga;40;tgc;462;525
1;1;150;19;22;15;0;21;-16;;0;65;;;;;;2;atc;**;ttg;466;529
0;0;160;18;18;16;0;19;-17;1;9;202;;;;;;**;agc;34;tac;467;548
1;3;170;16;17;17;1;13;-18;;0;81;;;;;;10;tcc;**;caa;526;553
0;0;180;13;19;18;0;14;-19;;1;86;;;;;;**;aac;6;tca;528;558
0;1;190;12;24;19;0;11;-20;;9;101;;;CDS-CDS;inf 50;;;;7;gac;578;646
0;0;200;14;13;20;0;12;-21;;0;71;;;intercalaire;;;;;4;cac;589;684
0;1;210;10;13;21;0;11;-22;;1;57;;;c-;x-;;;;**;gta;590;696
1;1;220;8;9;22;0;8;-23;1;3;33;;;-64;néant;;;;5;gta;608;961
0;2;230;7;15;23;3;4;-24;;0;134;;;-53;;;;;**;gaa;617;1100
1;0;240;6;15;24;2;10;-25;;3;161;;;-53;;;;;8;cgt;688;1332
0;0;250;4;9;25;2;7;-26;1;4;141;;;total;intercalaires;;;;**;cca;789;
0;0;260;9;8;26;2;11;-27;;0;107;;;;210,907;;;;;;1405;
0;0;270;5;11;27;0;5;-28;;0;213;;;ADN long;2,078,001;;;;;;;
0;1;280;5;2;28;0;9;-29;1;3;;;;%;10.1;;;;;;;
0;0;290;5;7;29;0;4;-30;;0;;;;;;;;;;;;
0;0;300;4;7;30;3;1;-31;;1;;;;non RNA;54;;;;;;;
0;0;310;7;4;31;4;5;-32;;4;;;;;;;;;;;;
0;0;320;4;5;32;6;0;-33;;0;;;;;;;;;;;;
0;0;330;2;11;33;5;7;-34;;0;;;;;;;;;;;;
0;1;340;3;2;34;1;4;-35;;1;;;;;;;;;;;;
0;0;350;2;4;35;3;4;-36;;0;;;;;;;;;;;;
0;0;360;4;7;36;1;3;-37;;2;;;;;;;;;;;;
0;0;370;2;4;37;2;6;-38;;1;;;;;;;;;;;;
0;0;380;1;7;38;1;2;-39;;0;;;;;;;;;;;;
0;0;390;4;3;39;0;2;-40;;0;;;;;;;;;;;;
0;0;400;0;2;40;4;3;-41;;0;;;;;;;;;;;;
0;0;reste;27;25;reste;431;762;-42;;0;;;;;;;;;;;;
15;28;total;483;1248;total;483;1248;-43;;0;;;;;;;;;;;;
15;28;diagr;454;1207;diagr;50;470;-44;;1;;;;;;;;;;;;
0;0; t30;23;434;;;;-45;;0;;;;;;;;;;;;
;;;;;;;;-46;;1;;;;;;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;;6;;;;;;;;;;;;
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;;;;
;x;481;15;2;498;;;-49;;0;;;;;;;;;;;;
;c;1232;272;16;1520;;;-50;1;3;;;;;;;;;;;;
;;;;;2018;152;;reste;;0;;;;;;;;;;;;
;;;;;;2170;;total;15;272;;;;;;;;;;;;

lam autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: lam autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;lam;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;comp;CDS;19323;20024;163;*;
;;tRNA;20188;20261;222;*;act
fin;;CDS;20484;21764;;;
deb;;CDS;56117;56530;562;*;
;;rRNA;57093;58656;133;*;1564
;;tRNA;58790;58864;52;*;atc
;;tRNA;58917;58989;118;*;gca
;;rRNA;59108;62015;69;*;2908
;;rRNA;62085;62201;13;*;117
;;tRNA;62215;62287;85;*;aac
fin;comp;CDS;62373;63296;;0;
deb;comp;CDS;78479;79216;169;*;
;comp;tRNA;79386;79458;114;*;aag
deb;comp;CDS;79573;79794;118;*;
;comp;tRNA;79913;79985;135;*;aag
fin;;CDS;80121;80837;;;
deb;comp;CDS;108050;109663;110;*;
;comp;regulatory;109774;109947;47;*;
fin;comp;CDS;109995;110627;;0;
deb;;CDS;193447;193782;139;*;
;;tRNA;193922;193994;71;*;acc
fin;;CDS;194066;195379;;;
deb;;CDS;210147;210809;59;*;
;comp;tRNA;210869;210939;41;*;ggg
fin;comp;CDS;210981;211580;;0;
deb;;CDS;213163;213804;53;*;
;;regulatory;213858;214021;76;*;
fin;;CDS;214098;216761;;;
deb;comp;CDS;243078;243656;73;*;
;comp;regulatory;243730;243827;60;*;
fin;comp;CDS;243888;244490;;1;
deb;comp;CDS;287010;287465;212;*;
;;tRNA;287678;287752;111;*;ggc
;;tRNA;287864;287935;112;*;ggc
;;tRNA;288048;288122;35;*;ggc
;;tRNA;288158;288231;76;*;ccg
fin;;CDS;288308;288763;;;
deb;comp;CDS;363306;363677;90;*;
;;misc_f;363768;363889;43;*;
fin;;CDS;363933;364445;;;
deb;;CDS;366810;367316;45;*;
;;ncRNA;367362;367456;54;*;
fin;;CDS;367511;369319;;;
deb;comp;CDS;445892;446887;513;*;
;;rRNA;447401;448964;133;*;1564
;;tRNA;449098;449172;52;*;atc
;;tRNA;449225;449297;118;*;gca
;;rRNA;449416;452323;69;*;2908
;;rRNA;452393;452509;4;*;117
;;tRNA;452514;452586;2;*;gta
;;tRNA;452589;452661;13;*;aaa
;;tRNA;452675;452756;23;*;cta
;;tRNA;452780;452852;10;*;aca
;;tRNA;452863;452934;11;*;ggc
;;tRNA;452946;453031;8;*;tta
;;tRNA;453040;453113;5;*;cgt
;;tRNA;453119;453192;29;*;cca
;;tRNA;453222;453295;12;*;atgj
;;tRNA;453308;453381;27;*;atgi
;;tRNA;453409;453482;3;*;atgf
;;tRNA;453486;453559;6;*;gac
;;tRNA;453566;453638;19;*;ttc
;;tRNA;453658;453728;5;*;gga
;;tRNA;453734;453808;2;*;atc
;;tRNA;453811;453900;168;*;agc
fin;;CDS;454069;454491;;;
deb;;CDS;454491;457388;222;*;
;;tRNA;457611;457682;35;*;gaa
;;tRNA;457718;457804;9;*;tca
;;tRNA;457814;457887;3;*;atgf
;;tRNA;457891;457964;6;*;gac
;;tRNA;457971;458043;7;*;ttc
;;tRNA;458051;458132;4;*;tac
;;tRNA;458137;458207;12;*;tgg
;;tRNA;458220;458292;7;*;cac
;;tRNA;458300;458371;23;*;caa
;;tRNA;458395;458465;40;*;tgc
;;tRNA;458506;458590;121;*;ttg
fin;;CDS;458712;459875;;;
deb;;CDS;467495;468823;744;*;
;;rRNA;469568;471131;203;*;1564
;;rRNA;471335;474242;69;*;2908
;;rRNA;474312;474428;13;*;117
;;tRNA;474442;474514;337;*;aac
fin;;CDS;474852;475862;;;
deb;;CDS;507082;507630;57;*;
;;tRNA;507688;507760;59;*;acg
fin;comp;CDS;507820;509192;;0;
deb;;CDS;526021;526704;181;*;
;;tRNA;526886;526957;278;*;caa
fin;;CDS;527236;528015;;;
deb;;CDS;528027;528719;574;*;
;;regulatory;529294;529457;80;*;
fin;;CDS;529538;532225;;;
deb;comp;CDS;546953;548239;77;*;
;comp;regulatory;548317;548377;91;*;
fin;comp;CDS;548469;548831;;;
deb;;CDS;551035;551484;65;*;
;;tRNA;551550;551631;34;*;tac
;;tRNA;551666;551737;202;*;caa
fin;;CDS;551940;553055;;;
deb;;CDS;566792;567247;81;*;
;;tRNA;567329;567413;86;*;ctt
fin;;CDS;567500;568147;;;
deb;;CDS;582725;583225;101;*;
;;tRNA;583327;583413;6;*;tca
;;tRNA;583420;583493;7;*;gac
;;tRNA;583501;583576;4;*;cac
;;tRNA;583581;583653;71;*;gta
fin;;CDS;583725;585191;;0;
deb;;CDS;606557;608326;26;*;
;;regulatory;608353;608445;50;*;
fin;;CDS;608496;609074;;;
deb;comp;CDS;609745;610383;156;*;
;;misc_b;610540;610782;243;*;
fin;;CDS;611026;611766;;;
deb;;CDS;640648;641976;57;*;
;;tRNA;642034;642106;39;*;agg
fin;comp;CDS;642146;642334;;0;
deb;;CDS;728387;729252;117;*;
;comp;tRNA;729370;729441;239;*;cgg
fin;;CDS;729681;730712;;;
deb;;CDS;770203;771387;52;*;
;;tmRNA;771440;771806;177;*;
fin;;CDS;771984;772877;;;
deb;comp;CDS;783691;784704;88;*;
;;tRNA;784793;784864;33;*;gag
fin;;CDS;784898;784993;;0;
deb;comp;CDS;877491;878846;218;*;
;;regulatory;879065;879235;91;*;
fin;;CDS;879327;880637;;;
deb;comp;CDS;916780;917757;129;*;
;;tRNA;917887;917975;134;*;tcg
fin;;CDS;918110;919498;;;
deb;comp;CDS;923642;924574;136;*;
;;misc_b;924711;924950;42;*;
fin;;CDS;924993;925847;;;
deb;;CDS;982901;983617;27;*;
;;regulatory;983645;983759;77;*;
fin;;CDS;983837;984526;;;
deb;comp;CDS;1011692;1012501;102;*;
;;regulatory;1012604;1012662;43;*;
fin;;CDS;1012706;1013095;;;
deb;;CDS;1095103;1095633;116;*;
;;misc_b;1095750;1096001;60;*;
fin;;CDS;1096062;1097180;;;
deb;;CDS;1152540;1155044;66;*;
;;misc_b;1155111;1155358;64;*;
fin;;CDS;1155423;1156802;;;
deb;comp;CDS;1212112;1213236;72;*;
;comp;ncRNA;1213309;1213675;26;*;
fin;comp;CDS;1213702;1214121;;;
deb;;CDS;1322695;1324020;55;*;
;;misc_b;1324076;1324319;57;*;
fin;;CDS;1324377;1325738;;0;
deb;comp;CDS;1449420;1449731;14;*;
;comp;misc_f;1449746;1449826;68;*;
fin;comp;CDS;1449895;1451271;;0;
deb;comp;CDS;1455677;1456573;150;*;
;;tRNA;1456724;1456800;99;*;aga
fin;comp;CDS;1456900;1458480;;;
deb;comp;CDS;1593167;1594216;37;*;
;comp;misc_b;1594254;1594461;38;*;
fin;comp;CDS;1594500;1594850;;;
deb;comp;CDS;1606331;1606858;26;*;
;comp;misc_f;1606885;1606996;53;*;
fin;comp;CDS;1607050;1608747;;;
deb;comp;CDS;1679837;1681135;82;*;
;;tRNA;1681218;1681301;161;*;
fin;;CDS;1681463;1681780;;;ctg
deb;comp;CDS;1706640;1707839;-3;*;
;comp;regulatory;1707837;1707930;67;*;
;comp;tRNA;1707998;1708070;5;*;gta
;comp;tRNA;1708076;1708147;141;*;gaa
deb;comp;CDS;1708289;1709176;107;*;
;comp;tRNA;1709284;1709374;10;*;tcc
;comp;tRNA;1709385;1709457;13;*;aac
;;rRNA;1709471;1709587;69;*;117
;;rRNA;1709657;1712564;203;*;2908
;;rRNA;1712768;1714331;649;*;1564
fin;comp;CDS;1714981;1716288;;;
deb;comp;CDS;1765715;1766362;152;*;
;comp;misc_b;1766515;1766748;43;*;
fin;comp;CDS;1766792;1769098;;0;
deb;;CDS;1985984;1986976;213;*;
;;tRNA;1987190;1987263;8;*;cgt
;;tRNA;1987272;1987345;58;*;cca
deb;comp;CDS;1987404;1988462;121;*;
;;misc_b;1988584;1988828;71;*;
fin;;CDS;1988900;1989913;;0;
deb;;CDS;2017560;2019416;56;*;
;;misc_f;2019473;2019530;40;*;
fin;;CDS;2019571;2020740;;;
deb;;CDS;2039362;2040669;131;*;
;;regulatory;2040801;2040898;72;*;
fin;;CDS;2040971;2042281;;;
deb;;CDS;2043158;2043412;56;*;
;;misc_b;2043469;2043702;76;*;
fin;;CDS;2043779;2045407;;0;

ppm[modifier | modifier le wikicode]

opérons[modifier | modifier le wikicode]

ppm chromosome[modifier | modifier le wikicode]
45.5%GC;26.7.19 Paris;16s 13;110;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Paenibacillus polymyxa SC2;;;;;;;;;;
;10545..11633;;CDS;;327;327;;;363;
;11961..13519;;16s;;280;;;;;
;13800..16728;;23s;;143;;;;;
;16872..16988;;5s;;232;232;;;;232
;17221..17640;;CDS;;93 855;;;;140;
;;;;;;;;;;
comp;111496..112530;;CDS;;616;;;;345;
;113147..114705;;16s;;207;;;;;
;114913..117843;;23s;;76;;;;;
;117920..118036;;5s;;343;343;;;;
;118380..119837;;CDS;;3 348;;;;486;
;;;;;;;;;;
;123186..124469;;CDS;;90;90;;;428;90
;124560..124648;;tca;;145;145;;;;
;124794..125135;;CDS;;55 592;;;;114;
;;;;;;;;;;
;180728..181003;;CDS;;412;;;;92;
;181416..182974;;16s;;108;;;;;
;183083..183199;;5s;@1;39;;;;;
;183239..183315;;atc;;20;;;20;;
;183336..183411;;gca;;128;;;;;
;183540..186468;;23s;;130;;;;;
;186599..186690;;agc;;28;;;28;;
;186719..186795;;atgj;;10;;;10;;
;186806..186881;;gta;;4;;;4;;
;186886..186961;;aca;;19;;;19;;
;186981..187057;;gac;;77;;;77;;
;187135..187210;;ttc;;6;;;6;;
;187217..187302;;tac;;7;;;7;;
;187310..187385;;aaa;;154;154;;;;154
;187540..188682;;CDS;;24 062;;;;381;
;;;;;;;;;;
comp;212745..213341;;CDS;;211;211;;;199;211
comp;213553..213624;;cgg;;259;259;;;;
;213884..214921;;CDS;;238 832;;;;346;
;;;;;;;;;;
;453754..455364;;CDS;;392;;;;537;
;455757..457315;;16s;;207;;;;;
;457523..460453;;23s;;76;;;;;
;460530..460646;;5s;;34;;;;;
;460681..460757;;atc;;22;;;22;;
;460780..460855;;gca;;4;;;4;;
;460860..460935;;aac;;34;;;34;;
;460970..461043;;atgj;;3;;;3;;
;461047..461138;;agc;;31;;;31;;
;461170..461241;;gaa;;6;;;6;;
;461248..461323;;gta;;10;;;10;;
;461334..461407;;atgf;;25;;;25;;
;461433..461509;;gac;;50;;;50;;
;461560..461635;;ttc;;22;;;22;;
;461658..461733;;aca;;5;;;5;;
;461739..461824;;tac;;16;;;16;;
;461841..461913;;cac;;18;;;18;;
;461932..462006;;caa;;4;;;4;;
;462011..462086;;aaa;;15;;;15;;
;462102..462189;;ctg;;6;;;6;;
;462196..462270;;ggc;;10;;;10;;
;462281..462351;;tgc;;26;;;26;;
;462378..462454;;cgt;;22;;;22;;
;462477..462550;;cca;;9;;;9;;
;462560..462630;;gga;;204;204;;;;204
comp;462835..463938;;CDS;;1 537;;;;368;
;;;;;;;;;;
;465476..466216;;CDS;;524;;;;247;
;466741..468299;;16s;;207;;;;;
;468507..471434;;23s;;76;;;;;
;471511..471627;;5s;;629;;;;;
;472257..473588;;CDS;;103 459;;;;444;
;;;;;;;;;;
;577048..577794;;CDS;;1 116;;;;249;
;578911..580469;;16s;;207;;;;;
;580677..583607;;23s;;76;;;;;
;583684..583800;;5s;;82;;;;;
;583883..583958;;gca;;4;;;4;;
;583963..584038;;aac;;3;;;3;;
;584042..584133;;tcc;;19;;;19;;
;584153..584224;;gaa;;9;;;9;;
;584234..584309;;gta;;29;;;29;;
;584339..584412;;atgf;;25;;;25;;
;584438..584514;;gac;;13;;;13;;
;584528..584603;;aca;;4;;;4;;
;584608..584693;;tac;;102;;;102;;
;584796..584870;;caa;;4;;;4;;
;584875..584950;;aaa;;12;;;12;;
;584963..585043;;cta;;10;;;10;;
;585054..585128;;ggc;;5;;;5;;
;585134..585210;;cgt;;12;;;12;;
;585223..585302;;ttg;;7;;;7;;
;585310..585386;;cca;;7;;;7;;
;585394..585464;;gga;;1 133;;;;;
;586598..587560;;CDS;;22 016;;;;321;
;;;;;;;;;;
;609577..609924;;CDS;;73;73;;;116;73
;609998..610069;;acg;;1 613;;;;;
comp;611683..612030;;CDS;;140 810;;;;116;
;;;;;;;;;;
;752841..754124;;CDS;;611;;;;428;
;754736..756294;;16s;;208;;;;;
;756503..759431;;23s;;75;;;;;
;759507..759623;;5s;;183;183;;;;183
comp;759807..760232;;CDS;;173 078;;;;142;
;;;;;;;;;;
;933311..934681;;CDS;;449;;;;457;
;935131..936689;;16s;;221;;;;;
;936911..939839;;23s;;76;;;;;
;939916..940032;;5s;;216;216;;;;216
;940249..941241;;CDS;;521 183;;;;331;
;;;;;;;;;;
;1462425..1462937;;CDS;;44;44;;;171;44
;1462982..1463057;;aac;;1;;1;;;
;1463059..1463147;;agc;;122;122;;;;
comp;1463270..1464145;;CDS;;74;;;;292;
;;;;;;;;;;
comp;1464220..1464981;;CDS;;246;246;;;254;
;1465228..1465299;;gaa;;86;;86;;;
;1465386..1465461;;aaa;;15;;15;;;
;1465477..1465562;;ctc;;162;162;;;;162
;1465725..1466180;;CDS;;1 667;;;;152;
;;;;;;;;;;
comp;1467848..1468585;;CDS;;262;262;;;246;
;1468848..1468930;;ctc;;148;148;;;;148
comp;1469079..1469564;;CDS;;112 990;;;;162;
;;;;;;;;;;
;1582555..1583361;;CDS;;490;;;;269;
;1583852..1583925;;ccc;;244;244;;;;
comp;1584170..1585441;;CDS;;32 099;;;;424;
;;;;;;;;;;
;1617541..1619682;;CDS;;107;107;;;714;107
;1619790..1619860;;gga;;265;265;;;;
;1620126..1621163;;CDS;;254 529;;;;346;
;;;;;;;;;;
;1875693..1876160;;CDS;;129;129;;;156;129
;1876290..1876365;;gcc;;11;;11;;;
;1876377..1876449;;aag;;520;;;;;
comp;1876970..1877974;;CDS;;55 215;;;;335;
;;;;;;;;;;
comp;1933190..1933630;;CDS;;381;;;;147;
;1934012..1934096;;ctg;;91;91;;;;91
comp;1934188..1934718;;CDS;;74 847;;;;177;
;;;;;;;;;;
comp;2009566..2010102;;CDS;;222;222;;;179;
;2010325..2010409;;ctg;;213;213;;;;
;2010623..2011135;;CDS;;432 608;;;;171;
;;;;;;;;;;
;2443744..2448333;;CDS;;540;;;;1530;
;2448874..2450432;;16s;;400;;;;;
;2450833..2453761;;23s;;143;;;;;
;2453905..2454021;;5s;;236;236;;;;236
comp;2454258..2455367;;CDS;;186 804;;;;370;
;;;;;;;;;;
;2642172..2643329;;CDS;;426;;;;386;
;2643756..2645314;;16s;;343;;;;;
;2645658..2648586;;23s;;144;;;;;
;2648731..2648847;;5s;;156;156;;;;156
;2649004..2649228;;CDS;;884 577;;;;75;
;;;;;;;;;;
comp;3533806..3534249;;CDS;;139;139;;;148;139
;3534389..3534460;;gtc;;279;279;;;;
comp;3534740..3535069;;CDS;;103 837;;;;110;
;;;;;;;;;;
;3638907..3639338;;CDS;;728;;;;144;
comp;3640067..3640152;;tta;;249;249;;;;249
;3640402..3640560;;CDS;;28 092;;;;53;
;;;;;;;;;;
;3668653..3669450;;CDS;;247;247;;;266;
comp;3669698..3669766;;atg;;267;267;;;;
comp;3670034..3670234;;CDS;;54 456;;;;67;
;;;;;;;;;;
;3724691..3725086;;CDS;;122;122;;;132;122
comp;3725209..3725282;;atgi;;435;;;;;
comp;3725718..3726359;;CDS;;612 148;;;;214;
;;;;;;;;;;
comp;4338508..4339209;;CDS;;107;107;;;234;107
comp;4339317..4339390;;cca;;7;;;7;;
comp;4339398..4339477;;ttg;;12;;;12;;
comp;4339490..4339566;;cgt;;5;;;5;;
comp;4339572..4339646;;ggc;;35;;;35;;
comp;4339682..4339757;;aaa;;28;;;28;;
comp;4339786..4339862;;gac;;26;;;26;;
comp;4339889..4339965;;atgf;;30;;;30;;
comp;4339996..4340071;;gta;;9;;;9;;
comp;4340081..4340152;;gaa;;17;;;17;;
comp;4340170..4340261;;tcc;;3;;;3;;
comp;4340265..4340340;;aac;;18;;;;;
comp;4340359..4340475;;5s;;76;;;;;
comp;4340552..4343482;;23s;;400;;;;;
comp;4343883..4345441;;16s;;493;;;;;
comp;4345935..4347563;;CDS;;46 596;;;;543;
;;;;;;;;;;
comp;4394160..4395092;;CDS;;238;238;;;311;
;4395331..4395404;;aga;;214;214;;;;
;4395619..4396383;;CDS;;49 894;;;;255;
;;;;;;;;;;
;4446278..4447621;;CDS;;207;207;;;448;
comp;4447829..4447902;;aga;;174;174;;;;
;4448077..4448370;;CDS;;256 556;;;;98;
;;;;;;;;;;
;4704927..4705187;;CDS;;361;;;;87;
comp;4705549..4705627;;ttg;;11;;11;;;
comp;4705639..4705713;;tgc;;11;;11;;;
comp;4705725..4705796;;ggc;;6;;6;;;
comp;4705803..4705877;;caa;;9;;9;;;
comp;4705887..4705959;;cac;;17;;17;;;
comp;4705977..4706050;;tgg;;7;;7;;;
comp;4706058..4706143;;tac;;4;;4;;;
comp;4706148..4706223;;aca;;22;;22;;;
comp;4706246..4706318;;ttc;;35;;35;;;
comp;4706354..4706430;;gac;;15;;15;;;
comp;4706446..4706522;;atgf;;25;;25;;;
comp;4706548..4706623;;gta;;58;;58;;;
comp;4706682..4706753;;gaa;;17;;17;;;
comp;4706771..4706862;;tcc;;3;;3;;;
comp;4706866..4706941;;aac;;326;326;;;;
comp;4707268..4707597;;CDS;;279 544;;;;110;
;;;;;;;;;;
comp;4987142..4989934;;CDS;;726;;;;931;
comp;4990661..4990731;;gga;;9;;;9;;
comp;4990741..4990814;;cca;;22;;;22;;
comp;4990837..4990913;;cgt;;5;;;5;;
comp;4990919..4990993;;ggc;;10;;;10;;
comp;4991004..4991084;;cta;;11;;;11;;
comp;4991096..4991171;;aaa;;4;;;4;;
comp;4991176..4991250;;caa;;55;;;55;;
comp;4991306..4991381;;gta;;11;;;11;;
comp;4991393..4991464;;gaa;;11;;;11;;
comp;4991476..4991548;;acc;;3;;;3;;
comp;4991552..4991627;;aac;;18;;;;;
comp;4991646..4991762;;5s;;76;;;;;
comp;4991839..4994768;;23s;;129;;;;;
comp;4994898..4994973;;gca;;20;;;20;;
comp;4994994..4995070;;atc;;38;;;;;
comp;4995109..4995225;;5s;;93;;;;;
comp;4995319..4996877;;16s;;367;;;;;
comp;4997245..4997475;;CDS;;60 140;;;;77;
;;;;;;;;;;
comp;5057616..5058803;;CDS;;163;163;;;396;163
comp;5058967..5059083;;5s;;76;;;;;
comp;5059160..5062089;;23s;;185;;;;;
comp;5062275..5062350;;gca;;89;;;;;
comp;5062440..5063998;;16s;;380;;;;;
comp;5064379..5066394;;CDS;;647 899;;;;672;
;;;;;;;;;;
;5714294..5714611;;CDS;;206;206;;;106;
comp;5714818..5714908;;tcg;;77;77;;;;77
comp;5714986..5715210;;CDS;;;;;;75;
ppm plasmide[modifier | modifier le wikicode]
  • Plasmide
plasmide;pSC2;37.6%GC;51;;;;;;;
;;;;;;CDS;aa;avec aa;aas;CDS dirigé
;3920..4174;;CDS;;536;536;;;85;
;4711..4803;;agc;+;5;;5;;;
;4809..4883;;tgc;3 aac;63;;63;;;
;4947..5021;;gaa;2 atc;7;;7;;;
;5029..5105;;ctt;2 caa;6;;6;;;
;5112..5186;;cca;2 cca;101;;101;;;
;5288..5361;;tgg;2 cga;4;;4;;;
;5366..5444;;tac;2 gaa;4;;4;;;
;5449..5522;;caa;2 tac;6;;6;;;
;5529..5605;;cac;3 tgg;5;;5;;;
;5611..5686;;gac;;125;;125;;;
;5812..5887;;gga;;10;;10;;;
;5898..5973;;aac;@1;4;;4;;;
;5978..6066;;tac;ctt;9;;9;;;
;6076..6153;;ata;ata;4;;4;;;
;6158..6231;;caa;;4;;4;;;
;6236..6311;;atgi;;5;;5;;;
;6317..6392;;aac;;4;;4;;;
;6397..6470;;tgg;;131;;131;;;
;6602..6678;;gaa;;5;;5;;;
;6684..6757;;ggc;;55;;55;;;
;6813..6885;;ttc;;22;;22;;;
;6908..6983;;cga;;4;;4;;;
;6988..7065;;cca;;5;;5;;;
;7071..7155;;ttg;;5;;5;;;
;7161..7235;;atc;;5;;5;;;
;7241..7317;;atgf;;5;;5;;;
;7323..7398;;gca;;109;;109;;;
;7508..7584;;cga;;3;;3;;;
;7588..7668;;cta;;13;;13;;;
;7682..7758;;atc;;8;;8;;;
;7767..7841;;aac;;4;;4;;;
;7846..7919;;tgg;;33;33;;;;33
;7953..8324;;CDS;@4;-24;-24;;;124;
;8301..8378;;gac;;8;;8;;;
;8387..8473;;tac;;86;;86;;;
;8560..8632;;aaa;;14;;14;;;
;8647..8720;;gga;;4;;4;;;
;8725..8800;;ttc;;7;;7;;;
;8808..8882;;acg;@2;100;100;;;;
comp;8983..9600;;CDS;acg;89;89;;;206;
;9690..9771;;tta;;3;;3;;;
;9775..9849;;aca;;35;35;;;;35
comp;9885..10169;;CDS;;150;;;;95;
;;;;;;;;;;
comp;10320..10622;;CDS;;116;116;;;101;
;10739..10813;;aca;;18;18;;;;18
comp;10832..11146;;CDS;;216;;;;105;
;;;;;;;;;;
comp;11363..11599;;CDS;;94;94;;;79;94
;11694..11768;;aga;;103;103;;;;
;11872..12312;;CDS;;195;;;;147;
;;;;;;;;;;
comp;12508..12756;;CDS;;293;293;;;83;
;13050..13126;;atc;;72;72;;;;72
;13199..14083;;CDS;;226;226;;;295;
;;;;;;;;;;
;14310..14385;;tcg;+;8;;8;;;
;14394..14481;;tcc;2 tcg;7;;7;;;
;14489..14563;;ctt;@3;3;;3;;;
;14567..14654;;tcg;tcg;5;;5;;;
;14660..14751;;tca;ctt;119;119;;;;119
;14871..15080;;CDS;;212044;;;;70;
;;;;;;;;;;
comp;227125..227388;;CDS;;444;444;;;88;
comp;227833..227903;;gga;;248;248;;;;248
comp;228152..228391;;CDS;;1401;;;;80;
;;;;;;;;;;
comp;229793..229999;;CDS;;24;24;;;69;24
comp;230024..230108;;tca;;289;289;;;;
comp;230398..230640;;CDS;;231;;;;81;
;;;;;;;;;;
comp;230872..231393;;CDS;;161;161;;;174;161
comp;231555..231640;;tta;;977;977;;;;
;232618..233067;;CDS;;277050;;;;150;
;510118..1;;;;;;;;;
ppm plasmide MAJ[modifier | modifier le wikicode]
plasmide;;Paenibacillus polymyxa SC2 MAJ;;;plasmide;;Paenibacillus polymyxa SC2;;;
23.10.19 Tanger;;;;;;26.7.19 Paris;;;;
;;49 aas;doubles;intercalaires;;;;51 aas;doubles;intercalaires
3920..4174;;cds hp;;;;3920..4174;;CDS;;536
4711..4803;;agc;+;;;4711..4803;;agc;+;5
4809..4883;;tgc;3 aac;;;4809..4883;;tgc;3 aac;63
4947..5021;;gaa;2 atc;;;4947..5021;;gaa;2 atc;7
5029..5105;;ctt;2 cca;;;5029..5105;;ctt;2 caa;6
5112..5186;;cca;2 cga;;;5112..5186;;cca;2 cca;101
5288..5361;;tgg;2 gaa;;;5288..5361;;tgg;2 cga;4
5366..5441;;tat;3 tgg;7;;5366..5444;;tac;2 gaa;4
5449..5522;;caa;;;;5449..5522;;caa;2 tac;6
5529..5605;;cac;;;;5529..5605;;cac;3 tgg;5
5611..5686;;gac;;;;5611..5686;;gac;;125
5812..5887;;gga;;;;5812..5887;;gga;;10
5898..5973;;aac;@1;;;5898..5973;;aac;@1;4
5978..6066;;tac;ctt;;;5978..6066;;tac;ctt;9
6076..6153;;ata;ata;82;;6076..6153;;ata;ata;4
;;****;tat;;;6158..6231;;caa;;4
6236..6311;;atgi;;;;6236..6311;;atgi;;5
6317..6392;;aac;;;;6317..6392;;aac;;4
6397..6470;;tgg;;;;6397..6470;;tgg;;131
6602..6678;;gaa;;;;6602..6678;;gaa;;5
6684..6757;;ggc;;;;6684..6757;;ggc;;55
6813..6885;;ttc;;;;6813..6885;;ttc;;22
6908..6980;;cga;;7;;6908..6983;;cga;;4
6988..7065;;cca;;;;6988..7065;;cca;;5
7071..7155;;ttg;;;;7071..7155;;ttg;;5
7161..7235;;atc;;4;;7161..7235;;atc;;5
7240..7317;;atgf;;;;7241..7317;;atgf;;5
7323..7398;;gca;;;;7323..7398;;gca;;109
7508..7584;;cga;;;;7508..7584;;cga;;3
7588..7668;;cta;;;;7588..7668;;cta;;13
7682..7758;;atc;;;;7682..7758;;atc;;8
7767..7841;;aac;;;;7767..7841;;aac;;4
7846..7919;;tgg;;;;7846..7919;;tgg;;33
7953..8324;;cds hp;;;;7953..8324;;CDS;@4;-24
8301..8378;;gac;;;;8301..8378;;gac;;8
8387..8473;;tac;;;;8387..8473;;tac;;86
8560..8632;;aaa;;;;8560..8632;;aaa;;14
8647..8720;;gga;;;;8647..8720;;gga;;4
8725..8800;;ttc;;;;8725..8800;;ttc;;7
8808..8882;;acg;@2;;;8808..8882;;acg;@2;100
8983..9600;;cds hp;acg;;comp;8983..9600;;CDS;acg;89
9690..9771;;tta;;;;9690..9771;;tta;;3
9775..9849;;aca;;;;9775..9849;;aca;;35
9885..10169;;cds hp;;;comp;9885..10169;;CDS;;150
;;;;;;;;;;
10320..10622;;cds hp;;;comp;10320..10622;;CDS;;116
10739..10813;;aca;;;;10739..10813;;aca;;18
10832..11146;;cds hp;;;comp;10832..11146;;CDS;;216
;;;;;;;;;;
11363..11599;;cds hp;;;comp;11363..11599;;CDS;;94
11694..11765;;aga;;85;;11694..11768;;aga;;103
11851..12312;;cds rev-trans;;;;11872..12312;;CDS;;195
;;;;;;;;;;
12508..12756;;cds trans-rg;;442;comp;12508..12756;;CDS;;293
****;;****;;;;13050..13126;;atc;;72
13199..14083;;cds hp;;;;13199..14083;;CDS;;226
;;;;;;;;;;
14310..14385;;tcg;+;;;14310..14385;;tcg;+;8
14394..14481;;tcc;2 tcg;;;14394..14481;;tcc;2 tcg;7
14489..14560;;ctt;@3;6;;14489..14563;;ctt;@3;3
14567..14654;;tcg;tcg;;;14567..14654;;tcg;tcg;5
14660..14751;;tca;ctt;;;14660..14751;;tca;ctt;119
14871..15080;;cds hp;;;;14871..15080;;CDS;;212044
;;;;;;;;;;
227125..227388;;cds hp;;;comp;227125..227388;;CDS;;444
227833..227903;;gga;;;comp;227833..227903;;gga;;248
228152..228391;;cds hp;;;comp;228152..228391;;CDS;;1401
;;;;;;;;;;
229793..229999;;cds hp;;;comp;229793..229999;;CDS;;24
230024..230108;;tca;;783;comp;230024..230108;;tca;;289
****;;****;;;comp;230398..230640;;CDS;;231
;;;;;;;;;;
230872..231393;;;cds hp;;comp;230872..231393;;CDS;;161
231558..231640;;tta;;;comp;231555..231640;;tta;;977
232618..233067;;cds hp;;;;232618..233067;;CDS;;277050
510118..1;;;;;;510118..1;;;;

ppm cumuls[modifier | modifier le wikicode]

Paenibacillus polymyxa SC2;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;13;1;1;0;1;0;100;8;5;40;0
;16 23 5s 0;7;20;12;46;50;1;200;20;17;60;1
;16 5 atc gca;2;40;3;15;100;4;300;10;6;80;2
;16 23 5s a;3;60;1;2;150;8;400;13;9;100;2
;max a;21;80;0;1;200;6;500;7;4;120;2
;a doubles;0;100;1;0;250;15;600;2;0;140;3
;16 gca 23 5s ;1;120;0;1;300;5;700;1;0;160;3
;total aas;73;140;0;0;350;3;800;1;1;180;2
sans ;opérons;19;160;0;0;400;5;900;0;0;200;1
;1 aa;15;180;0;0;450;4;1000;1;0;220;3
;max a;15;200;0;0;500;2;1100;0;0;240;2
;a doubles;0;;0;0;;11;;1;0;;1
;total aas;37;;18;65;;64;;64;42;;22
total aas;;110;moyenne;20;17;;193;;292;229;;150
remarques;;1;variance;21;17;;73;;234;123;;58
jaune;;;;;;;sans;;;sans;;
  • Plasmide
Paenibacillus polymyxa SC2;;;;;;;;;;;;
plasmide;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;0;1;0;;1;1;60;0;;40;4
;16 23 5s 0;;20;33;;50;4;80;4;;60;0
;16 5 atc gca;;40;1;;100;4;100;5;;80;1
;16 23 5s a;;60;1;;150;3;120;2;;100;1
;max a;;80;1;;200;1;140;1;;120;1
;a doubles;;100;1;;250;2;160;2;;140;0
;16 gca 23 5s ;;120;2;;300;2;180;1;;160;0
;total aas;;140;2;;350;0;200;0;;180;1
sans ;opérons;10;160;0;;400;0;220;1;;200;0
;1 aa;6;180;0;;450;1;240;0;;220;0
;max a;32;200;0;;500;0;260;0;;240;0
;a doubles;2;;0;;;2;;1;;;1
;total aas;51;;41;;;20;;17;;;9
total aas;;51;moyenne;6;;;126;;102;;;89
remarques;;3;variance;3;;;92;;32;;;77
;jaune;;;sans;;;sans;;sans;;;

ppm blocs[modifier | modifier le wikicode]

ppm blocs;;;;;;;
cds;392;;cds;1116;;cds;493
$16s;207;;$16s;207;;$16s;400
$23s;76;;$23s;76;;$23s;76
$5s;34;;$5s;82;;$5s;18
atc;22;;gca;4;;aac;3
19aas;*;;15aas;*;;9aas;*
gga;'''204’;;gga;1133;;cca;107
cds;;;cds;;;cds;
;;;;;;;
cds;367;;cds;412;;cds;380
$16s;93;;$16s;108;;$16s;89
$5s;38;;$5s;39;;gca;185
atc;20;;atc;20;;$23s;76
gca;129;;gca;128;;$5s;163
$23s;76;;$23s;130;;cds;
$5s;18;;agc;28;;;
aac;3;;6aas;*;;;
9aas;*;;aaa;154;;;
gga;726;;cds;;;;
cds;;;;;;;
;;;;;;;
cds;327;'''616’;524;611;449;540;426
$16s;280;207;207;208;221;400;343
$23s;143;76;76;75;76;143;144
$5s;232;343;629;'''183’;216;'''236’;156
cds;;;;;;;
;;;;;;;
$5s;constant;39 aas;117 pbs;;;;

ppm distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1;;;;;;;;;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;;tac;;tgc;;;ttc;1;tcc;1;tac;1;tgc;1;;;;;;;;;;;ttc;2;tcc;2;tac;3;tgc;1
atc;;acc;;aac;;agc;;;atc;;acc;;aac;2;agc;1;;;;;;;;;;;atc;1;acc;1;aac;4;agc;2
ctc;1;ccc;1;cac;;cgt;;;ctc;1;ccc;;cac;1;cgt;;;;;;;;;;;;ctc;;ccc;;cac;1;cgt;4
gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;1;gac;1;ggc;1;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;4
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;2;;ata;;aca;1;aaa;1;aga;;;;;;;;;;;;ata;;aca;3;aaa;5;aga;
cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;;;;;;;;;;cta;2;cca;4;caa;3;cga;
gta;;gca;;gaa;;gga;1;;gta;1;gca;;gaa;2;gga;;;;;;;;;;;;gta;5;gca;2;gaa;4;gga;3
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;;;;;;;;;;ttg;2;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;;;atgj;;acg;;aag;1;agg;;;;;;;;;;;;atgj;2;acg;;aag;;agg;
ctg;2;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;1;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ppm;;15;;;;;15;;ppm;22;;;;;;22;;;;;;;;;;;ppm;;;;68;;;68
  • Plasmide
atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;2;tcc;1;tac;3;tgc;1
atc;1;acc;;aac;;agc;;;atc;2;acc;;aac;3;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;1;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;;aga;1;;ata;1;aca;1;aaa;1;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;2;caa;2;cga;2
gta;;gca;;gaa;;gga;1;;gta;;gca;1;gaa;2;gga;2
ttg;;tcg;;tag;;tgg;;;ttg;1;tcg;2;tag;;tgg;3
atgj;;acg;;aag;;agg;;;atgj;;acg;1;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ppm;;6;;;;;6;;ppm;45;;;;;;45

ppm données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: ppm données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
;CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA tRNA;;tRNA tRNA;;tRNA tRNA;;;CDS-CDS;400-600;;reste;Sup 700
;effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;;effectif;;;long;long
;fxt;fct;ppm;fx;fc;ppm;fx40;fc40;ppm;x-;c-;c;x;c;aa;c;aa;c;x;aa;ppm;fx;fc;fx;fc
0;;0;0;0;19;0;0;19;-1;0;59;90;259;16s tRNA;;tRNA tRNA;contig;tRNA tRNA;suite;contig;400;1116;2955;708;702
10;;0;10;16;226;1;0;46;-2;0;0;145;204;98;gca;28;agc;7;;cca;410;10;13;730;702
20;;0;20;20;240;2;2;33;-3;0;0;157;94;tRNA 23s;;10;atgj;12;;ttg;420;6;17;734;705
30;;0;30;11;212;3;0;22;-4;7;229;226;122;129;gca;4;gta;5;;cgt;430;8;8;749;719
40;;0;40;16;141;4;2;28;-5;0;0;1133;246;130;gca;19;aca;38;;ggc;440;5;16;751;719
50;;1;50;22;136;5;4;25;-6;0;0;73;262;186;gca;77;gac;28;;aaa;450;7;2;763;723
60;;0;60;16;103;6;3;17;-7;0;6;44;148;5s tRNA;;9;ttc;26;;gac;460;8;8;764;728
70;;0;70;33;103;7;0;14;-8;2;76;165;130;39;atc;7;tac;30;;atgf;470;6;9;770;736
80;;2;80;46;105;8;3;12;-9;1;0;107;244;34;atc;**;aaa;9;;gta;480;4;3;778;740
90;;1;90;60;114;9;0;13;-10;1;4;265;520;82;gca;22;atc;17;;gaa;490;3;7;794;743
100;2;0;100;49;98;10;2;16;-11;2;27;129;381;2* 18;aac;4;gca;3;;tcc;500;5;7;800;743
110;;2;110;51;110;11;3;12;-12;1;0;213;91;38;atc;34;aac;**;;aac;510;8;8;811;745
120;;0;120;58;96;12;2;31;-13;1;1;270;222;23s tRNA;;3;atgj;9;;gga;520;5;8;836;751
130;3;2;130;54;91;13;2;25;-14;0;22;123;139;131;agc;31;agc;22;;cca;530;5;9;844;752
140;1;0;140;45;93;14;2;30;-15;0;0;107;279;tRNA tRNA;intra;6;gaa;5;;cgt;540;2;7;854;755
150;1;1;150;53;69;15;2;23;-16;1;1;214;504;2* 20;atc gca;10;gta;10;;ggc;550;5;5;855;761
160;;1;160;43;87;16;2;29;-17;1;18;1861;249;tRNA tRNA;;25;atgf;11;;cta;560;4;3;866;763
170;;1;170;40;88;17;3;21;-18;0;0;2208;247;1;aac;50;gac;4;;aaa;570;4;2;988;775
180;1;0;180;29;79;18;1;22;-19;0;1;726;122;**;agc;25;ttc;55;;caa;580;4;4;1042;786
190;;0;190;32;84;19;1;21;-20;1;15;77;238;86;gaa;5;aca;11;;gta;590;5;2;1130;795
200;;0;200;35;74;20;2;26;-21;0;0;;207;15;aaa;16;tac;11;;gaa;600;1;3;1176;798
210;3;0;210;40;54;21;1;20;-22;0;1;;174;**;ctc;18;cac;3;;acc;610;4;3;1244;801
220;;2;220;35;56;22;0;21;-23;0;11;;206;11;gcc;4;caa;**;;aac;620;1;1;1277;805
230;1;1;230;36;62;23;1;22;-24;0;1;CDS 16s;;**;aag;15;aaa;;;;630;1;4;1310;820
240;1;0;240;28;45;24;0;19;-25;0;5;323;612;11;ttg;6;ctg;;;;640;3;1;1482;824
250;4;0;250;37;44;25;3;16;-26;1;10;408;570;11;tgc;10;ggc;;;;650;0;0;1505;836
260;1;0;260;16;36;26;0;24;-27;0;0;388;;6;ggc;26;tgc;;;;660;4;5;;840
270;1;2;270;22;28;27;2;25;-28;0;1;520;;9;caa;22;cgt;;;;670;3;3;;847
280;1;0;280;28;44;28;4;20;-29;0;6;607;;17;cac;9;cca;;;;680;2;1;;849
290;;0;290;19;28;29;0;21;-30;0;0;445;;7;tgg;**;gga;;CDS-CDS;inf 50;690;1;1;;857
300;;0;300;20;22;30;0;24;-31;0;0;536;;4;tac;4;gca;;intercalaire;;700;1;4;;866
310;;0;310;15;23;31;3;14;-32;2;3;422;;22;aca;3;aac;;c-;x-;;;;;867
320;;0;320;14;20;32;1;19;-33;1;0;489;;35;ttc;19;tcc;;-101;-87;;;;;888
330;;0;330;10;21;33;2;16;-34;0;1;363;;15;gac;9;gaa;;-80;-71;;;;;893
340;;0;340;14;15;34;0;15;-35;0;4;376;;25;atgf;29;gta;;-64;-68;;;;;898
350;;0;350;12;22;35;1;14;-36;0;0;16s 23s;;58;gta;25;atgf;;-55;;;;;;955
360;;0;360;11;20;36;0;20;-37;0;0;290;;17;gaa;13;gac;;-55;;;;;;977
370;;0;370;11;8;37;2;8;-38;1;1;4* 217;;3;tcc;4;aca;;-53;;;;;;979
380;;0;380;6;14;38;3;14;-39;0;0;218;;**;aac;102;tac;;-53;;;;;;1005
390;1;0;390;4;18;39;3;12;-40;0;2;231;;;;4;caa;;total;intercalaires;;;;;1018
400;;0;400;9;7;40;1;9;-41;1;2;2* 410;;;;12;aaa;;;791,31;;;;;1020
reste;2;4;reste;151;221;reste;1204;2338;-42;0;0;353;;;;10;cta;;ADN long;5,728,392;;;;;1028
;23;20;total;1267;3176;total;1267;3176;-43;0;0;23s 5s;;;;5;ggc;;%;13.8;;;;;1046
;21;16;diagr;1116;2936;diagr;63;819;-44;0;4;6* 77;;;;12;cgt;;;;;;;;1108
;0;0; t30;47;678;;;;-45;1;0;3* 78;;;;7;ttg;;non RNA;8;;;;;1110
;;;;;;;;;-46;0;0;144;;;;7;cca;;;;;;;;1130
;;;Récapitulatif des effectifs;;;;;;-47;1;2;2* 145;;;;**;gga;;;;;;;;1167
;;;>0;<0;zéro;total;*;;-48;0;0;16s 5s;;;;;;;;;;;;;1215
;;x;1267;29;0;1296;;;-49;0;1;117;;;;;;;;;;;;;1237
;;c;3157;523;19;3699;;;-50;0;2;102;;;;;;;;;;;;;1239
;;;;;;4995;190;;reste;3;7;5s CDS;;;;;;;;;;;;;1303
;;;;;;;5185;;total;29;523;232;176;;;;;;;;;;;;1323
;;;;;;;;;;;;343;183;;;;;;;;;;;;1390
;;;;;;;;;;;;216;236;;;;;;;;;;;;1431
;;;;;;;;;;;;383;;;;;;;;;;;;;1479
;;;;;;;;;;;;163;;;;;;;;;;;;;1614
;;;;;;;;;;;;;;;;;;;;;;;;;2159

ppm autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: ppm autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires ;;ppm;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;10545;11633;323;*;
;;rRNA;11957;13510;290;*;1554
;;rRNA;13801;16726;145;*;2926
;;rRNA;16872;16988;232;*;117
fin;;CDS;17221;17640;;0;
deb;comp;CDS;111496;112530;612;*;
;;rRNA;113143;114696;217;*;1554
;;rRNA;114914;117842;77;*;2929
;;rRNA;117920;118036;343;*;117
fin;;CDS;118380;119837;;;
deb;;CDS;123186;124469;90;*;
;;tRNA;124560;124648;145;*;tca
fin;;CDS;124794;125135;;;
deb;;CDS;176747;176944;111;*;
;;ncRNA;177056;177322;155;*;
fin;;CDS;177478;179229;;;
deb;;CDS;180728;181003;408;*;
;;rRNA;181412;182965;117;*;1554
;;rRNA;183083;183199;39;*;117
;;tRNA;183239;183315;20;*;atc
;;tRNA;183336;183411;129;*;gca
;;rRNA;183541;186467;131;*;2927
;;tRNA;186599;186690;28;*;agc
;;tRNA;186719;186795;10;*;atgj
;;tRNA;186806;186881;4;*;gta
;;tRNA;186886;186961;19;*;aca
;;tRNA;186981;187057;77;*;gac
;;tRNA;187135;187207;9;*;ttc
;;tRNA;187217;187302;7;*;tac
;;tRNA;187310;187382;157;*;aaa
fin;;CDS;187540;188682;;;
deb;comp;CDS;212745;213326;226;*;
;comp;tRNA;213553;213624;259;*;cgg
fin;;CDS;213884;214921;;;
deb;;CDS;224658;225137;255;*;
;;tmRNA;225393;225757;618;*;
fin;;CDS;226376;227050;;;
deb;;CDS;453754;455364;388;*;
;;rRNA;455753;457306;217;*;1554
;;rRNA;457524;460452;77;*;2929
;;rRNA;460530;460646;34;*;117
;;tRNA;460681;460757;22;*;atc
;;tRNA;460780;460855;4;*;gca
;;tRNA;460860;460935;34;*;aac
;;tRNA;460970;461043;3;*;atgj
;;tRNA;461047;461138;31;*;agc
;;tRNA;461170;461241;6;*;gaa
;;tRNA;461248;461323;10;*;gta
;;tRNA;461334;461407;25;*;atgf
;;tRNA;461433;461509;50;*;gac
;;tRNA;461560;461632;25;*;ttc
;;tRNA;461658;461733;5;*;aca
;;tRNA;461739;461824;16;*;tac
;;tRNA;461841;461913;18;*;cac
;;tRNA;461932;462006;4;*;caa
;;tRNA;462011;462086;15;*;aaa
;;tRNA;462102;462189;6;*;ctg
;;tRNA;462196;462270;10;*;ggc
;;tRNA;462281;462351;26;*;tgc
;;tRNA;462378;462454;22;*;cgt
;;tRNA;462477;462550;9;*;cca
;;tRNA;462560;462630;204;*;gga
fin;comp;CDS;462835;463938;;;
deb;;CDS;465476;466216;520;*;
;;rRNA;466737;468290;217;*;1554
;;rRNA;468508;471432;78;*;2925
;;rRNA;471511;471627;176;*;117
fin;comp;CDS;471804;471962;;0;
deb;comp;CDS;578235;578336;570;*;
;;rRNA;578907;580460;217;*;1554
;;rRNA;580678;583605;78;*;2928
;;rRNA;583684;583800;82;*;117
;;tRNA;583883;583958;4;*;gca
;;tRNA;583963;584038;3;*;aac
;;tRNA;584042;584133;19;*;tcc
;;tRNA;584153;584224;9;*;gaa
;;tRNA;584234;584309;29;*;gta
;;tRNA;584339;584412;25;*;atgf
;;tRNA;584438;584514;13;*;gac
;;tRNA;584528;584603;4;*;aca
;;tRNA;584608;584693;102;*;tac
;;tRNA;584796;584870;4;*;caa
;;tRNA;584875;584950;12;*;aaa
;;tRNA;584963;585043;10;*;cta
;;tRNA;585054;585128;5;*;ggc
;;tRNA;585134;585210;12;*;cgt
;;tRNA;585223;585302;7;*;ttg
;;tRNA;585310;585386;7;*;cca
;;tRNA;585394;585464;1133;*;gga
fin;;CDS;586598;587560;;0;
deb;;CDS;609577;609924;73;*;
;;tRNA;609998;610069;94;*;acg
fin;comp;CDS;610164;610445;;;
deb;;CDS;752841;754124;607;*;
;;rRNA;754732;756285;218;*;1554
;;rRNA;756504;759429;77;*;2926
;;rRNA;759507;759623;183;*;117
fin;comp;CDS;759807;760232;;0;
deb;;CDS;933311;934681;445;*;
;;rRNA;935127;936680;231;*;1554
;;rRNA;936912;939838;77;*;2927
;;rRNA;939916;940032;216;*;117
fin;;CDS;940249;941241;;;
deb;;CDS;1462425;1462937;44;*;
;;tRNA;1462982;1463057;1;*;aac
;;tRNA;1463059;1463147;122;*;agc
fin;comp;CDS;1463270;1464145;;;
deb;comp;CDS;1464220;1464981;246;*;
;;tRNA;1465228;1465299;86;*;gaa
;;tRNA;1465386;1465461;15;*;aaa
;;tRNA;1465477;1465559;165;*;ctc
fin;;CDS;1465725;1466180;;;
deb;comp;CDS;1467848;1468585;262;*;
;;tRNA;1468848;1468930;148;*;ctc
fin;comp;CDS;1469079;1469564;;0;
deb;comp;CDS;1583500;1583721;130;*;
;;tRNA;1583852;1583925;244;*;ccc
fin;comp;CDS;1584170;1585441;;0;
deb;;CDS;1617541;1619682;107;*;
;;tRNA;1619790;1619860;265;*;gga
fin;;CDS;1620126;1621163;;;
deb;;CDS;1875693;1876160;129;*;
;;tRNA;1876290;1876365;11;*;gcc
;;tRNA;1876377;1876449;520;*;aag
fin;comp;CDS;1876970;1877974;;;
deb;comp;CDS;1933190;1933630;381;*;
;;tRNA;1934012;1934096;91;*;ctg
fin;comp;CDS;1934188;1934718;;0;
deb;;CDS;1982038;1982799;58;*;
;;ncRNA;1982858;1983052;216;*;
fin;;CDS;1983269;1983661;;0;
deb;comp;CDS;2009566;2010102;222;*;
;;tRNA;2010325;2010409;213;*;ctg
fin;;CDS;2010623;2011135;;;
deb;;CDS;2443744;2448333;536;*;
;;rRNA;2448870;2450423;410;*;1554
;;rRNA;2450834;2453760;144;*;2927
;;rRNA;2453905;2454021;236;*;117
fin;comp;CDS;2454258;2455367;;;
deb;;CDS;2642172;2643329;422;*;
;;rRNA;2643752;2645305;353;*;1554
;;rRNA;2645659;2648585;145;*;2927
;;rRNA;2648731;2648847;383;*;117
fin;;CDS;2649231;2650082;;;
deb;comp;CDS;3533806;3534249;139;*;
;;tRNA;3534389;3534460;279;*;gtc
fin;comp;CDS;3534740;3535069;;;
deb;;CDS;3639395;3639562;504;*;
;comp;tRNA;3640067;3640152;249;*;tta
fin;;CDS;3640402;3640560;;;
deb;;CDS;3668653;3669450;247;*;
;comp;tRNA;3669698;3669763;270;*;atgj
fin;comp;CDS;3670034;3670234;;;
deb;;CDS;3724691;3725086;122;*;
;comp;tRNA;3725209;3725282;123;*;atgi
fin;comp;CDS;3725406;3725570;;;
deb;;CDS;3796407;3797627;286;*;
;comp;ncRNA;3797914;3798312;79;*;
fin;comp;CDS;3798392;3798958;;;
deb;comp;CDS;4338508;4339209;107;*;
;comp;tRNA;4339317;4339390;7;*;cca
;comp;tRNA;4339398;4339477;12;*;ttg
;comp;tRNA;4339490;4339566;5;*;cgt
;comp;tRNA;4339572;4339646;38;*;ggc
;comp;tRNA;4339685;4339757;28;*;aaa
;comp;tRNA;4339786;4339862;26;*;gac
;comp;tRNA;4339889;4339965;30;*;atgf
;comp;tRNA;4339996;4340071;9;*;gta
;comp;tRNA;4340081;4340152;17;*;gaa
;comp;tRNA;4340170;4340261;3;*;tcc
;comp;tRNA;4340265;4340340;18;*;aac
;comp;rRNA;4340359;4340475;78;*;117
;comp;rRNA;4340554;4343481;410;*;2928
;comp;rRNA;4343892;4345445;489;*;1554
fin;comp;CDS;4345935;4347563;;;
deb;comp;CDS;4394160;4395092;238;*;
;;tRNA;4395331;4395404;214;*;aga
fin;;CDS;4395619;4396383;;0;
deb;;CDS;4446278;4447621;207;*;
;comp;tRNA;4447829;4447902;174;*;aga
fin;;CDS;4448077;4448370;;0;
deb;comp;CDS;4703166;4703687;1861;*;
;comp;tRNA;4705549;4705627;11;*;ttg
;comp;tRNA;4705639;4705713;11;*;tgc
;comp;tRNA;4705725;4705796;6;*;ggc
;comp;tRNA;4705803;4705877;9;*;caa
;comp;tRNA;4705887;4705959;17;*;cac
;comp;tRNA;4705977;4706050;7;*;tgg
;comp;tRNA;4706058;4706143;4;*;tac
;comp;tRNA;4706148;4706223;22;*;aca
;comp;tRNA;4706246;4706318;35;*;ttc
;comp;tRNA;4706354;4706430;15;*;gac
;comp;tRNA;4706446;4706522;25;*;atgf
;comp;tRNA;4706548;4706623;58;*;gta
;comp;tRNA;4706682;4706753;17;*;gaa
;comp;tRNA;4706771;4706862;3;*;tcc
;comp;tRNA;4706866;4706941;2208;*;aac
fin;comp;CDS;4709150;4710085;;;
deb;comp;CDS;4987142;4989934;726;*;
;comp;tRNA;4990661;4990731;9;*;gga
;comp;tRNA;4990741;4990814;22;*;cca
;comp;tRNA;4990837;4990913;5;*;cgt
;comp;tRNA;4990919;4990993;10;*;ggc
;comp;tRNA;4991004;4991084;11;*;cta
;comp;tRNA;4991096;4991171;4;*;aaa
;comp;tRNA;4991176;4991250;55;*;caa
;comp;tRNA;4991306;4991381;11;*;gta
;comp;tRNA;4991393;4991464;11;*;gaa
;comp;tRNA;4991476;4991548;3;*;acc
;comp;tRNA;4991552;4991627;18;*;aac
;comp;rRNA;4991646;4991762;77;*;117
;comp;rRNA;4991840;4994767;130;*;2928
;comp;tRNA;4994898;4994973;20;*;gca
;comp;tRNA;4994994;4995070;38;*;atc
;comp;rRNA;4995109;4995225;102;*;117
;comp;rRNA;4995328;4996881;363;*;1554
fin;comp;CDS;4997245;4997475;;;
deb;comp;CDS;5057616;5058803;163;*;
;comp;rRNA;5058967;5059083;77;*;117
;comp;rRNA;5059161;5062088;186;*;2928
;comp;tRNA;5062275;5062350;98;*;gca
;comp;rRNA;5062449;5064002;376;*;1554
fin;comp;CDS;5064379;5066394;;;
deb;;CDS;5714294;5714611;206;*;
;comp;tRNA;5714818;5714908;77;*;tcg
fin;comp;CDS;5714986;5715210;;;

ppmp données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: ppmp données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
;CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;tRNA tRNA;;;tRNA hors bloc;;reste;Sup 400
;effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;supposé contigu;;intercalaire;ppmp;long;long
;fxt;fct;ppmp;fx;fc;ppmp;fx40;fc40;ppmp;x-;c-;c;x;c;x;aa;c;aa;fx;fc
0;;1;0;0;3;0;0;3;-1;;4;536;100;tRNA contig;;;tRNA hors;;404;401
10;;;10;0;18;1;0;1;-2;;0;33;89;5;;agc;3;tta;420;401
20;1;;20;0;26;2;0;3;-3;;0;-24;35;63;;tgc;**;aca;427;402
30;;1;30;4;21;3;0;3;-4;;11;106;116;7;;gaa;8;tcg;433;403
40;1;1;40;1;23;4;0;2;-5;;0;226;18;6;;ctt;7;tcc;438;406
50;;;50;2;10;5;0;4;-6;;1;119;94;101;;cca;6;ctt;442;410
60;;;60;3;14;6;0;2;-7;;0;444;977;4;;tgg;5;tcg;466;423
70;;;70;4;22;7;0;0;-8;;4;248;;7;;tat;**;tca;480;427
80;;;80;1;21;8;0;1;-9;;0;126;;6;;caa;;;512;439
90;1;;90;4;20;9;0;1;-10;;0;116;;5;;cac;;;514;439
100;2;;100;2;11;10;0;1;-11;;2;24;;125;;gac;;;546;440
110;;1;110;1;8;11;0;0;-12;;0;763;;10;;gga;;;560;446
120;1;2;120;3;11;12;0;2;-13;;0;164;;4;;aac;CDS-CDS;inf 50;565;448
130;;1;130;1;12;13;0;7;-14;;2;;;9;;tac;intercalaire;;582;470
140;;;140;3;14;14;0;1;-15;;0;;;82;;ata;c-;x-;593;476
150;;;150;4;14;15;0;4;-16;;0;;;5;;atgi;-92;néant;602;476
160;;;160;9;10;16;0;2;-17;;0;;;4;;aac;-56;;643;484
170;;1;170;2;8;17;0;4;-18;;0;;;131;;tgg;total;intercalaires;654;490
180;;;180;2;8;18;0;4;-19;;0;;;5;;gaa;;119,608;657;503
190;;;190;5;10;19;0;2;-20;;2;;;55;;ggc;ADN long;510,118;735;504
200;;;200;2;11;20;0;0;-21;;0;;;22;;ttc;%;23.4;753;521
210;;;210;1;7;21;0;2;-22;;1;;;7;;cga;;;933;524
220;;;220;2;13;22;0;3;-23;;1;;;5;;cca;non RNA;2;1087;532
230;;1;230;3;10;23;0;2;-24;;0;;;5;;ttg;;;1108;562
240;;;240;1;5;24;1;2;-25;;1;;;4;;atc;;;1171;562
250;;1;250;3;7;25;0;3;-26;;0;;;5;;atgf;;;;576
260;;;260;1;2;26;0;4;-27;;0;;;109;;gca;;;;586
270;;;270;3;3;27;1;1;-28;;0;;;3;;cga;;;;598
280;;;280;2;7;28;1;1;-29;;0;;;13;;cta;;;;600
290;;;290;5;4;29;0;1;-30;;0;;;8;;atc;;;;608
300;;;300;1;3;30;1;2;-31;;0;;;4;;aac;;;;619
310;;;310;0;5;31;0;3;-32;;0;;;**;;tgg;;;;620
320;;;320;1;4;32;0;1;-33;;0;;;8;;gac;;;;642
330;;;330;0;4;33;0;2;-34;;0;;;86;;tac;;;;672
340;;;340;2;1;34;0;0;-35;;0;;;14;;aaa;;;;673
350;;;350;2;1;35;0;2;-36;;0;;;4;;gga;;;;719
360;;;360;0;5;36;0;6;-37;;0;;;7;;ttc;;;;719
370;;;370;0;1;37;0;1;-38;;0;;;**;;acg;;;;719
380;;;380;2;3;38;0;1;-39;;0;;;;;;;;;719
390;;;390;0;2;39;1;5;-40;;0;;;;;;;;;720
400;;;400;0;2;40;0;2;-41;;0;;;;;;;;;728
reste;1;3;reste;25;54;reste;102;347;-42;;0;;;;;;;;;743
;7;13;total;107;438;total;107;438;-43;;0;;;;;;;;;755
;6;9;diagr;82;381;diagr;5;88;-44;;0;;;;;;;;;804
;1;1; t30;4;65;;;;-45;;0;;;;;;;;;857
;;;;;;;;;-46;;0;;;;;;;;;863
;;;Récapitulatif des effectifs;;;;;;-47;;1;;;;;;;;;974
;;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;981
;;x;107;0;0;107;;;-49;;0;;;;;;;;;1009
;;c;435;32;3;470;;;-50;;0;;;;;;;;;1013
;;;;;;577;62;;reste;;2;;;;;;;;;1048
;;;;;;;639;;total;0;32;;;;;;;;;1053
;;;;;;;;;;;;;;;;;;;;1137
;;;;;;;;;;;;;;;;;;;;1882

ppmp autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: ppmp autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires ;;ppmp;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;3920;4174;536;*;
;;tRNA;4711;4803;5;*;agc
;;tRNA;4809;4883;63;*;tgc
;;tRNA;4947;5021;7;*;gaa
;;tRNA;5029;5105;6;*;ctt
;;tRNA;5112;5186;101;*;cca
;;tRNA;5288;5361;4;*;tgg
;;tRNA;5366;5441;7;*;tat
;;tRNA;5449;5522;6;*;caa
;;tRNA;5529;5605;5;*;cac
;;tRNA;5611;5686;125;*;gac
;;tRNA;5812;5887;10;*;gga
;;tRNA;5898;5973;4;*;aac
;;tRNA;5978;6066;9;*;tac
;;tRNA;6076;6153;82;*;ata
;;tRNA;6236;6311;5;*;atgi
;;tRNA;6317;6392;4;*;aac
;;tRNA;6397;6470;131;*;tgg
;;tRNA;6602;6678;5;*;gaa
;;tRNA;6684;6757;55;*;ggc
;;tRNA;6813;6885;22;*;ttc
;;tRNA;6908;6980;7;*;cga
;;tRNA;6988;7065;5;*;cca
;;tRNA;7071;7155;5;*;ttg
;;tRNA;7161;7235;4;*;atc
;;tRNA;7240;7317;5;*;atgf
;;tRNA;7323;7398;109;*;gca
;;tRNA;7508;7584;3;*;cga
;;tRNA;7588;7668;13;*;cta
;;tRNA;7682;7758;8;*;atc
;;tRNA;7767;7841;4;*;aac
;;tRNA;7846;7919;33;*;tgg
deb;;CDS;7953;8324;-24;*;
;;tRNA;8301;8378;8;*;gac
;;tRNA;8387;8473;86;*;tac
;;tRNA;8560;8632;14;*;aaa
;;tRNA;8647;8720;4;*;gga
;;tRNA;8725;8800;7;*;ttc
;;tRNA;8808;8882;100;*;acg
deb;comp;CDS;8983;9600;89;*;
;;tRNA;9690;9771;3;*;tta
;;tRNA;9775;9849;35;*;aca
fin;comp;CDS;9885;10169;;;
deb;comp;CDS;10320;10622;116;*;
;;tRNA;10739;10813;18;*;aca
fin;comp;CDS;10832;11146;;;
deb;comp;CDS;11363;11599;94;*;
;;tRNA;11694;11765;106;*;aga
fin;;CDS;11872;12312;;0;
deb;;CDS;13199;14083;226;*;
;;tRNA;14310;14385;8;*;tcg
;;tRNA;14394;14481;7;*;tcc
;;tRNA;14489;14560;6;*;ctt
;;tRNA;14567;14654;5;*;tcg
;;tRNA;14660;14751;119;*;tca
fin;;CDS;14871;15080;;0;
deb;comp;CDS;227125;227388;444;*;
;comp;tRNA;227833;227903;248;*;gga
deb;comp;CDS;228152;228391;126;*;
;comp;tRNA;228518;228624;116;*;other
fin;comp;CDS;228741;229064;;;
deb;comp;CDS;229793;229999;24;*;
;comp;tRNA;230024;230108;763;*;tca
deb;comp;CDS;230872;231393;164;*;
;comp;tRNA;231558;231640;977;*;tta
fin;;CDS;232618;233067;;0;
deb;;CDS;369072;371174;102;*;
;;misc_b;371277;371523;53;*;misc_b
fin;;CDS;371577;374243;;;

pmq[modifier | modifier le wikicode]

pmq opérons[modifier | modifier le wikicode]

58.3%GC;24.7.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paenibacillus mucilaginosus 3016;;;;;;;;;
;9206..10276;CDS;;322;322;;;357;
;10599..12139;16s;;269;;;;;
;12409..15343;23s;;95;;;;;
;15439..15555;5s;;178;178;;;;178
;15734..17190;CDS;;3061;;;;486;
;;;;;;;;;
;20252..21532;CDS;;47;47;;;427;47
;21580..21666;tca;;140;140;;;;
;21807..22157;CDS hp;@1;17;;;;117;
;22175..22357;CDS hp;;23;;;;*61;
;22381..22524;CDS hp;;86;;;;*48;
comp;22611..22796;CDS hp;;138;;;;*62;
comp;22935..25265;CDS replicase;;156;;;;*777;
;;;;;;;;;
;25422..26165;CDS;;220;220;;;248;
comp;26386..26460;cgg;;183;183;;;;183
;26644..27168;CDS;;151287;;;;175;
;;;;;;;;;
;178456..179454;CDS;;298;298;;;333;
;179753..181299;16s;;254;;;;;
;181554..184488;23s;;168;;;;;
;184657..184773;5s;;15;;;;;
;184789..184876;agc;;29;;;29;;
;184906..184982;atgj;;39;;;39;;
;185022..185097;gta;;15;;;15;;
;185113..185189;atgf;;14;;;14;;
;185204..185280;gac;;48;;;48;;
;185329..185404;ttc;;5;;;5;;
;185410..185485;aca;;9;;;9;;
;185495..185579;tac;;15;;;15;;
;185595..185670;aaa;;183;183;;;;183
comp;185854..187104;CDS;;30460;;;;417;
;;;;;;;;;
comp;217565..218146;CDS;;129;129;;;194;129
comp;218276..218350;cgg;;261;261;;;;
;218612..219643;CDS;;34238;;;;344;
;;;;;;;;;
;253882..254526;CDS;;677;*677;;;215;
;255204..256745;16s;;268;;;;;
;257014..259948;23s;;95;;;;;
;260044..260160;5s;;55;;;;;
;260216..260292;atc;;19;;;19;;
;260312..260387;gca;+;16;;;16;;
;260404..260475;gaa;2 gca;9;;;9;;
;260485..260569;tac;;20;;;20;;
;260590..260665;aac;;3;;;3;;
;260669..260744;gta;;19;;;19;;
;260764..260840;gac;;20;;;20;;
;260861..260933;ttc;;15;;;15;;
;260949..261021;aaa;;10;;;10;;
;261032..261118;ctg;;3;;;3;;
;261122..261196;ggc;;12;;;12;;
;261209..261280;tgc;;15;;;15;;
;261296..261369;cgt;;5;;;5;;
;261375..261448;cca;;158;;;*158;;
;261607..261682;gca;;4;;;4;;
;261687..261759;acc;;5;;;5;;
;261765..261854;tcg;;19;;;19;;
;261874..261961;agc;;17;;;17;;
;261979..262054;gtc;;5;;;5;;
;262060..262134;acg;;39;;;39;;
;262174..262262;tcc;;41;;;41;;
;262304..262386;ctc;;283;283;;;;*283
;262670..263515;CDS;;314679;;;;282;
;;;;;;;;;
;578195..579055;CDS;;324;324;;;287;
;579380..580921;16s;;258;;;;;
;581180..584114;23s;;166;;;;;
;584281..584397;5s;;31;;;;;
;584429..584505;aac;;6;;;6;;
;584512..584600;tcc;;38;;;38;;
;584639..584710;gaa;;11;;;11;;
;584722..584797;gta;;17;;;17;;
;584815..584891;atgf;;15;;;15;;
;584907..584983;gac;;67;;;67;;
;585051..585125;acg;;11;;;11;;
;585137..585212;cac;;10;;;10;;
;585223..585297;caa;;5;;;5;;
;585303..585378;aaa;;17;;;17;;
;585396..585470;ggc;+;40;;;40;;
;585511..585585;ggc;2 ggc;24;;;24;;
;585610..585692;ttg;;5;;;5;;
;585698..585774;cca;;19;;;19;;
;585794..585867;gga;;1;;;1;;
;585869..585942;aga;;187;187;;;;187
;586130..586885;CDS;;85587;;;;252;
;;;;;;;;;
;672473..672949;CDS;;18;18;;;159;18
;672968..673043;aac;;7;;7;;;
;673051..673138;agc;@2;297;;297;;;
;673436..673507;gaa;;9;;9;;;
;673517..673599;ctc;;180;180;;;;
;673780..674199;CDS;;182;;;;140;
;;;;;;;;;
;674382..675278;CDS;;159;159;;;299;
;675438..675520;ctc;;64;64;;;;64
;675585..675833;CDS;;18450;;;;83;
;;;;;;;;;
;694284..695636;CDS;;797;*797;;;451;
;696434..697974;16s;;261;;;;;
;698236..701170;23s;;94;;;;;
;701265..701381;5s;;43;;;;;
;701425..701498;atc;;11;;;11;;
;701510..701584;gaa;;5;;;5;;
;701590..701665;gtc;;5;;;5;;
;701671..701747;atgf;;4;;;4;;
;701752..701825;tgg;;9;;;9;;
;701835..701909;caa;;8;;;8;;
;701918..701990;aaa;;18;;;18;;
;702009..702095;ctg;;4;;;4;;
;702100..702174;ggc;;11;;;11;;
;702186..702259;cgt;;12;;;12;;
;702272..702348;cca;;577;*577;;;;*577
;702926..703120;CDS;;370320;;;;65;
;;;;;;;;;
;1073441..1074214;CDS;;373;373;;;258;
;1074588..1076136;16s;;260;;;;;
;1076397..1079331;23s;;168;;;;;
;1079500..1079616;5s;;9;;;;;
;1079626..1079701;aac;;6;;;6;;
;1079708..1079796;tcc;;38;;;38;;
;1079835..1079906;gaa;;11;;;11;;
;1079918..1079993;gta;;17;;;17;;
;1080011..1080087;atgf;;13;;;13;;
;1080101..1080177;gac;;49;;;49;;
;1080227..1080302;ttc;;4;;;4;;
;1080307..1080382;aca;;13;;;13;;
;1080396..1080481;tac;;8;;;8;;
;1080490..1080560;tgg;;13;;;13;;
;1080574..1080649;cac;;26;;;26;;
;1080676..1080747;caa;;9;;;9;;
;1080757..1080831;ggc;;12;;;12;;
;1080844..1080917;tgc;;10;;;10;;
;1080928..1081016;tta;;20;;;20;;
;1081037..1081113;cgt;;3;;;3;;
;1081117..1081199;ttg;;147;147;;;;147
;1081347..1081973;CDS;;128630;;;;209;
;;;;;;;;;
;1210604..1213519;CDS;;354;354;;;972;
;1213874..1213949;gca;;16;;16;;;
;1213966..1214037;gaa;;12;;12;;;
;1214050..1214125;gta;;16;;16;;;
;1214142..1214218;gac;;17;;17;;;
;1214236..1214311;cac;;9;;9;;;
;1214321..1214395;caa;;9;;9;;;
;1214405..1214477;aaa;;8;;8;;;
;1214486..1214572;ctg;;3;;3;;;
;1214576..1214647;ggc;;169;169;;;;169
comp;1214817..1215602;CDS;;378784;;;;262;
;;;;;;;;;
;1594387..1594665;CDS;;537;*537;;;93;
;1595203..1596743;16s;;252;;;;;
;1596996..1599930;23s;;94;;;;;
;1600025..1600141;5s;;43;;;;;
;1600185..1600261;atc;;19;;;19;;
;1600281..1600356;gca;;17;;;17;;
;1600374..1600445;gaa;;8;;;8;;
;1600454..1600529;gta;+;5;;;5;;
;1600535..1600610;aca;2 gta;10;;;10;;
;1600621..1600705;tac;;18;;;18;;
;1600724..1600799;aac;;4;;;4;;
;1600804..1600879;gta;;21;;;21;;
;1600901..1600977;atgf;;12;;;12;;
;1600990..1601066;gac;;34;;;34;;
;1601101..1601176;cac;;13;;;13;;
;1601190..1601264;caa;;8;;;8;;
;1601273..1601345;aaa;;17;;;17;;
;1601363..1601448;ctc;;13;;;13;;
;1601462..1601548;ctg;;5;;;5;;
;1601554..1601628;ggc;;14;;;14;;
;1601643..1601713;tgc;;10;;;10;;
;1601724..1601797;cgt;;5;;;5;;
;1601803..1601876;cca;;105;105;;;;105
;1601982..1602245;CDS;;232535;;;;88;
;;;;;;;;;
;1834781..1835260;CDS;;106;106;;;160;106
;1835367..1835439;gcc;;137;137;;;;
comp;1835577..1835978;CDS;;371114;;;;134;
;;;;;;;;;
comp;2207093..2208091;CDS;;192;192;;;333;192
;2208284..2208367;ctg;+;49;;49;;;
;2208417..2208500;ctg;2 ctg;315;315;;;;
;2208816..2209952;CDS;;1246561;;;;379;
;;;;;;;;;
;3456514..3456786;CDS;;256;256;;;91;
;3457043..3457119;ccc;;142;142;;;;142
;3457262..3457483;CDS;;1547757;;;;74;
;;;;;;;;;
comp;5005241..5005426;CDS;;127;127;;;62;127
comp;5005554..5005636;ctc;;40;;40;;;
comp;5005677..5005765;tcc;;13;;13;;;
comp;5005779..5005852;atg;;19;;19;;;
comp;5005872..5005958;tcg;;167;167;;;;
;5006126..5006220;ncRNA;;1377035;;;;32;
;;;;;;;;;
comp;6383256..6384173;CDS;;228;228;;;306;
;6384402..6384477;gtc;;69;69;;;;69
comp;6384547..6385458;CDS;;5453;;;;304;
;;;;;;;;;
comp;6390912..6391130;CDS;;142;142;;;73;142
comp;6391273..6391358;tta;;7;;7;;;
comp;6391366..6391442;atgi;;19;;19;;;
comp;6391462..6391538;atgf;;370;370;;;;
comp;6391909..6392460;CDS;;962046;;;;184;
;;;;;;;;;
;7354507..7354737;CDS;;342;342;;;77;*342
comp;7355080..7355162;ctc;;28;;;28;;
comp;7355191..7355279;tcc;;12;;;12;;
comp;7355292..7355368;atgf;;14;;;14;;
comp;7355383..7355459;atgj;;14;;;14;;
comp;7355474..7355561;agc;;8;;;8;;
comp;7355570..7355659;tcg;;4;;;4;;
comp;7355664..7355736;acc;;4;;;4;;
comp;7355741..7355816;gca;;119;;;;;
;7355936..7356030;ncRNA;@3;36;;;;;
comp;7356067..7356140;cca;;6;;;6;;
comp;7356147..7356220;cgt;;104;;;*104;;
comp;7356325..7356396;ggc;;7;;;7;;
comp;7356404..7356490;ctg;;9;;;9;;
comp;7356500..7356572;aaa;;9;;;9;;
comp;7356582..7356656;caa;;9;;;9;;
comp;7356666..7356741;cac;;17;;;17;;
comp;7356759..7356835;gac;;12;;;12;;
comp;7356848..7356923;gta;;4;;;4;;
comp;7356928..7357003;aac;;15;;;15;;
comp;7357019..7357103;tac;;8;;;8;;
comp;7357112..7357187;aca;;5;;;5;;
comp;7357193..7357264;gaa;;15;;;15;;
comp;7357280..7357355;gcc;;9;;;9;;
comp;7357365..7357438;atc;;54;;;;;
comp;7357493..7357609;5s;;112;;;;;
comp;7357722..7360655;23s;;258;;;;;
comp;7360914..7362454;16s;;403;*403;;;;
;7362858..7363397;CDS;;254752;;;;180;
;;;;;;;;;
;7618150..7618842;CDS;;280;280;;;231;*280
comp;7619123..7619193;ggg;;335;335;;;;
;7619529..7620461;CDS;;46171;;;;311;
;;;;;;;;;
comp;7666633..7668069;CDS;;104;104;;;479;104
comp;7668174..7668244;ggg;;5;;;5;;
comp;7668250..7668326;cca;;106;;;*106;;
comp;7668433..7668506;cgt;;11;;;11;;
comp;7668518..7668592;ggc;;5;;;5;;
comp;7668598..7668684;ctg;;13;;;13;;
comp;7668698..7668783;ctc;;16;;;16;;
comp;7668800..7668872;aaa;;10;;;10;;
comp;7668883..7668967;tac;;28;;;28;;
comp;7668996..7669071;ttc;;12;;;;;
comp;7669084..7669200;5s;;159;;;;;
comp;7669360..7672297;23s;;256;;;;;
comp;7672554..7674095;16s;;537;*537;;;;
;7674633..7675382;CDS;;177794;;;;250;
;;;;;;;;;
comp;7853177..7853761;CDS;;57;57;;;195;57
comp;7853819..7853892;cac;;230;;230;;;
comp;7854123..7854196;cac;;404;*404;;;;
comp;7854601..7854801;CDS;;245639;;;;67;
;;;;;;;;;
comp;8100441..8100854;CDS;;123;123;;;138;123
comp;8100978..8101094;5s;;167;;;;;
comp;8101262..8104180;23s;;248;;;;;
comp;8104429..8105969;16s;;325;325;;;;
comp;8106295..8106636;CDS;;45281;;;;114;
;;;;;;;;;
comp;8151918..8152448;CDS;;460;*460;;;177;*460
comp;8152909..8153031;5s;;94;;;;;
comp;8153126..8156060;23s;;258;;;;;
comp;8156319..8157859;16s;;456;*456;;;;
;8158316..8158642;CDS;;98285;;;;109;
;;;;;;;;;
;8256928..8257746;CDS;;83;83;;;273;83
comp;8257830..8257903;gga;;5;;;5;;
comp;8257909..8257985;cca;;16;;;16;;
comp;8258002..8258078;cgt;;4;;;4;;
comp;8258083..8258157;ggc;;8;;;8;;
comp;8258166..8258248;cta;;42;;;42;;
comp;8258291..8258366;aaa;;8;;;8;;
comp;8258375..8258449;caa;;9;;;9;;
comp;8258459..8258532;tgg;;4;;;4;;
comp;8258537..8258613;atgf;;5;;;5;;
comp;8258619..8258694;gtc;;5;;;5;;
comp;8258700..8258774;gaa;;11;;;11;;
comp;8258786..8258859;atc;;43;;;;;
comp;8258903..8259019;5s;;94;;;;;
comp;8259114..8262048;23s;;255;;;;;
comp;8262304..8263845;16s;;306;306;;;;
comp;8264152..8264370;CDS;;58373;;;;73;
;;;;;;;;;
comp;8322744..8323205;CDS;;393;393;;;154;*393
comp;8323599..8323715;5s;;94;;;;;
comp;8323810..8326748;23s;;258;;;;;
comp;8327007..8328547;16s;;369;369;;;;
comp;8328917..8330413;CDS;;21505;;;;499;
;;;;;;;;;
comp;8351919..8354414;CDS;;396;396;;;832;
comp;8354811..8354884;atg;;149;149;;;;149
comp;8355034..8355537;CDS;;34450;;;;168;
;;;;;;;;;
;8389988..8390512;CDS;;296;296;;;175;*296
comp;8390809..8390925;5s;;94;;;;;
comp;8391020..8393954;23s;;259;;;;;
comp;8394214..8395754;16s;;234;234;;;;
comp;8395989..8396255;CDS;;220222;;;;89;
;;;;;;;;;
comp;8616478..8616924;CDS;;417;*417;;;149;
;8617342..8617418;gac;;157;157;;;;157
;8617576..8618541;CDS;;105821;;;;322;
;;;;;;;;;
;8724363..8724614;CDS;;455;*455;;;84;
comp;8725070..8725160;tcg;;165;165;;;;165
comp;8725326..8725559;CDS;;9205;;;;78;
;;opéron;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd

pmq cumuls[modifier | modifier le wikicode]

pmq;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cds dirigé;gammes;cdsa;cdsd
avec rRNA;opérons;14;1;0;1;1;0;1;0;100;15;8
;16 23 5s 0;5;20;14;107;50;3;20;1;200;18;10
;16 atc gca;0;40;1;12;100;4;40;0;300;12;6
;16 23 5s a;9;60;1;4;150;11;60;2;400;9;3
;max a;23;80;0;1;200;11;80;2;500;6;4
;a doubles;3;100;0;0;250;3;100;1;600;0;0
;spéciaux;0;120;0;2;300;6;120;3;700;0;0
;total aas;138;140;0;0;350;7;140;3;800;0;0
sans ;opérons;17;160;0;1;400;6;160;5;900;1;0
;1 aa;11;180;0;0;450;3;180;3;1000;1;0
;max a;9;200;0;0;500;3;200;4;1100;0;0
;a doubles;1;;2;0;;5;;7;;0;0
;total aas;35;;18;128;;62;;31;;62;31
total aas;;173;;;;;;;;;;
remarques;;3;;;;;;;;;;
avec jaune;;;moyenne;;16;;;;;;235;213
;;;variance;;20;;;;;;184;122
sans jaune;;;moyenne;16;14;;207;;126;;;
;;;variance;12;11;;106;;49;;;

pmq blocs[modifier | modifier le wikicode]

Les blocs à rRNAs pmq;;;;;
CDS;298;324;373;12;
16s;254;258;260;159;
23s;168;166;168;256;
5s;15;31;9;537;
1er aa;agc;aac;aac;ttc;
aas;9;16;17;9;
CDS;183;187;147;104;
;;;;;
CDS;677;797;537;54;43
16s;268;261;252;112;94
23s;95;94;94;258;255
5s;55;43;43;403;306
atc / aas;22;11;19;23;12
CDS;283;577;105;342;83
;;;;;
CDS;322;123;460;393;296
16s;269;167;94;94;94
23s;95;248;258;258;259
5s;178;325;456;369;234

pmq distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;7
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;ctg2;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;ggc2  5s;ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;4;tcc;4;tac;6;tgc;3
atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;atc;;acc;;aac;;agc;;;atc;5;acc;2;aac;5;agc;3
ctc;1;ccc;1;cac;;cgt;;;ctc;2;ccc;;cac;3;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;4;ccc;;cac;4;cgt;7
gtc;1;gcc;1;gac;1;ggc;;;gtc;;gcc;;gac;1;ggc;1;;gtc;;gcc;;gac;;ggc;;;gtc;3;gcc;1;gac;6;ggc;9
tta;;tca;1;taa;;tga;;;tta;1;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;1;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;4;aaa;8;aga;1
cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;7;caa;6;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;1;gaa;2;gga;;;gta;;gca;;gaa;;gga;;;gta;7;gca;4;gaa;7;gga;2
ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;2;tcg;2;tag;;tgg;3
atgj;1;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;2;acg;2;aag;;agg;
ctg;;ccg;;cag;;cgg;2;;ctg;1;ccg;;cag;;cgg;;;ctg;2;ccg;;cag;;cgg;;;ctg;5;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;1
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
pmq;;11;;;;;11;;pmq;22;;;;;;22;;pmq;2;;;;;;2;;pmq;;;;138;;;138

pmq données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: pmq données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA contig;;tRNA contig;;tRNA contig;;;tRNA tRNA;;CDS-CDS;;400-800;;Sup 800;Sup 1200
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;;intercalaire;;frequence;effectif;;long;long;long
fxt;fct;pmq;fx;fc;pmq;fx40;fc40;pmq;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;c;x;aa;c;aa;pmq;fx;fc;fx;fc;fc
;0;0;5;26;0;5;26;-1;0;80;47;222;CDS 16s;;16s 23s;;tRNA contig;;tRNA contig;suite;tRNA contig;;suite;tRNA tRNA;hors bloc;400;1623;4186;804;807;1203
;0;10;15;298;1;1;52;-2;3;0;137;183;318;399;2* 280;;29;agc;11;atc;28;;ctc;7;aac;410;14;15;810;811;1206
;1;20;15;336;2;1;46;-3;0;1;129;183;299;533;266;;39;atgj;5;gaa;12;;tcc;297;agc;420;10;15;823;814;1240
;0;30;21;274;3;1;35;-4;11;384;283;261;673;793;272;;15;gta;5;gtc;14;;atgf;9;gaa;430;16;19;826;815;1252
;0;40;15;250;4;1;34;-5;0;1;187;169;320;;271;;14;atgf;4;atgf;14;;atgj;**;ctc;440;10;21;837;816;1263
;1;50;21;195;5;1;28;-6;3;1;18;137;377;;263;;48;gac;9;tgg;8;;agc;16;gca;450;9;10;849;819;1270
;0;60;24;156;6;1;32;-7;0;5;180;192;533;;4* 269;;5;ttc;8;caa;4;;tcg;12;gaa;460;12;13;851;827;1276
;1;70;32;142;7;2;28;-8;0;76;159;228;321;;268;;9;aca;18;aaa;4;;acc;16;gta;470;5;12;851;828;1276
1;1;80;45;170;8;2;12;-9;1;0;64;72;272;;259;;15;tac;7;ctg;;119;gca;17;gac;480;7;14;856;828;1277
1;1;90;45;162;9;4;10;-10;1;8;577;342;302;;267;;**;aaa;11;ggc;;36;ncRNA;9;cac;490;11;9;856;830;1351
;0;100;53;148;10;1;21;-11;2;32;150;280;365;;270;;19;atc;12;cgt;6;;cca;9;caa;500;15;11;858;852;1352
;3;110;55;121;11;1;23;-12;0;0;354;335;230;;23s 5s;;16;gca;**;cca;104;;cgt;8;aaa;510;6;7;858;863;1428
;0;120;61;117;12;0;38;-13;0;7;105;86;5s CDS;;2* 97;;9;gaa;6;aac;7;;ggc;3;ctg;520;7;7;873;868;1497
;1;130;78;119;13;1;43;-14;2;27;106;417;178;296;2* 170;;20;tac;38;tcc;9;;ctg;**;ggc;530;5;9;875;885;1534
1;1;140;60;95;14;1;45;-15;0;0;315;455;123;;168;;3;aac;11;gaa;9;;aaa;49;ctg;540;9;10;886;885;1546
;4;150;65;118;15;3;39;-16;0;5;256;;460;;6* 96;;19;gta;17;gta;9;;caa;**;ctg;550;6;14;896;899;1576
;2;160;67;87;16;2;34;-17;2;17;142;;393;;113;;20;gac;13;atgf;17;;cac;40;ctc;560;2;10;906;900;1613
1;1;170;75;94;17;1;25;-18;0;0;394;;;;161;;15;ttc;49;gac;12;;gac;13;tcc;570;6;9;910;903;1742
;1;180;66;111;18;3;36;-19;0;1;142;;;;169;;10;aaa;4;ttc;4;;gta;19;atgj;580;3;6;921;912;
2;1;190;81;93;19;3;29;-20;1;14;75;;;;5s tRNA;agc;3;ctg;13;aca;15;;aac;**;tcg;590;3;8;922;913;
1;0;200;64;95;20;0;24;-21;0;0;104;;;;15;atc;12;ggc;8;tac;8;;tac;7;tta;600;4;8;923;931;
;0;210;66;85;21;6;37;-22;1;5;84;;;;55;atc;15;tgc;13;tgg;5;;aca;19;atgi;610;4;11;930;932;
;0;220;59;85;22;1;32;-23;0;13;404;;;;54;atc;5;cgt;26;cac;15;;gaa;**;atgf;620;6;4;936;935;
2;0;230;53;78;23;2;24;-24;0;0;396;;;;3* 43;aac;158;cca;9;caa;9;;gcc;230;cac;630;2;4;940;947;
;0;240;54;87;24;2;45;-25;1;3;149;;;;9;aac;4;gca;12;ggc;**;;atc;**;cac;640;2;4;949;951;
;0;250;48;73;25;0;28;-26;3;13;157;;;;31;ttc;5;acc;10;tgc;5;;ggg;;;650;4;6;959;962;
;1;260;42;65;26;5;15;-27;0;0;165;;;;12;;19;tcg;20;tta;106;;cca;;;660;6;2;963;989;
1;0;270;43;60;27;2;24;-28;0;0;;;;;;;17;agc;3;cgt;11;;cgt;;;670;3;2;987;996;
1;0;280;35;59;28;2;14;-29;0;8;;;;;;;5;gtc;**;ttg;5;;ggc;;;680;2;3;992;1006;
;1;290;29;45;29;0;25;-30;0;0;;;CDS-CDS;inf 50;;;39;acg;19;atc;13;;ctg;;;690;2;4;1007;1013;
;0;300;23;35;30;1;30;-31;0;2;;;intercalaire;;;;41;tcc;17;gca;16;;ctc;;;700;2;2;1027;1024;
;0;310;35;45;31;0;26;-32;1;8;;;c-;x-;;;**;ctc;8;gaa;10;;aaa;;;710;1;4;1038;1040;
;1;320;28;32;32;1;21;-33;0;0;;;-119;-89;;;10;aac;5;gta;28;;tac;;;720;3;2;1042;1045;
;0;330;28;41;33;1;26;-34;1;2;;;-119;-75;;;38;tcc;10;aca;**;;ttc;;;730;1;4;1054;1052;
1;0;340;21;27;34;3;20;-35;1;6;;;-116;-73;;;11;gaa;18;tac;5;;gga;;;740;4;1;1055;1052;
1;0;350;25;33;35;1;31;-36;2;0;;;-115;-65;;;17;gta;4;aac;16;;cca;;;750;3;1;1084;1077;
;1;360;19;22;36;1;23;-37;0;2;;;-113;-51;;;15;atgf;21;gta;4;;cgt;;;760;4;2;1087;1088;
;0;370;15;25;37;3;24;-38;0;2;;;-101;;;;67;gac;12;atgf;8;;ggc;;;770;2;3;1169;1095;
;0;380;12;32;38;1;24;-39;0;0;;;-101;;;;11;acg;34;gac;42;;cta;;;780;2;2;1211;1109;
;0;390;15;24;39;2;27;-40;0;1;;;-95;;;;10;cac;13;cac;8;;aaa;;;790;3;0;1277;1141;
;2;400;10;26;40;2;28;-41;0;5;;;-95;;;;5;caa;8;caa;9;;caa;;;800;2;3;1279;1157;
2;2;reste;265;354;reste;1817;3356;-42;0;0;;;-74;;;;17;aaa;17;aaa;4;;tgg;;;;47;63;1318;1184;
15;27;total;1888;4540;total;1888;4540;-43;0;0;;;-65;;;;40;ggc;13;ctc;5;;atgf;;;;;;1378;1186;
13;25;diagr;1618;4160;diagr;66;1158;-44;1;3;;;-65;;;;24;ggc;5;ctg;5;;gtc;;;;;;1521;1189;
0;1; t30;51;908;;;;-45;0;0;;;-56;;;;8;ttg;14;ggc;11;;gaa;;;;;;1532;1200;
;;;;;;;;-46;0;1;;;-56;;;;19;cca;10;tgc;**;;atc;;;;;;1551;;
;;Récapitulatif des effectifs;;;;;;-47;0;1;;;-55;;;;1;gga;5;cgt;;;;;;;;;1651;;
;;>0;<0;zéro;total;*;;-48;0;0;;;-53;;;;**;aga;**;cca;;;;;;;;;;;
;x;1883;42;5;1930;;;-49;0;2;;;total;intercalaires;;;;;;;;;;;;;;;;;
;c;4514;753;26;5293;;;-50;0;1;;;;1,228,719;;;;;;;;;;;;;;;;;
;;;;;7223;256;;reste;5;16;;;ADN long;8,739,048;;;;;;;;;;;;;;;;;
;;;;;;7479;;total;42;753;;;%;14.1;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;non RNA;12;;;;;;;;;;;;;;;;;

pmq autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: pmq autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;pmq;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;9206;10276;318;*;
;;rRNA;10595;12131;280;*;16s
;;rRNA;12412;15341;97;*;23s
;;rRNA;15439;15555;178;*;5s
fin;;CDS;15734;17190;;;
deb;;CDS;20252;21532;47;*;
;;tRNA;21580;21669;137;*;tca
fin;;CDS;21807;22157;;;
deb;;CDS;25422;26165;222;*;
;comp;tRNA;26388;26460;183;*;cgg
fin;;CDS;26644;27168;;;
deb;;CDS;178456;179454;299;*;
;;rRNA;179754;181290;266;*;16s
;;rRNA;181557;184486;170;*;23s
;;rRNA;184657;184773;15;*;5s
;;tRNA;184789;184876;29;*;agc
;;tRNA;184906;184982;39;*;atgj
;;tRNA;185022;185097;15;*;gta
;;tRNA;185113;185189;14;*;atgf
;;tRNA;185204;185280;48;*;gac
;;tRNA;185329;185404;5;*;ttc
;;tRNA;185410;185485;9;*;aca
;;tRNA;185495;185579;15;*;tac
;;tRNA;185595;185670;183;*;aaa
fin;comp;CDS;185854;187104;;0;
deb;comp;CDS;217565;218146;129;*;
;comp;tRNA;218276;218350;261;*;cgg
fin;;CDS;218612;219643;;;
deb;;CDS;230970;231455;186;*;
;;tmRNA;231642;232004;140;*;
fin;;CDS;232145;232804;;;
deb;;CDS;253921;254526;673;*;
;;rRNA;255200;256736;280;*;16s
;;rRNA;257017;259946;97;*;23s
;;rRNA;260044;260160;55;*;5s
;;tRNA;260216;260292;19;*;atc
;;tRNA;260312;260387;16;*;gca
;;tRNA;260404;260475;9;*;gaa
;;tRNA;260485;260569;20;*;tac
;;tRNA;260590;260665;3;*;aac
;;tRNA;260669;260744;19;*;gta
;;tRNA;260764;260840;20;*;gac
;;tRNA;260861;260933;15;*;ttc
;;tRNA;260949;261021;10;*;aaa
;;tRNA;261032;261118;3;*;ctg
;;tRNA;261122;261196;12;*;ggc
;;tRNA;261209;261280;15;*;tgc
;;tRNA;261296;261369;5;*;cgt
;;tRNA;261375;261448;158;*;cca
;;tRNA;261607;261682;4;*;gca
;;tRNA;261687;261759;5;*;acc
;;tRNA;261765;261854;19;*;tcg
;;tRNA;261874;261961;17;*;agc
;;tRNA;261979;262054;5;*;gtc
;;tRNA;262060;262134;39;*;acg
;;tRNA;262174;262262;41;*;tcc
;;tRNA;262304;262386;283;*;ctc
fin;;CDS;262670;263515;;;
deb;;CDS;578195;579055;320;*;
;;rRNA;579376;580913;269;*;16s
;;rRNA;581183;584112;168;*;23s
;;rRNA;584281;584397;31;*;5s
;;tRNA;584429;584501;10;*;aac
;;tRNA;584512;584600;38;*;tcc
;;tRNA;584639;584710;11;*;gaa
;;tRNA;584722;584797;17;*;gta
;;tRNA;584815;584891;15;*;atgf
;;tRNA;584907;584983;67;*;gac
;;tRNA;585051;585125;11;*;acg
;;tRNA;585137;585212;10;*;cac
;;tRNA;585223;585297;5;*;caa
;;tRNA;585303;585378;17;*;aaa
;;tRNA;585396;585470;40;*;ggc
;;tRNA;585511;585585;24;*;ggc
;;tRNA;585610;585689;8;*;ttg
;;tRNA;585698;585774;19;*;cca
;;tRNA;585794;585867;1;*;gga
;;tRNA;585869;585942;187;*;aga
fin;;CDS;586130;586885;;;
deb;;CDS;672473;672949;18;*;
;;tRNA;672968;673043;7;*;aac
;;tRNA;673051;673138;297;*;agc
;;tRNA;673436;673507;9;*;gaa
;;tRNA;673517;673599;180;*;ctc
fin;;CDS;673780;674199;;;
deb;;CDS;674382;675278;159;*;
;;tRNA;675438;675520;64;*;ctc
fin;;CDS;675585;675833;;;
deb;comp;CDS;694284;695636;793;*;
;;rRNA;696430;697966;272;*;16s
;;rRNA;698239;701168;96;*;23s
;;rRNA;701265;701381;43;*;5s
;;tRNA;701425;701498;11;*;atc
;;tRNA;701510;701584;5;*;gaa
;;tRNA;701590;701665;5;*;gtc
;;tRNA;701671;701747;4;*;atgf
;;tRNA;701752;701825;9;*;tgg
;;tRNA;701835;701909;8;*;caa
;;tRNA;701918;701990;18;*;aaa
;;tRNA;702009;702092;7;*;ctg
;;tRNA;702100;702174;11;*;ggc
;;tRNA;702186;702259;12;*;cgt
;;tRNA;702272;702348;577;*;cca
fin;;CDS;702926;703120;;;
deb;;CDS;1073441;1074214;377;*;
;;rRNA;1074592;1076128;271;*;16s
;;rRNA;1076400;1079329;170;*;23s
;;rRNA;1079500;1079616;9;*;5s
;;tRNA;1079626;1079701;6;*;aac
;;tRNA;1079708;1079796;38;*;tcc
;;tRNA;1079835;1079906;11;*;gaa
;;tRNA;1079918;1079993;17;*;gta
;;tRNA;1080011;1080087;13;*;atgf
;;tRNA;1080101;1080177;49;*;gac
;;tRNA;1080227;1080302;4;*;ttc
;;tRNA;1080307;1080382;13;*;aca
;;tRNA;1080396;1080481;8;*;tac
;;tRNA;1080490;1080560;13;*;tgg
;;tRNA;1080574;1080649;26;*;cac
;;tRNA;1080676;1080747;9;*;caa
;;tRNA;1080757;1080831;12;*;ggc
;;tRNA;1080844;1080917;10;*;tgc
;;tRNA;1080928;1081016;20;*;tta
;;tRNA;1081037;1081113;3;*;cgt
;;tRNA;1081117;1081196;150;*;ttg
fin;;CDS;1081347;1081973;;0;
deb;;CDS;1210625;1213519;354;*;
;;tRNA;1213874;1213949;16;*;gca
;;tRNA;1213966;1214037;12;*;gaa
;;tRNA;1214050;1214125;16;*;gta
;;tRNA;1214142;1214218;17;*;gac
;;tRNA;1214236;1214311;9;*;cac
;;tRNA;1214321;1214395;9;*;caa
;;tRNA;1214405;1214477;8;*;aaa
;;tRNA;1214486;1214572;3;*;ctg
;;tRNA;1214576;1214647;169;*;ggc
fin;comp;CDS;1214817;1215602;;;
deb;;CDS;1594387;1594665;533;*;
;;rRNA;1595199;1596735;263;*;16s
;;rRNA;1596999;1599928;96;*;23s
;;rRNA;1600025;1600141;43;*;5s
;;tRNA;1600185;1600261;19;*;atc
;;tRNA;1600281;1600356;17;*;gca
;;tRNA;1600374;1600445;8;*;gaa
;;tRNA;1600454;1600529;5;*;gta
;;tRNA;1600535;1600610;10;*;aca
;;tRNA;1600621;1600705;18;*;tac
;;tRNA;1600724;1600799;4;*;aac
;;tRNA;1600804;1600879;21;*;gta
;;tRNA;1600901;1600977;12;*;atgf
;;tRNA;1600990;1601066;34;*;gac
;;tRNA;1601101;1601176;13;*;cac
;;tRNA;1601190;1601264;8;*;caa
;;tRNA;1601273;1601345;17;*;aaa
;;tRNA;1601363;1601448;13;*;ctc
;;tRNA;1601462;1601548;5;*;ctg
;;tRNA;1601554;1601628;14;*;ggc
;;tRNA;1601643;1601713;10;*;tgc
;;tRNA;1601724;1601797;5;*;cgt
;;tRNA;1601803;1601876;105;*;cca
fin;;CDS;1601982;1602245;;;
deb;;CDS;1834781;1835260;106;*;
;;tRNA;1835367;1835439;137;*;gcc
fin;comp;CDS;1835577;1835978;;;
deb;;CDS;2147627;2148466;89;*;
;;ncRNA;2148556;2148735;114;*;
fin;;CDS;2148850;2149506;;0;
deb;comp;CDS;2207093;2208091;192;*;
;;tRNA;2208284;2208367;49;*;ctg
;;tRNA;2208417;2208500;315;*;ctg
fin;;CDS;2208816;2209952;;;
deb;;CDS;3456514;3456786;256;*;
;;tRNA;3457043;3457119;142;*;ccc
fin;;CDS;3457262;3457483;;;
deb;comp;CDS;5004536;5005159;394;*;
;comp;tRNA;5005554;5005636;40;*;ctc
;comp;tRNA;5005677;5005765;13;*;tcc
;comp;tRNA;5005779;5005852;19;*;atgj
;comp;tRNA;5005872;5005958;167;*;tcg
;;ncRNA;5006126;5006220;132;*;
fin;comp;CDS;5006353;5007825;;;
deb;comp;CDS;6383256;6384173;228;*;
;;tRNA;6384402;6384474;72;*;gtc
fin;comp;CDS;6384547;6385458;;;
deb;comp;CDS;6390912;6391130;142;*;
;comp;tRNA;6391273;6391358;7;*;tta
;comp;tRNA;6391366;6391442;19;*;atgi
;comp;tRNA;6391462;6391538;75;*;atgf
fin;comp;CDS;6391614;6391778;;;
deb;;CDS;6561157;6563109;118;*;
;comp;ncRNA;6563228;6563648;95;*;
fin;comp;CDS;6563744;6564859;;;
deb;;CDS;7354507;7354737;342;*;
;comp;tRNA;7355080;7355162;28;*;ctc
;comp;tRNA;7355191;7355279;12;*;tcc
;comp;tRNA;7355292;7355368;14;*;atgf
;comp;tRNA;7355383;7355459;14;*;atgj
;comp;tRNA;7355474;7355561;8;*;agc
;comp;tRNA;7355570;7355659;4;*;tcg
;comp;tRNA;7355664;7355736;4;*;acc
;comp;tRNA;7355741;7355816;119;*;gca
;;ncRNA;7355936;7356030;36;*;
;comp;tRNA;7356067;7356140;6;*;cca
;comp;tRNA;7356147;7356220;104;*;cgt
;comp;tRNA;7356325;7356396;7;*;ggc
;comp;tRNA;7356404;7356490;9;*;ctg
;comp;tRNA;7356500;7356572;9;*;aaa
;comp;tRNA;7356582;7356656;9;*;caa
;comp;tRNA;7356666;7356741;17;*;cac
;comp;tRNA;7356759;7356835;12;*;gac
;comp;tRNA;7356848;7356923;4;*;gta
;comp;tRNA;7356928;7357003;15;*;aac
;comp;tRNA;7357019;7357103;8;*;tac
;comp;tRNA;7357112;7357187;5;*;aca
;comp;tRNA;7357193;7357264;15;*;gaa
;comp;tRNA;7357280;7357355;9;*;gcc
;comp;tRNA;7357365;7357438;54;*;atc
;comp;rRNA;7357493;7357609;113;*;5s
;comp;rRNA;7357723;7360652;269;*;23s
;comp;rRNA;7360922;7362458;399;*;16s
fin;;CDS;7362858;7363397;;0;
deb;;CDS;7618150;7618842;280;*;
;comp;tRNA;7619123;7619193;335;*;ggg
fin;;CDS;7619529;7620461;;0;
deb;comp;CDS;7666633;7668069;104;*;
;comp;tRNA;7668174;7668244;5;*;ggg
;comp;tRNA;7668250;7668326;106;*;cca
;comp;tRNA;7668433;7668506;11;*;cgt
;comp;tRNA;7668518;7668592;5;*;ggc
;comp;tRNA;7668598;7668684;13;*;ctg
;comp;tRNA;7668698;7668783;16;*;ctc
;comp;tRNA;7668800;7668872;10;*;aaa
;comp;tRNA;7668883;7668967;28;*;tac
;comp;tRNA;7668996;7669071;12;*;ttc
;comp;rRNA;7669084;7669200;161;*;5s
;comp;rRNA;7669362;7672294;268;*;23s
;comp;rRNA;7672563;7674099;533;*;16s
fin;;CDS;7674633;7675382;;;
deb;comp;CDS;7853177;7853734;84;*;
;comp;tRNA;7853819;7853892;230;*;cac
;comp;tRNA;7854123;7854196;404;*;cac
fin;comp;CDS;7854601;7854801;;;
deb;comp;CDS;8100441;8100854;123;*;
;comp;rRNA;8100978;8101094;169;*;5s
;comp;rRNA;8101264;8104177;259;*;23s
;comp;rRNA;8104437;8105973;321;*;16s
fin;comp;CDS;8106295;8106636;;;
deb;comp;CDS;8151918;8152448;460;*;
;comp;rRNA;8152909;8153031;96;*;5s
;comp;rRNA;8153128;8156057;269;*;23s
;comp;rRNA;8156327;8157863;272;*;16s
fin;comp;CDS;8158136;8158708;;;
deb;;CDS;8256928;8257746;86;*;
;comp;tRNA;8257833;8257903;5;*;gga
;comp;tRNA;8257909;8257985;16;*;cca
;comp;tRNA;8258002;8258078;4;*;cgt
;comp;tRNA;8258083;8258157;8;*;ggc
;comp;tRNA;8258166;8258248;42;*;cta
;comp;tRNA;8258291;8258366;8;*;aaa
;comp;tRNA;8258375;8258449;9;*;caa
;comp;tRNA;8258459;8258532;4;*;tgg
;comp;tRNA;8258537;8258613;5;*;atgf
;comp;tRNA;8258619;8258694;5;*;gtc
;comp;tRNA;8258700;8258774;11;*;gaa
;comp;tRNA;8258786;8258859;43;*;atc
;comp;rRNA;8258903;8259019;96;*;5s
;comp;rRNA;8259116;8262045;267;*;23s
;comp;rRNA;8262313;8263849;302;*;16s
fin;comp;CDS;8264152;8264370;;;
deb;comp;CDS;8322744;8323205;393;*;
;comp;rRNA;8323599;8323715;96;*;5s
;comp;rRNA;8323812;8326745;269;*;23s
;comp;rRNA;8327015;8328551;365;*;16s
fin;comp;CDS;8328917;8330413;;;
deb;comp;CDS;8351919;8354414;396;*;
;comp;tRNA;8354811;8354884;149;*;atgj
fin;comp;CDS;8355034;8355537;;;
deb;;CDS;8389988;8390512;296;*;
;comp;rRNA;8390809;8390925;96;*;5s
;comp;rRNA;8391022;8393951;270;*;23s
;comp;rRNA;8394222;8395758;230;*;16s
fin;comp;CDS;8395989;8396255;;;
deb;comp;CDS;8399622;8400683;208;*;
;comp;ncRNA;8400892;8401155;47;*;
fin;comp;CDS;8401203;8401592;;;
deb;comp;CDS;8616478;8616924;417;*;
;;tRNA;8617342;8617418;157;*;gac
fin;;CDS;8617576;8618541;;0;
deb;;CDS;8724363;8724614;455;*;
;comp;tRNA;8725070;8725160;165;*;tcg
fin;comp;CDS;8725326;8725559;;;

pmq intercalaires entre cds[modifier | modifier le wikicode]

pmq intercalaires positifs S+[modifier | modifier le wikicode]

Maj 25.1.22;;;;;;;;;;;;;;
pmq Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
mba;min10;705;1651;2356;154;-330;-221;109;-512;-477;-223;;;
cbei;min10;950;3395;4345;402;-509;-375;134;-649;-648;-290;;;
pmq;min10;1614;4164;5778;458;-832;-651;181;-866;-825;-61;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
45;214;0.21;1255;2688;1;8;18;114;51;428;-74;;;
26;244;0.11;1212;4400;0;4;8;89;35;954;272;;;
32;218;0.15;1927;5296;3;5;22;140;68;1156;-207;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
pmq;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;&-7;-5;-3;1;R2;flex c+;comment.
1 à 400;31;-283;664;-7.0;878;304;max190;&-29;229;-645;79;946;263;min70
31 à 400;;;;;;;2 parties;&-13;112;-388;63;937;287;2 parties
droite;-a;cste;-;R2;note;R2’;;&-a;cste;-;R2;note;R2’;
1 à 400;28;31;-;65;poly;813;tF;&143;54;;806;poly;140;SF
31 à 400;;;;;;;;&113;46;-;886;dte;51;Sf
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30, t30.
  • Corrélations et fréquences faibles
;400;200;250;;;;;corrélation;;;;;;
;coefficient de corrélation fx fc;;;;;;;-0.207;;24.1.22 Paris;;;;
41-n;0.458;-0.832;-0.651;;;;;;;;;;;
1-n;-0.061;-0.866;-0.825;;;;;;;;;14.8.21 Paris;;
pmq;fx;fc;;pmq;fx%;fc%;;fx40;fc40;;x;pmq;Sx-;Sc-
0;5;26;;0;3;6;0;5;26;>0;1880;-1;0;80
10;15;298;;10;9;72;1;1;52;<0;42;-2;3;0
20;15;336;;20;9;81;2;1;46;zéro;5;-3;0;1
30;22;273;;30;14;66;3;1;35;total;1927;-4;11;384
40;16;249;;40;10;60;4;1;34;;c;-5;0;1
50;22;194;;50;14;47;5;1;28;>0;4517;-6;3;1
60;24;156;;60;15;37;6;1;32;<0;753;-7;0;5
70;32;142;;70;20;34;7;2;28;zéro;26;-8;0;76
80;47;168;;80;29;40;8;2;12;total;5296;-9;1;0
90;44;163;;90;27;39;9;4;10;;;-10;1;8
100;53;148;;100;33;36;10;1;21;total;7223;-11;2;32
110;53;123;;110;33;30;11;1;23;;;-12;0;0
120;61;117;;120;38;28;12;0;38;;;-13;0;7
130;77;120;;130;48;29;13;1;43;;;-14;2;27
140;60;95;;140;37;23;14;1;45;;;-15;0;0
150;64;119;;150;40;29;15;3;39;;;-16;0;5
160;67;87;;160;42;21;16;2;34;;;-17;2;17
170;75;94;;170;46;23;17;1;25;;;-18;0;0
180;66;111;;180;41;27;18;3;36;;;-19;0;1
190;81;93;;190;50;22;19;3;29;;;-20;1;14
200;65;94;;200;40;23;20;0;24;;;-21;0;0
210;65;86;;210;40;21;21;6;37;;;-22;1;5
220;58;86;;220;36;21;22;1;32;;;-23;0;13
230;52;79;;230;32;19;23;3;23;;;-24;0;0
240;54;87;;240;33;21;24;2;45;;;-25;1;3
250;47;74;;250;29;18;25;0;28;;;-26;3;13
260;41;66;;260;25;16;26;5;15;;;-27;0;0
270;43;60;;270;27;14;27;2;24;;;-28;0;0
280;35;59;;280;22;14;28;2;14;;;-29;0;8
290;30;44;;290;19;11;29;0;25;;;-30;0;0
300;23;35;;300;14;8;30;1;30;;;-31;0;2
310;35;45;;310;22;11;31;0;26;;;-32;1;8
320;28;32;;320;17;8;32;2;20;;;-33;0;0
330;28;41;;330;17;10;33;1;26;;;-34;1;2
340;21;27;;340;13;6;34;3;20;;;-35;1;6
350;25;33;;350;15;8;35;1;31;;;-36;2;0
360;19;22;;360;12;5;36;1;23;;;-37;0;2
370;14;26;;370;9;6;37;3;24;;;-38;0;2
380;12;32;;380;7;8;38;1;24;;;-39;0;0
390;15;24;;390;9;6;39;2;27;;;-40;0;1
400;10;26;;400;6;6;40;2;28;;;-41;0;5
reste;266;353;;;;;reste;1812;3361;;;-42;0;0
total;1885;4543;;t30;32;218;total;1885;4543;;;-43;0;0
diagr;1614;4164;;;;;diagr;68;1156;;;-44;1;3
 - t30;1562;3257;;;;;;;;;;-45;0;0
;;;;;;;;;;;;-46;0;1
;;;;;;;;;;;;-47;0;1
;;;;;;;;;;;;-48;0;0
;;;;;;;;;;;;-49;0;2
;;;;;;;;;;;;-50;0;1
;;;;;;;;;;;;reste;5;16
;;;;;;;;;;;;total;42;753

pmq intercalaires négatifs S-[modifier | modifier le wikicode]

pmq;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;-51;-52;-53;-54;-55;-56;-57;-58;-59;-60;-61;-62;-63;-64;-65;-66;-67;-68;-69;-70;-71;-72;-73;-74;-75;-76;-77;-78;-79;-80;-81;-82;-83;-84;-85;-86;-87;-88;-89;-90;-91;-92;-93;-94;-95;-96;-97;-98;-99;-100;;;à partir de 51
comp’;0;3;0;8;0;3;0;0;1;0;2;0;0;2;0;0;1;0;0;1;0;1;0;0;1;3;0;0;0;0;0;1;0;0;0;2;0;0;0;0;0;0;0;1;;;;;;;1;;;;;;;;;;;;;;1;;;;;;;;1;0;1;;;;;;;;;;;;;;;;;;;;;;;;;;;34;4
continu;80;0;1;387;1;1;5;76;0;9;32;0;7;27;0;5;18;0;1;14;0;5;13;0;3;13;0;0;8;0;2;8;0;3;7;0;2;2;0;1;5;0;0;3;0;1;1;0;2;1;0;0;1;0;1;2;0;0;0;0;0;0;0;0;2;0;0;0;0;0;0;0;0;1;0;0;0;0;0;0;0;0;0;0;0;0;0;0;1;0;0;0;0;0;2;0;0;0;0;0;7;761;17
  • 14.8.21
14.8.21 Paris;pmq;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;3;0;11;0;3;0;0;1;1;2;0;0;2;0;0;2;0;0;1;0;1;0;0;1;3;0;0;0;0;0;1;0;1;1;2;0;0;0;0;0;0;0;1;0;0;0;0;0;0;5;42
;Sc-;80;0;1;384;1;1;5;76;0;8;32;0;7;27;0;5;17;0;1;14;0;5;13;0;3;13;0;0;8;0;2;8;0;2;6;0;2;2;0;1;5;0;0;3;0;1;1;0;2;1;16;753

pmq autres intercalaires[modifier | modifier le wikicode]

pmq;autres intercalaires;;adresses1;;;pmq;autres intercalaires;;adresses2;;;pmq;autres intercalaires;;adresses3;;;pmq;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;9206;318;;;deb;°CDS;672473;18;;;deb;°CDS;1834781;106;;;deb;°CDS;7666633;104;comp
;$rRNA;10595;280;;;;&tRNA;672968;7;;;;&tRNA;1835367;137;;;;&tRNA;7668174;5;comp
;$rRNA;12412;97;;;;&tRNA;673051;297;;;fin;°CDS;1835577;;comp;;;&tRNA;7668250;106;comp
;$rRNA;15439;178;;;;&tRNA;673436;9;;;deb;°CDS;2147627;89;;;;&tRNA;7668433;11;comp
fin;°CDS;15734;;;;;&tRNA;673517;180;;;;ncRNA;2148556;114;;;;&tRNA;7668518;5;comp
deb;°CDS;20252;47;;;fin;°CDS;673780;;;;fin;°CDS;2148850;;;;;&tRNA;7668598;13;comp
;&tRNA;21580;137;;;deb;°CDS;674382;159;;;deb;°CDS;2207093;192;comp;;;&tRNA;7668698;16;comp
fin;°CDS;21807;;;;;&tRNA;675438;64;;;;&tRNA;2208284;49;;;;&tRNA;7668800;10;comp
deb;°CDS;25422;222;;;fin;°CDS;675585;;;;;&tRNA;2208417;315;;;;&tRNA;7668883;28;comp
;&tRNA;26388;183;comp;;deb;°CDS;694284;793;;;fin;°CDS;2208816;;;;;&tRNA;7668996;12;comp
fin;°CDS;26644;;;;;$rRNA;696430;272;;;deb;°CDS;3456514;256;;;;$rRNA;7669084;161;comp
deb;°CDS;178456;299;;;;$rRNA;698239;96;;;;&tRNA;3457043;142;;;;$rRNA;7669362;268;comp
;$rRNA;179754;266;;;;$rRNA;701265;43;;;fin;°CDS;3457262;;;;;$rRNA;7672563;533;comp
;$rRNA;181557;170;;;;&tRNA;701425;11;;;deb;°CDS;5004536;394;comp;;fin;°CDS;7674633;;
;$rRNA;184657;15;;;;&tRNA;701510;5;;;;&tRNA;5005554;40;comp;;deb;°CDS;7853177;84;comp
;&tRNA;184789;29;;;;&tRNA;701590;5;;;;&tRNA;5005677;13;comp;;;&tRNA;7853819;230;comp
;&tRNA;184906;39;;;;&tRNA;701671;4;;;;&tRNA;5005779;19;comp;;;&tRNA;7854123;404;comp
;&tRNA;185022;15;;;;&tRNA;701752;9;;;;&tRNA;5005872;167;comp;;fin;°CDS;7854601;;comp
;&tRNA;185113;14;;;;&tRNA;701835;8;;;;ncRNA;5006126;132;;;deb;°CDS;8100441;123;comp
;&tRNA;185204;48;;;;&tRNA;701918;18;;;fin;°CDS;5006353;;;;;$rRNA;8100978;169;comp
;&tRNA;185329;5;;;;&tRNA;702009;7;;;deb;°CDS;6383256;228;comp;;;$rRNA;8101264;259;comp
;&tRNA;185410;9;;;;&tRNA;702100;11;;;;&tRNA;6384402;72;;;;$rRNA;8104437;321;comp
;&tRNA;185495;15;;;;&tRNA;702186;12;;;fin;°CDS;6384547;;comp;;fin;°CDS;8106295;;comp
;&tRNA;185595;183;;;;&tRNA;702272;577;;;deb;°CDS;6390912;142;comp;;deb;°CDS;8151918;460;comp
fin;°CDS;185854;;comp;;fin;°CDS;702926;;;;;&tRNA;6391273;7;comp;;;$rRNA;8152909;96;comp
deb;°CDS;217565;129;comp;;deb;°CDS;1073441;377;;;;&tRNA;6391366;19;comp;;;$rRNA;8153128;269;comp
;&tRNA;218276;261;comp;;;$rRNA;1074592;271;;;;&tRNA;6391462;75;comp;;;$rRNA;8156327;272;comp
fin;°CDS;218612;;;;;$rRNA;1076400;170;;;fin;°CDS;6391614;;comp;;fin;°CDS;8158136;;comp
deb;°CDS;230970;186;;;;$rRNA;1079500;9;;;deb;°CDS;6561157;118;;;deb;°CDS;8256928;86;
;tmRNA;231642;140;;;;&tRNA;1079626;6;;;;ncRNA;6563228;95;comp;;;&tRNA;8257833;5;comp
fin;°CDS;232145;;;;;&tRNA;1079708;38;;;fin;°CDS;6563744;;comp;;;&tRNA;8257909;16;comp
deb;°CDS;253921;673;;;;&tRNA;1079835;11;;;deb;°CDS;7354507;342;;;;&tRNA;8258002;4;comp
;$rRNA;255200;280;;;;&tRNA;1079918;17;;;;&tRNA;7355080;28;comp;;;&tRNA;8258083;8;comp
;$rRNA;257017;97;;;;&tRNA;1080011;13;;;;&tRNA;7355191;12;comp;;;&tRNA;8258166;42;comp
;$rRNA;260044;55;;;;&tRNA;1080101;49;;;;&tRNA;7355292;14;comp;;;&tRNA;8258291;8;comp
;&tRNA;260216;19;;;;&tRNA;1080227;4;;;;&tRNA;7355383;14;comp;;;&tRNA;8258375;9;comp
;&tRNA;260312;16;;;;&tRNA;1080307;13;;;;&tRNA;7355474;8;comp;;;&tRNA;8258459;4;comp
;&tRNA;260404;9;;;;&tRNA;1080396;8;;;;&tRNA;7355570;4;comp;;;&tRNA;8258537;5;comp
;&tRNA;260485;20;;;;&tRNA;1080490;13;;;;&tRNA;7355664;4;comp;;;&tRNA;8258619;5;comp
;&tRNA;260590;3;;;;&tRNA;1080574;26;;;;&tRNA;7355741;119;comp;;;&tRNA;8258700;11;comp
;&tRNA;260669;19;;;;&tRNA;1080676;9;;;;ncRNA;7355936;36;;;;&tRNA;8258786;43;comp
;&tRNA;260764;20;;;;&tRNA;1080757;12;;;;&tRNA;7356067;6;comp;;;$rRNA;8258903;96;comp
;&tRNA;260861;15;;;;&tRNA;1080844;10;;;;&tRNA;7356147;104;comp;;;$rRNA;8259116;267;comp
;&tRNA;260949;10;;;;&tRNA;1080928;20;;;;&tRNA;7356325;7;comp;;;$rRNA;8262313;302;comp
;&tRNA;261032;3;;;;&tRNA;1081037;3;;;;&tRNA;7356404;9;comp;;fin;°CDS;8264152;;comp
;&tRNA;261122;12;;;;&tRNA;1081117;150;;;;&tRNA;7356500;9;comp;;deb;°CDS;8322744;393;comp
;&tRNA;261209;15;;;fin;°CDS;1081347;;;;;&tRNA;7356582;9;comp;;;$rRNA;8323599;96;comp
;&tRNA;261296;5;;;deb;°CDS;1210625;354;;;;&tRNA;7356666;17;comp;;;$rRNA;8323812;269;comp
;&tRNA;261375;158;;;;&tRNA;1213874;16;;;;&tRNA;7356759;12;comp;;;$rRNA;8327015;365;comp
;&tRNA;261607;4;;;;&tRNA;1213966;12;;;;&tRNA;7356848;4;comp;;fin;°CDS;8328917;;comp
;&tRNA;261687;5;;;;&tRNA;1214050;16;;;;&tRNA;7356928;15;comp;;deb;°CDS;8351919;396;comp
;&tRNA;261765;19;;;;&tRNA;1214142;17;;;;&tRNA;7357019;8;comp;;;&tRNA;8354811;149;comp
;&tRNA;261874;17;;;;&tRNA;1214236;9;;;;&tRNA;7357112;5;comp;;fin;°CDS;8355034;;comp
;&tRNA;261979;5;;;;&tRNA;1214321;9;;;;&tRNA;7357193;15;comp;;deb;°CDS;8389988;296;
;&tRNA;262060;39;;;;&tRNA;1214405;8;;;;&tRNA;7357280;9;comp;;;$rRNA;8390809;96;comp
;&tRNA;262174;41;;;;&tRNA;1214486;3;;;;&tRNA;7357365;54;comp;;;$rRNA;8391022;270;comp
;&tRNA;262304;283;;;;&tRNA;1214576;169;;;;$rRNA;7357493;113;comp;;;$rRNA;8394222;230;comp
fin;°CDS;262670;;;;fin;°CDS;1214817;;comp;;;$rRNA;7357723;269;comp;;fin;°CDS;8395989;;comp
deb;°CDS;578195;320;;;deb;°CDS;1594387;533;;;;$rRNA;7360922;399;comp;;deb;°CDS;8399622;208;comp
;$rRNA;579376;269;;;;$rRNA;1595199;263;;;fin;°CDS;7362858;;;;;ncRNA;8400892;47;comp
;$rRNA;581183;168;;;;$rRNA;1596999;96;;;deb;°CDS;7618150;280;;;fin;°CDS;8401203;;comp
;$rRNA;584281;31;;;;$rRNA;1600025;43;;;;&tRNA;7619123;335;comp;;deb;°CDS;8616478;417;comp
;&tRNA;584429;10;;;;&tRNA;1600185;19;;;fin;°CDS;7619529;;;;;&tRNA;8617342;157;
;&tRNA;584512;38;;;;&tRNA;1600281;17;;;;;;;;;fin;°CDS;8617576;;
;&tRNA;584639;11;;;;&tRNA;1600374;8;;;;;;;;;deb;°CDS;8724363;455;
;&tRNA;584722;17;;;;&tRNA;1600454;5;;;;;;;;;;&tRNA;8725070;165;comp
;&tRNA;584815;15;;;;&tRNA;1600535;10;;;;;;;;;fin;°CDS;8725326;;comp
;&tRNA;584907;67;;;;&tRNA;1600621;18;;;;;;;;;;;;;
;&tRNA;585051;11;;;;&tRNA;1600724;4;;;;;;;;;;;;;
;&tRNA;585137;10;;;;&tRNA;1600804;21;;;;;;;;;;;;;
;&tRNA;585223;5;;;;&tRNA;1600901;12;;;;;;;;;;;;;
;&tRNA;585303;17;;;;&tRNA;1600990;34;;;;;;;;;;;;;
;&tRNA;585396;40;;;;&tRNA;1601101;13;;;;;;;;;;;;;
;&tRNA;585511;24;;;;&tRNA;1601190;8;;;;;;;;;;;;;
;&tRNA;585610;8;;;;&tRNA;1601273;17;;;;;;;;;;;;;
;&tRNA;585698;19;;;;&tRNA;1601363;13;;;;;;;;;;;;;
;&tRNA;585794;1;;;;&tRNA;1601462;5;;;;;;;;;;;;;
;&tRNA;585869;187;;;;&tRNA;1601554;14;;;;;;;;;;;;;
fin;°CDS;586130;;;;;&tRNA;1601643;10;;;;;;;;;;;;;
;;;;;;;&tRNA;1601724;5;;;;;;;;;;;;;
;;;;;;;&tRNA;1601803;105;;;;;;;;;;;;;
;;;;;;fin;°CDS;1601982;;;;;;;;;;;;;;

pmq intercalaires tRNA-cds[modifier | modifier le wikicode]

pmq;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;47;;137;;18;64;'''deb;
comp’;222;comp’;183;;47;75;<201;8
;;comp’;183;;84;105;total;12
;129;comp’;261;;104;137;taux;67%
;;;283;;106;142;'''fin;
;;;187;;129;149;<201;11
;18;;180;;142;150;total;15
;159;;64;;159;157;taux;73%
;;;577;;256;165;;
;;;150;;354;180;'''total;
;354;comp’;169;;394;187;<201;19
;;;105;;396;283;total;27
;106;comp’;137;;'''-;315;taux;70%
comp’;192;;315;;'''-;404;;
;256;;142;;'''-;577;'''comp’;'''cumuls
;394;;;;86;72;;
comp’;228;comp’;72;;192;137;'''deb;2
;142;;75;;222;169;;8
comp’;342;;;;228;183;;
comp’;280;comp’;335;;280;183;'''fin;5
;104;;;;342;261;;7
;84;;404;;417;335;'''total;
comp’;86;;;;455;'''-;<201;7
;396;;149;;;;total;15
comp’;417;;157;;;;taux;47%
comp’;455;;165;;;;;
;;;;;;;;
;;;;;;;;
;deb;fin;total;;;;;
<201;10;16;26;;;;;
total;20;22;42;;;;;
taux;50%;73%;62%;;;;;

lbu[modifier | modifier le wikicode]

lbu opérons[modifier | modifier le wikicode]

49.8%GC;29.7.19 Paris;16s 8;;;;;;;;
Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
comp;18533..19237;CDS;;128;128;;;235;128
;19366..19438;act;@1;195;195;;;;
;19634..20371;CDS;;6912;;;;246;
;;;;;;;;;
;27284..29785;CDS;;276;276;;;*834;
;30062..30134;act;;134;134;;;;134
;30269..30907;CDS;;11768;;;;213;
;;;;;;;;;
;42676..43248;cds hp;;451;*451;;;*191;
;43700..45271;16s;;209;;;;;
;45481..48391;23s;;69;;;;;
;48461..48577;5s;;275;275;;;;275
;48853..49091;cds hp;;56679;;;;80;
;;;;;;;;;
comp;105771..106547;CDS;;56;56;;;259;56
comp;106604..106679;aag;;125;125;;;;
;106805..107533;CDS;;103754;;;;243;
;;;;;;;;;
;211288..212553;CDS;;94;94;;;422;
;212648..212720;acc;;23;23;;;;23
comp<;212744..213262;CDS;;64997;;;;173;
;;;;;;;;;
;278260..278928;CDS;;69;69;;;223;69
comp;278998..279068;ggg;;181;181;;;;
;279250..280275;CDS;;44047;;;;342;
;;;;;;;;;
comp;324323..324949;CDS;;117;117;;;209;117
;325067..325138;ggc;+;4;;4;;;
;325143..325216;ccg;2 ggc;108;;;;;
;325325..325399;ggc;;155;155;;;;
;325555..326016;CDS;;37886;;;;154;
;;;;;;;;;
;363903..364394;CDS;;98;98;;;164;98
;364493..364564;caa;;614;*614;;;;
;365179..366360;CDS;;-14;;;;*394;
;;;;;;;;;
;366347..367402;CDS;;75;75;;;352;
;367478..367559;tac;;5;;5;;;
;367565..367636;caa;;62;62;;;;62
<;367699..368318;CDS;;14127;;;;207;
;;;;;;;;;
;382446..382907;CDS;;30;30;;;154;30
;382938..383026;ctt;;118;118;;;;
;383145..383768;CDS;;70441;;;;208;
;;;;;;;;;
;454210..455529;CDS;;61;61;;;440;61
;455591..455665;agg;;341;341;;;;
;456007..457035;CDS;;75557;;;;343;
;;;;;;;;;
;532593..533285;CDS;;82;82;;;231;82
comp;533368..533442;cgg;;296;296;;;;
;533739..534782;CDS;;48963;;;;348;
;;;;;;;;;
;583746..584728;CDS;;57;57;;;328;57
comp;584786..584858;cag;;5;;5;;;
comp;584864..584935;gag;;170;170;;;;
;585106..586110;CDS;;94988;;;;335;
;;;;;;;;;
;681099..682741;CDS;;518;*518;;;*548;
;683260..684831;16s;;106;;;;;
;684938..685011;atc;;69;;;69;;
;685081..685153;gca;;127;;;;;
;685281..688191;23s;;68;;;;;
;688260..688376;5s;;208;208;;;;208
comp;688585..689801;CDS;;55794;;;;406;
;;;;;;;;;
comp;745596..745821;CDS;;134;134;;;75;134
comp;745956..746044;tcg;;787;*787;;;;
;746832..749597;CDS;;36741;;;;*922;
;;;;;;;;;
;786339..787004;CDS;;54;54;;;222;54
;787059..787142;ctg;;109;109;;;;
comp;787252..787872;CDS;;2072;;;;207;
;;;;;;;;;
comp;789945..791867;CDS;;613;*613;;;*641;
;792481..794052;16s;;105;;;;;
;794158..794231;atc;;69;;;69;;
;794301..794373;gca;;126;;;;;
;794500..797410;23s;;69;;;;;
;797480..797596;5s;;87;87;;;;87
;797684..798559;CDS;;36;;;;292;
;;;;;;;;;
comp;798596..800178;CDS;;530;*530;;;*528;
;800709..800781;aac;@2;3;;3;;;
;800785..800858;cca;;24;;24;;;
;800883..800954;ggc;;30;;30;;;
;800985..801058;cgt;;2;;2;;;
;801061..801133;gta;;3;;3;;;
;801137..801208;gaa;;42;;42;;;
;801251..801338;tca;;9;;9;;;
;801348..801421;atgf;;3;;3;;;
;801425..801498;gac;;6;;6;;;
;801505..801577;ttc;;8;;8;;;
;801586..801667;tac;;4;;4;;;
;801672..801742;tgg;;13;;13;;;
;801756..801831;cac;;26;;26;;;
;801858..801928;tgc;;28;;28;;;
;801957..802041;ttg;;356;356;;;;356
;802398..802961;CDS;;284259;;;;188;
;;;;;;;;;
comp;1087221..1088531;CDS;;157;157;;;437;157
comp;1088689..1088760;caa;;656;*656;;;;
comp;1089417..1090313;CDS;;173317;;;;*299;
;;;;;;;;;
comp;1263631..1265769;CDS;;188;188;;;*713;188
comp;1265958..1266031;aga;;222;222;;;;
;1266254..1268632;CDS;;84103;;;;*793;
;;;;;;;;;
comp;1352736..1354022;CDS;;98;98;;;429;98
;1354121..1354204;ctg;;204;204;;;;
comp;1354409..1354928;CDS;;13182;;;;173;
;;;;;;;;;
comp;1368111..1369307;CDS;;161;161;;;399;161
comp;1369469..1369541;gta;;3;;;3;;
comp;1369545..1369616;gaa;;138;;;*138;;
comp;1369755..1369828;atgj;;6;;;6;;
comp;1369835..1369925;tcc;;8;;;8;;
comp;1369934..1370006;aac;;7;;;;;
comp;1370014..1370130;5s;;69;;;;;
comp;1370200..1373111;23s;;126;;;;;
comp;1373238..1373310;gca;;69;;;69;;
comp;1373380..1373453;atc;;105;;;;;
comp;1373559..1375130;16s;;547;*547;;;;
;1375678..1376604;CDS;;102845;;;;*309;
;;;;;;;;;
comp;1479450..1479824;CDS;;200;200;;;125;
comp;1480025..1480101;gac;;26;;;26;;
comp;1480128..1480199;gaa;;3;;;3;;
comp;1480203..1480275;gta;;2;;;2;;
comp;1480278..1480351;cgt;;35;;;35;;
comp;1480387..1480458;ggc;;36;;;;;
comp;1480495..1480611;5s;;68;;;;;
comp;1480680..1483590;23s;;208;;;;;
comp;1483799..1485370;16s;;153;153;;;;153
comp;1485524..1485716;CDS;;20944;;;;64;
;;;;;;;;;
comp;1506661..1507464;CDS;;270;270;;;268;
comp;1507735..1507807;aag;+;34;;34;;;
comp;1507842..1507914;aag;5 aag;33;;33;;;
comp;1507948..1508020;aag;;33;;33;;;
comp;1508054..1508126;aag;@3;33;;33;;;
comp;1508160..1508232;aag;;130;130;;;;130
comp;1508363..1509226;CDS;;167;;;;288;
;;;;;;;;;
;1509394..1510872;CDS;;106;106;;;493;106
comp;1510979..1511051;gta;;3;;3;;;
comp;1511055..1511126;gaa;;151;;*151;;;
;1511278..1511366;ctt;;113;113;;;;
;1511480..1512010;CDS;;21195;;;;177;
;;;;;;;;;
comp;1533206..1534129;CDS;;355;355;;;308;
comp;1534485..1534557;acg;;154;154;;;;154
comp;1534712..1535950;CDS;;18502;;;;413;
;;;;;;;;;
;1554453..1554638;CDS;;303;303;;;62;303
comp;1554942..1555029;agc;;673;*673;;;;
comp;1555703..1556203;CDS;;595;;;;*167;
;;;;;;;;;
;1556799..1558178;CDS;;277;277;;;460;
comp;1558456..1558572;5s;;68;;;;;
comp;1558641..1561551;23s;;126;;;;;
comp;1561678..1561750;gca;;69;;;69;;
comp;1561820..1561893;atc;;105;;;;;
comp;1561999..1563570;16s;;189;189;;;;189
;1563760..1563948;CDS;;19274;;;;63;
;;;;;;;;;
comp;1583223..1584392;CDS;;151;151;;;390;151
comp;1584544..1584628;ttg;+;17;;17;;;
comp;1584646..1584730;ttg;2 ttg;28;;28;;;
comp;1584759..1584829;tgc;2 ttc;26;;26;;;
comp;1584856..1584931;cac;2 atgf;13;;13;;;
comp;1584945..1585015;tgg;;4;;4;;;
comp;1585020..1585101;tac;;8;;8;;;
comp;1585110..1585182;ttc;;6;;6;;;
comp;1585189..1585262;gac;;3;;3;;;
comp;1585266..1585339;atgf;;9;;9;;;
comp;1585349..1585436;tca;;42;;42;;;
comp;1585479..1585550;gaa;;258;;*258;;;
comp;1585809..1585899;agc;;2;;2;;;
comp;1585902..1585975;atc;;3;;3;;;
comp;1585979..1586049;gga;;14;;14;;;
comp;1586064..1586136;ttc;;17;;17;;;
comp;1586154..1586227;atgf;;11;;11;;;
comp;1586239..1586312;atgi;;12;;12;;;
comp;1586325..1586398;atg;;36;;36;;;
comp;1586435..1586508;cca;;6;;6;;;
comp;1586515..1586588;cgt;;5;;5;;;
comp;1586594..1586679;tta;;15;;15;;;
comp;1586695..1586766;ggc;;4;;4;;;
comp;1586771..1586843;aca;;11;;11;;;
comp;1586855..1586936;cta;;12;;12;;;
comp;1586949..1587021;aaa;;2;;2;;;
comp;1587024..1587096;gta;;157;157;;;;
comp;1587254..1588681;CDS;;539;;;;476;
;;;;;;;;;
comp;1589221..1590557;CDS;;156;156;;;446;156
comp;1590714..1590830;5s;;68;;;;;
comp;1590899..1593809;23s;;126;;;;;
comp;1593936..1594008;gca;;69;;;69;;
comp;1594078..1594151;atc;;105;;;;;
comp;1594257..1595828;16s;;581;*581;;;;
comp;1596410..1597276;CDS;;189853;;;;*289;
;;;;;;;;;
comp;1787130..1788440;CDS;;298;298;;;437;298
comp;1788739..1788855;5s;;68;;;;;
comp;1788924..1791834;23s;@4;208;;;;;
comp;1792043..1793614;16s;;436;*436;;;;
comp;1794051..1794596;CDS;;-8;;;;*182;
comp;1794589..1795436;CDS;;138;138;;;283;138
comp;1795575..1795648;gac;;3;;;3;;
comp;1795652..1795724;gta;;2;;;2;;
comp;1795727..1795800;cgt;;35;;;35;;
comp;1795836..1795907;ggc;;19;;;19;;
comp;1795927..1796000;cca;;3;;;3;;
comp;1796004..1796076;aac;;7;;;;;
comp;1796084..1796200;5s;;68;;;;;
comp;1796269..1799179;23s;;208;;;;;
comp;1799388..1800959;16s;;501;*501;;;;
comp;1801461..1802087;CDS;;;;;;*209;

lbu cumuls[modifier | modifier le wikicode]

lbu cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;0;1;0;100;5
;16 23 5s 0;2;20;33;9;50;2;20;0;200;11
;16 atc gca;5;40;11;3;100;12;40;2;300;19
;16 23 5s a;2;60;2;0;150;11;60;3;400;11
;max a;7;80;0;5;200;14;80;3;500;11
;a doubles;0;100;0;0;250;3;100;4;600;2
;autres;0;120;0;0;300;6;120;2;700;1
;total aas;26;140;0;1;350;2;140;5;800;2
sans ;opérons;23;160;1;0;400;2;160;5;900;1
;1 aa;16;180;0;0;450;1;180;1;1000;1
;max a;26;200;0;0;500;1;200;2;1100;0
;a doubles;3;;1;0;;10;;5;;0
;total aas;72;;48;18;;64;;32;;64
total aas;;98;;;;;;;;;
remarques;;;;;;;;;;;
avec jaune;;;moyenne;;;;;;138;;320
;;;variance;;;;;;81;;182
sans jaune;;;moyenne;14;29;;159;;114;;275
;;;variance;12;29;;85;;50;;122

lbu blocs[modifier | modifier le wikicode]

lbu blocs;;;;;;;
cds;'''277’;;cds;156;;cds;298
$5s;68;;$5s;68;;$5s;68
$23s;126;;$23s;126;;$23s;208
gca;69;;gca;69;;$16s;436
atc;105;;atc;105;;cds;-8
$16s;'''189’;;$16s;581;;cds;138
cds;;;cds;;;gac;3
;;;;;;4aas;*
cds;518;;cds;'''613’;;aac;7
$16s;106;;$16s;105;;$5s;68
atc;69;;atc;69;;$23s;208
gca;127;;gca;126;;$16s;501
$23s;68;;$23s;69;;cds;
$5s;'''208’;;$5s;87;;;
cds;;;cds;;;;
;;;;;;;
cds;161;;cds hp;451;;cds;200
gta;3;;$16s;209;;gac;26
3aas;*;;$23s;69;;3aas;*
aac;7;;$5s;275;;ggc;36
$5s;69;;cds hp;;;$5s;68
$23s;126;;;;;$23s;208
gca;69;;;;;$16s;153
atc;105;;;;;cds;
$16s;'''547’;;;;;;
cds;;;;;;;

lbu distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;
att;;act;2;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;1;cct;;cat;;cgc;;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;ttg2;ttc;3;tcc;;tac;3;tgc;2;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;1;tac;;tgc;
atc;;acc;1;aac;;agc;1;aag5;atc;1;acc;;aac;1;agc;1;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;2;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;2;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;2
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;4;;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;2
tta;;tca;;taa;;tga;;;tta;1;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;;ata;;aca;1;aaa;1;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;;cca;;caa;2;cga;;;cta;1;cca;2;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;1;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;3;gca;;gaa;3;gga;1;;gta;;gca;;gaa;;gga;;;gta;3;gca;;gaa;2;gga;
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;2;;ttg;2;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;1;agg;1;;atgj;1;acg;;aag;;agg;;;atgj;;acg;;aag;5;agg;;;atgj;1;acg;;aag;;agg;
ctg;2;ccg;;cag;;cgg;1;;ctg;;ccg;1;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
lbu;;16;;;;;16;;lbu;49;;;;;;49;;lbu;7;;;;;;7;;lbu;;;;16;;;16

lbu données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: lbu données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA contig;;tRNA tRNA;;;reste;Sup 400
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;lam;long;long
fxt;fct;lbu;fx;fc;lbu;fx40;fc40;lbu;x-;c-;c;x;c;x;c;aa;c;aa;c;x;aa;fx;fc
;0;0;2;10;0;2;10;-1;1;80;cont;x;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;;hors bloc;408;403
;0;10;1;142;1;0;24;-2;1;0;195;128;451;613;218;;3;gta;4;;ggc;420;406
1;0;20;2;128;2;0;36;-3;;1;95;125;518;547;3* 217;;138;gaa;108;;ccg;430;409
;1;30;9;78;3;0;15;-4;4;55;134;11;510;295;23s 5s;;6;atgj;**;;ggc;437;409
;0;40;17;35;4;0;10;-5;;0;59;69;258;;3* 71;;8;tcc;5;;tac;439;416
;0;50;22;43;5;0;11;-6;;0;94;181;298;;6* 70;;**;aac;**;;caa;439;419
1;2;60;27;43;6;0;5;-7;;3;158;117;501;;16s tRNA;;26;gac;5;;cag;445;420
1;1;70;31;40;7;0;3;-8;1;38;98;85;5s CDS;;114;atc;3;gaa;**;;gag;447;424
;1;80;26;34;8;0;4;-9;;0;119;296;308;208;4* 113;atc;2;gta;3;;aac;460;427
1;0;90;19;33;9;1;17;-10;;1;75;57;87;277;tRNA 23s;;35;cgt;24;;cca;461;429
1;3;100;21;39;10;0;17;-11;;24;137;170;156;;128;gca;**;ggc;30;;ggc;481;429
2;1;110;15;43;11;0;15;-12;;0;30;787;298;;4* 127;gca;3;gac;2;;cgt;481;430
1;2;120;8;37;12;1;16;-13;;1;121;109;;;5s tRNA;;2;gta;3;;gta;481;446
2;3;130;14;25;13;0;12;-14;1;17;61;530;;;2* 7;aac;35;cgt;42;;gaa;485;449
;2;140;20;32;14;0;15;-15;2;0;341;222;;;36;ggc;19;ggc;9;;tca;487;449
;0;150;10;25;15;0;16;-16;;0;204;98;;;tRNA tRNA;intra;3;cca;3;;atgf;493;451
;5;160;6;34;16;0;12;-17;;7;54;204;;;5* 69;atc gca;**;aac;6;;gac;506;452
1;0;170;8;29;17;0;10;-18;;1;356;106;;;;;;;8;;ttc;517;455
;0;180;15;21;18;1;11;-19;;1;157;303;;;;;;;4;;tac;517;461
1;1;190;8;16;19;0;12;-20;;5;126;;;;;;;;13;;tgg;522;465
;1;200;11;14;20;0;9;-21;;0;188;;;;;;;;29;;cac;540;473
1;2;210;7;16;21;0;11;-22;;3;203;;;;;;;;28;;tgc;547;479
;0;220;8;14;22;1;17;-23;;3;270;;;CDS-CDS;inf 50;;;;**;;ttg;550;484
1;0;230;7;11;23;1;7;-24;;0;130;;;intercalaire;;;;;34;;aag;601;490
;0;240;5;13;24;1;5;-25;;2;113;;;c-;x-;;;;33;;aag;634;494
;0;250;10;9;25;1;7;-26;;4;355;;;-119;-99;;;;33;;aag;647;506
;0;260;7;7;26;1;8;-27;;0;154;;;-97;-99;;;;33;;aag;668;511
;1;270;5;8;27;1;6;-28;;2;673;;;-89;-98;;;;**;;aag;674;511
;0;280;7;7;28;1;5;-29;2;3;151;;;-85;-76;;;;3;;gta;800;515
;0;290;2;12;29;2;5;-30;;0;157;;;-77;-54;;;;-;151;gaa;845;515
1;0;300;1;5;30;0;7;-31;;2;102;;;-67;-51;;;;**;;ctt;876;516
1;0;310;4;8;31;1;4;-32;;4;;;;-67;;;;;17;;ttg;917;523
;0;320;7;2;32;0;4;-33;;0;;;;-65;;;;;28;;ttg;;533
;0;330;6;8;33;1;6;-34;;0;;;;-62;;;;;29;;tgc;;558
;0;340;5;2;34;1;2;-35;;3;;;;-61;;;;;13;;cac;;559
;1;350;0;4;35;0;3;-36;;0;;;;-59;;;;;4;;tgg;;560
;2;360;1;2;36;1;4;-37;;0;;;;-56;;;;;8;;tac;;586
;0;370;1;5;37;1;2;-38;;0;;;;-56;;;;;6;;ttc;;598
;0;380;0;3;38;1;2;-39;1;0;;;;-52;;;;;3;;gac;;642
;0;390;1;7;39;5;6;-40;;1;;;;-52;;;;;9;;atgf;;669
;0;400;3;3;40;6;2;-41;;0;;;;total;intercalaires;;;;42;;tca;;671
2;1;reste;32;51;reste;380;705;-42;;0;;;;;222,489;;;;261;;gaa;;693
18;30;total;411;1098;total;411;1098;-43;;0;;;;ADN long;1,856,951;;;;2;;agc;;718
16;29;diagr;377;1037;diagr;29;383;-44;1;0;;;;%;12.0;;;;3;;atc;;721
1;1; t30;12;348;;;;-45;;0;;;;;;;;;14;;gga;;755
;;;;;;;;-46;;2;;;;non RNA;42;;;;17;;ttc;;755
;;Récapitulatif des effectifs;;;;;;-47;;1;;;;;;;;;11;;atgf;;841
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;12;;atgi;;844
;x;409;20;2;431;;;-49;;1;;;;;;;;;36;;atgj;;1005
;c;1088;280;10;1378;;;-50;;15;;;;;;;;;6;;cca;;1005
;;;;;1809;198;;reste;6;0;;;;;;;;;5;;cgt;;1054
;;;;;;2007;;total;20;280;;;;;;;;;15;;tta;;
;;;;;;;;;;;;;;;;;;;4;;ggc;;
;;;;;;;;;;;;;;;;;;;11;;aca;;
;;;;;;;;;;;;;;;;;;;12;;cta;;
;;;;;;;;;;;;;;;;;;;2;;aaa;;
;;;;;;;;;;;;;;;;;;;**;;gta;;

lbu autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: lbu autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires ;;lbu;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;comp;CDS;18533;19237;128;*;
;;tRNA;19366;19438;195;*;act
fin;;CDS;19634;20371;;;
deb;;CDS;29805;29966;95;*;
;;tRNA;30062;30134;134;*;act
fin;;CDS;30269;30907;;;
deb;;CDS;42676;43248;451;*;
;;rRNA;43700;45263;218;*;1564
;;rRNA;45482;48389;71;*;2908
;;rRNA;48461;48577;308;*;117
fin;;CDS;48886;49215;;;
deb;;CDS;64875;65066;71;*;
;;misc_b;65138;65377;147;*;
fin;;CDS;65525;65743;;;
deb;comp;CDS;105771;106547;59;*;
;comp;tRNA;106607;106679;125;*;aag
fin;;CDS;106805;107533;;;
deb;comp;CDS;118390;119745;29;*;
;comp;regulatory;119775;119862;185;*;
fin;;CDS;120048;121523;;;
deb;comp;CDS;134737;136320;120;*;
;comp;regulatory;136441;136616;92;*;
fin;comp;CDS;136709;137335;;0;
deb;;CDS;211288;212553;94;*;
;;tRNA;212648;212720;11;*;acc
fin;comp;CDS;212732;213079;;;
deb;;CDS;215354;216541;50;*;
;;misc_b;216592;216828;95;*;
fin;;CDS;216924;217778;;;
deb;comp;CDS;242936;243505;67;*;
;comp;regulatory;243573;243670;189;*;
fin;;CDS;243860;245017;;;
deb;;CDS;278260;278928;69;*;
;comp;tRNA;278998;279068;181;*;ggg
fin;;CDS;279250;280275;;;
deb;;CDS;280740;281354;106;*;
;;regulatory;281461;281624;89;*;
fin;;CDS;281714;284404;;;
deb;comp;CDS;324323;324949;117;*;
;;tRNA;325067;325138;4;*;ggc
;;tRNA;325143;325216;108;*;ccg
;;tRNA;325325;325396;158;*;ggc
fin;;CDS;325555;326016;;;
deb;;CDS;363903;364394;98;*;
;;tRNA;364493;364564;119;*;caa
fin;;CDS;364684;364854;;;
deb;;CDS;366347;367402;75;*;
;;tRNA;367478;367559;5;*;tac
;;tRNA;367565;367636;137;*;caa
fin;;CDS;367774;368166;;;
deb;;CDS;382446;382907;30;*;
;;tRNA;382938;383023;121;*;ctt
fin;;CDS;383145;383768;;;
deb;;CDS;425577;426662;66;*;
;;regulatory;426729;426825;44;*;
fin;;CDS;426870;427439;;0;
deb;;CDS;454210;455529;61;*;
;;tRNA;455591;455665;341;*;agg
fin;;CDS;456007;457035;;;
deb;;CDS;532593;533285;85;*;
;comp;tRNA;533371;533442;296;*;cgg
fin;;CDS;533739;534782;;;
deb;;CDS;574078;575265;66;*;
;;tmRNA;575332;575693;294;*;
fin;;CDS;575988;576143;;;
deb;;CDS;583246;584728;57;*;
;comp;tRNA;584786;584858;5;*;cag
;comp;tRNA;584864;584935;170;*;gag
fin;;CDS;585106;586110;;;
deb;;CDS;673933;676341;66;*;
;;misc_b;676408;676655;83;*;
fin;;CDS;676739;677599;;;
deb;;CDS;681099;682741;518;*;
;;rRNA;683260;684823;114;*;1564
;;tRNA;684938;685011;69;*;atc
;;tRNA;685081;685153;128;*;gca
;;rRNA;685282;688189;70;*;2908
;;rRNA;688260;688376;208;*;117
fin;comp;CDS;688585;689738;;;
deb;;CDS;727702;728421;27;*;
;;regulatory;728449;728564;80;*;
fin;;CDS;728645;729349;;;
deb;comp;CDS;745596;745751;204;*;
;comp;tRNA;745956;746044;787;*;tcg
fin;;CDS;746832;749597;;;
deb;;CDS;755313;756185;29;*;
;;repeat_region;756215;757463;258;*;
fin;;CDS;757722;758336;;;
deb;;CDS;786339;787004;54;*;
;;tRNA;787059;787142;109;*;ctg
fin;comp;CDS;787252;787872;;0;
deb;comp;CDS;789978;791867;613;*;
;;rRNA;792481;794044;113;*;1564
;;tRNA;794158;794231;69;*;atc
;;tRNA;794301;794373;127;*;gca
;;rRNA;794501;797408;71;*;2908
;;rRNA;797480;797596;87;*;117
fin;;CDS;797684;798559;;0;
deb;comp;CDS;798596;800178;530;*;
;;tRNA;800709;800781;3;*;aac
;;tRNA;800785;800858;24;*;cca
;;tRNA;800883;800954;30;*;ggc
;;tRNA;800985;801058;2;*;cgt
;;tRNA;801061;801133;3;*;gta
;;tRNA;801137;801208;42;*;gaa
;;tRNA;801251;801338;9;*;tca
;;tRNA;801348;801421;3;*;atgf
;;tRNA;801425;801498;6;*;gac
;;tRNA;801505;801577;8;*;ttc
;;tRNA;801586;801667;4;*;tac
;;tRNA;801672;801742;13;*;tgg
;;tRNA;801756;801828;29;*;cac
;;tRNA;801858;801928;28;*;tgc
;;tRNA;801957;802041;356;*;ttg
fin;;CDS;802398;804017;;;
deb;;CDS;862229;862693;29;*;
;;ncRNA;862723;863083;125;*;
fin;;CDS;863209;864333;;;
deb;comp;CDS;905582;905794;173;*;
;comp;misc_b;905968;906185;390;*;
fin;;CDS;906576;907085;;0;
deb;comp;CDS;952333;952842;390;*;
;;misc_b;953233;953450;173;*;
fin;;CDS;953624;953836;;;
deb;comp;CDS;1087221;1088531;157;*;
;comp;tRNA;1088689;1088760;126;*;caa
fin;comp;CDS;1088887;1089033;;;
deb;comp;CDS;1242851;1243162;16;*;
;comp;misc_f;1243179;1243255;147;*;
fin;;CDS;1243403;1243759;;0;
deb;comp;CDS;1263631;1265769;188;*;
;comp;tRNA;1265958;1266031;222;*;aga
fin;;CDS;1266254;1268632;;;
deb;comp;CDS;1297694;1298743;37;*;
;comp;misc_b;1298781;1298982;42;*;
fin;comp;CDS;1299025;1299375;;;
deb;comp;CDS;1309324;1309845;47;*;
;comp;misc_f;1309893;1310004;394;*;
fin;;CDS;1310399;1311799;;0;
deb;comp;CDS;1352736;1354022;98;*;
;;tRNA;1354121;1354204;204;*;ctg
fin;comp;CDS;1354409;1355976;;;
deb;comp;CDS;1368111;1369307;-3;*;
;comp;regulatory;1369305;1369392;76;*;
;comp;tRNA;1369469;1369541;3;*;gta
;comp;tRNA;1369545;1369616;138;*;gaa
;comp;tRNA;1369755;1369828;6;*;atgj
;comp;tRNA;1369835;1369925;8;*;tcc
;comp;tRNA;1369934;1370006;7;*;aac
;comp;rRNA;1370014;1370130;71;*;117
;comp;rRNA;1370202;1373110;127;*;2909
;comp;tRNA;1373238;1373310;69;*;gca
;comp;tRNA;1373380;1373453;113;*;atc
;comp;rRNA;1373567;1375130;547;*;1564
fin;;CDS;1375678;1376604;;;
deb;comp;CDS;1418883;1420661;53;*;
;comp;ncRNA;1420715;1420811;9;*;
fin;comp;CDS;1420821;1421330;;;
deb;comp;CDS;1434541;1435050;33;*;
;comp;misc_f;1435084;1435213;440;*;
fin;;CDS;1435654;1436972;;;
deb;comp;CDS;1479450;1479824;203;*;
;comp;tRNA;1480028;1480101;26;*;gac
;comp;tRNA;1480128;1480199;3;*;gaa
;comp;tRNA;1480203;1480275;2;*;gta
;comp;tRNA;1480278;1480351;35;*;cgt
;comp;tRNA;1480387;1480458;36;*;ggc
;comp;rRNA;1480495;1480611;70;*;117
;comp;rRNA;1480682;1483589;217;*;2908
;comp;rRNA;1483807;1485370;510;*;1564
fin;comp;CDS;1485881;1487044;;;
deb;comp;CDS;1506661;1507464;270;*;
;comp;tRNA;1507735;1507807;34;*;aag
;comp;tRNA;1507842;1507914;33;*;aag
;comp;tRNA;1507948;1508020;33;*;aag
;comp;tRNA;1508054;1508126;33;*;aag
;comp;tRNA;1508160;1508232;130;*;aag
fin;comp;CDS;1508363;1509226;;0;
deb;;CDS;1509394;1510872;106;*;
;comp;tRNA;1510979;1511051;3;*;gta
;comp;tRNA;1511055;1511126;151;*;gaa
;;tRNA;1511278;1511366;113;*;ctt
fin;;CDS;1511480;1512010;;0;
deb;comp;CDS;1533206;1534129;355;*;
;comp;tRNA;1534485;1534557;154;*;acg
fin;comp;CDS;1534712;1535950;;0;
deb;;CDS;1554441;1554638;303;*;
;comp;tRNA;1554942;1555029;673;*;agc
fin;comp;CDS;1555703;1556164;;0;
deb;;CDS;1556799;1558178;277;*;
;comp;rRNA;1558456;1558572;70;*;117
;comp;rRNA;1558643;1561550;127;*;2908
;comp;tRNA;1561678;1561750;69;*;gca
;comp;tRNA;1561820;1561893;113;*;act
;comp;rRNA;1562007;1563570;258;*;1564
fin;comp;CDS;1563829;1564131;;0;
deb;comp;CDS;1583223;1584392;151;*;
;comp;tRNA;1584544;1584628;17;*;ttg
;comp;tRNA;1584646;1584730;28;*;ttg
;comp;tRNA;1584759;1584829;29;*;tgc
;comp;tRNA;1584859;1584931;13;*;cac
;comp;tRNA;1584945;1585015;4;*;tgg
;comp;tRNA;1585020;1585101;8;*;tac
;comp;tRNA;1585110;1585182;6;*;ttc
;comp;tRNA;1585189;1585262;3;*;gac
;comp;tRNA;1585266;1585339;9;*;atgf
;comp;tRNA;1585349;1585436;42;*;tca
;comp;tRNA;1585479;1585550;261;*;gaa
;comp;tRNA;1585812;1585899;2;*;agc
;comp;tRNA;1585902;1585975;3;*;atc
;comp;tRNA;1585979;1586049;14;*;gga
;comp;tRNA;1586064;1586136;17;*;ttc
;comp;tRNA;1586154;1586227;11;*;atgf
;comp;tRNA;1586239;1586312;12;*;atgi
;comp;tRNA;1586325;1586398;36;*;atgj
;comp;tRNA;1586435;1586508;6;*;cca
;comp;tRNA;1586515;1586588;5;*;cgt
;comp;tRNA;1586594;1586679;15;*;tta
;comp;tRNA;1586695;1586766;4;*;ggc
;comp;tRNA;1586771;1586843;11;*;aca
;comp;tRNA;1586855;1586936;12;*;cta
;comp;tRNA;1586949;1587021;2;*;aaa
;comp;tRNA;1587024;1587096;157;*;gta
fin;comp;CDS;1587254;1588681;;;
deb;comp;CDS;1589221;1590557;156;*;
;comp;rRNA;1590714;1590830;70;*;117
;comp;rRNA;1590901;1593808;127;*;2908
;comp;tRNA;1593936;1594008;69;*;gca
;comp;tRNA;1594078;1594151;113;*;act
;comp;rRNA;1594265;1595828;295;*;1564
fin;;CDS;1596124;1596324;;0;
deb;comp;CDS;1787130;1788440;298;*;
;comp;rRNA;1788739;1788855;70;*;117
;comp;rRNA;1788926;1791833;217;*;2908
;comp;rRNA;1792051;1793614;507;*;1564
fin;comp;CDS;1794122;1794325;;;
deb;comp;CDS;1795068;1795472;102;*;
;comp;tRNA;1795575;1795648;3;*;gac
;comp;tRNA;1795652;1795724;2;*;gta
;comp;tRNA;1795727;1795800;35;*;cgt
;comp;tRNA;1795836;1795907;19;*;ggc
;comp;tRNA;1795927;1796000;3;*;cca
;comp;tRNA;1796004;1796076;7;*;aac
;comp;rRNA;1796084;1796200;70;*;117
;comp;rRNA;1796271;1799178;217;*;2908
;comp;rRNA;1799396;1800959;501;*;1564
fin;comp;CDS;1801461;1802087;;;
deb;;CDS;1813522;1815336;60;*;
;;misc_f;1815397;1815445;52;*;
fin;;CDS;1815498;1816658;;0;

ban*[modifier | modifier le wikicode]

ban opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Baci_anth_2002013094/baciAnth_2002013094-tRNAs.fa;gtRNAdb;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009902;ban*;;genome;;;;;;aas;cds dirigé
35.1%GC;15.8.19 Paris;16s 11;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Bacillus anthracis strain 2002013094;;;;;;;;;;
;618142..618366;;CDS;;188;188;;;75;188
;618555..618627;;gtc;;419;*419;;;;
comp;619047..619235;;CDS;;;;;;63;
;;;;;;;;;;
comp;1102183..1102602;;CDS;;130;130;;;140;130
comp;1102733..1102804;;gaa;+;1;;;1;;
comp;1102806..1102880;;aac;2 aca;8;;;8;;
comp;1102889..1102965;;atc;2 tca;11;;;11;;
comp;1102977..1103047;;tgg;;6;;;6;;
comp;1103054..1103126;;aca;;9;;;9;;
comp;1103136..1103211;;ttc;;9;;;9;;
comp;1103221..1103296;;gac;;4;;;4;;
comp;1103301..1103377;;atgf;;20;;;20;;
comp;1103398..1103490;;tca;;54;;;54;;
comp;1103545..1103637;;tca;;20;;;20;;
comp;1103658..1103730;;gca;;16;;;16;;
comp;1103747..1103820;;cca;;10;;;10;;
comp;1103831..1103904;;cgt;;3;;;3;;
comp;1103908..1103996;;tta;;16;;;16;;
comp;1104013..1104087;;ggc;;29;;;29;;
comp;1104117..1104197;;cta;;22;;;22;;
comp;1104220..1104295;;cac;;9;;;9;;
comp;1104305..1104380;;aca;;4;;;4;;
comp;1104385..1104460;;gta;;4;;;;;
comp;1104465..1104580;;5s;;97;;;;;
comp;1104678..1107604;;23s;;141;;;;;
comp;1107746..1109299;;16s;;694;*694;;;;
;1109994..1113038;;CDS;;;;;;*1015;
;;;;;;;;;;
comp;1306706..1307848;;CDS;;198;198;;;381;
comp;1308047..1308120;;gga;;115;115;;;;115
comp;1308236..1308889;;CDS;;;;;;218;
;;;;;;;;;;
;1312025..1312345;;CDS;;207;207;;;107;207
comp;1312553..1312637;;ttg;;10;;;10;;
comp;1312648..1312718;;tgc;;14;;;14;;
comp;1312733..1312807;;ggc;;5;;;5;;
comp;1312813..1312887;;caa;;63;;;63;;
comp;1312951..1313026;;cac;;19;;;19;;
comp;1313046..1313119;;tgg;;7;;;7;;
comp;1313127..1313210;;tac;;17;;;17;;
comp;1313228..1313303;;gta;;5;;;5;;
comp;1313309..1313383;;gaa;;24;;;24;;
comp;1313408..1313480;;acc;;4;;;4;;
comp;1313485..1313559;;aac;;9;;;;;
comp;1313569..1313684;;5s;;96;;;;;
comp;1313781..1316709;;23s;;141;;;;;
comp;1316851..1318405;;16s;;386;*386;;;;
;1318792..1319148;;CDS;;;;;;119;
;;;;;;;;;;
;1556278..1556507;;CDS;;57;57;;;77;57
comp;1556565..1556680;;5s;;49;;;;;
comp;1556730..1560126;;23s;;173;;;;;
comp;1560300..1562132;;16s;;476;*476;;;;
;1562609..1563322;;CDS;;;;;;238;
;;;;;;;;;;
>;1566949..1567219;;CDS;;99;99;;;90;99
comp;1567319..1567434;;5s;;46;;;;;
comp;1567481..1570409;;23s;;142;;;;;
comp;1570552..1572115;;16s;;451;*451;;;;
;1572567..1574498;;CDS;;;;;;*644;
;;;;;;;;;;
;1579539..1580615;;CDS;;14;14;;;359;14
comp;1580630..1580745;;5s;;45;;;;;
comp;1580791..1583912;;23s;;153;;;;;
comp;1584066..1585720;;16s;;294;294;;;;
comp;1586015..1587520;;CDS;;;;;;*502;
;;;;;;;;;;
comp;1600693..1601166;;CDS;;174;174;;;158;
comp;1601341..1601416;;gac;;3;;;3;;
comp;1601420..1601496;;atgf;;12;;;;;
comp;1601509..1601624;;5s;@1;46;;;;;
comp;1601671..1604598;;23s;;141;;;;;
comp;1604740..1606294;;16s;;75;;;;;
comp;1606370..1606440;;gga;;1;;1;;;
comp;1606442..1606518;;cca;+;4;;4;;;
comp;1606523..1606599;;cgt;Séquence 10;3;;3;;;
comp;1606603..1606691;;tta;;16;;16;;;
comp;1606708..1606782;;ggc;;29;;29;;;
comp;1606812..1606892;;cta;;14;;14;;;
comp;1606907..1606982;;aaa;;5;;5;;;
comp;1606988..1607062;;caa;;87;;*87;;;
comp;1607150..1607225;;gac;;46;;46;;;
comp;1607272..1607347;;gta;;4;;4;;;
comp;1607352..1607426;;gaa;;1;;1;;;
comp;1607428..1607502;;aac;2 aac;8;;8;;;
comp;1607511..1607587;;atc;;11;;11;;;
comp;1607599..1607669;;tgg;;6;;6;;;
comp;1607676..1607748;;aca;;9;;9;;;
comp;1607758..1607833;;ttc;;8;;8;;;
comp;1607842..1607917;;gac;;4;;4;;;
comp;1607922..1607998;;atgf;;20;;20;;;
comp;1608019..1608111;;tca;2 tca;54;;54;;;
comp;1608166..1608258;;tca;;20;;20;;;
comp;1608279..1608351;;gca;;16;;16;;;
comp;1608368..1608441;;cca;;10;;10;;;
comp;1608452..1608525;;cgt;;3;;3;;;
comp;1608529..1608617;;tta;;16;;16;;;
comp;1608634..1608708;;ggc;;29;;29;;;
comp;1608738..1608818;;cta;;13;;13;;;
comp;1608832..1608907;;aaa;;5;;5;;;
comp;1608913..1608987;;caa;;87;;*87;;;
comp;1609075..1609150;;gac;;46;;46;;;
comp;1609197..1609272;;gta;;4;;4;;;
comp;1609277..1609351;;gaa;;8;;8;;;
comp;1609360..1609450;;agc;;3;;3;;;
comp;1609454..1609528;;aac;;114;114;;;;114
comp;1609643..1610101;;CDS;;;;;;153;
;;;;;;;;;;
comp;1702642..1703788;;CDS;;114;114;;;382;114
comp;1703903..1703975;;gca;;10;;;10;;
comp;1703986..1704057;;ggc;;5;;;5;;
comp;1704063..1704138;;aaa;;5;;;5;;
comp;1704144..1704218;;caa;;65;;;65;;
comp;1704284..1704366;;tac;;17;;;17;;
comp;1704384..1704459;;gta;;5;;;5;;
comp;1704465..1704539;;gaa;;24;;;24;;
comp;1704564..1704636;;acc;;4;;;4;;
comp;1704641..1704715;;aac;;9;;;;;
comp;1704725..1704840;;5s;;82;;;;;
comp;1704923..1707851;;23s;;141;;;;;
comp;1707993..1709545;;16s;;223;223;;;;
comp;1709769..1709987;;CDS;;;;;;73;
;;;;;;;;;;
comp;1767157..1767618;;CDS;;206;206;;;154;206
comp;1767825..1767940;;5s;;45;;;;;
comp;1767986..1770913;;23s;;141;;;;;
comp;1771055..1772608;;16s;;372;*372;;;;
comp;1772981..1774480;;CDS;;;;;;*500;
;;;;;;;;;;
comp;1787717..1790188;;CDS;;259;259;;;*824;
comp;1790448..1790519;;gaa;;13;;13;;;
comp;1790533..1790606;;atgj;@2;160;160;;;;160
comp;1790767..1791249;;CDS;;;;;;161;
;;;;;;;;;;
comp;1820538..1820717;;CDS;;190;190;;;60;190
comp;1820908..1821023;;5s;;44;;;;;
comp;1821068..1823996;;23s;;77;;;;;
comp;1824074..1824149;;gca;;8;;;8;;
comp;1824158..1824234;;atc;;130;;;;;
comp;1824365..1825919;;16s;;217;217;;;;
comp;1826137..1826406;;CDS;;;;;;90;
;;;;;;;;;;
comp;1832600..1832992;;CDS;;166;166;;;131;
comp;1833159..1833251;;tca;;156;156;;;;156
comp;1833408..1834682;;CDS;;;;;;425;
;;;;;;;;;;
;1839668..1840669;;CDS;;34;34;;;334;34
comp;1840704..1840819;;5s;;44;;;;;
comp;1840864..1843791;;23s;;76;;;;;
comp;1843868..1843943;;gca;;8;;;8;;
comp;1843952..1844028;;atc;;130;;;;;
comp;1844159..1845713;;16s;;240;240;;;;
comp;1845954..1848425;;CDS;;;;;;*824;
;;;;;;;;;;
;1873838..1875127;;CDS;;139;139;;;430;139
;1875267..1875342;;aaa;;13;;13;;;
;1875356..1875427;;gaa;;21;;21;;;
;1875449..1875524;;gac;;41;;41;;;
;1875566..1875638;;ttc;;403;*403;;;;
;1876042..1876749;;CDS;;;;;;236;
;;;;;;;;;;
comp;2217640..2217846;;CDS;;205;205;;;69;205
;2218052..2218130;;cgg;;255;255;;;;
;2218386..2219693;;CDS;;;;;;436;
;;;;;;;;;;
comp;2428815..2429495;;CDS;;404;*404;;;227;
;2429900..2431456;;16s;;139;;;;;
;2431596..2434524;;23s;;97;;;;;
;2434622..2434737;;5s;;4;;;;;
;2434742..2434817;;gta;+;4;;;4;;
;2434822..2434897;;aca;2 cta;9;;;9;;
;2434907..2434982;;cac;2 aca;22;;;22;;
;2435005..2435085;;cta;;29;;;29;;
;2435115..2435189;;ggc;;16;;;16;;
;2435206..2435294;;tta;;3;;;3;;
;2435298..2435371;;cgt;;10;;;10;;
;2435382..2435455;;cca;;16;;;16;;
;2435472..2435544;;gca;;20;;;20;;
;2435565..2435657;;tca;;54;;;54;;
;2435712..2435805;;cta;;20;;;20;;
;2435826..2435902;;atgf;;1;;;1;;
;2435904..2435979;;gac;;12;;;12;;
;2435992..2436067;;ttc;;14;;;14;;
;2436082..2436157;;aca;;10;;;10;;
;2436168..2436243;;aaa;;13;;;13;;
;2436257..2436327;;gga;;10;;;10;;
;2436338..2436414;;atc;;7;;;7;;
;2436422..2436496;;aac;;7;;;7;;
;2436504..2436594;;agc;;6;;;6;;
;2436601..2436672;;gaa;;59;59;;;;59
;2436732..2436842;;CDS;;;;;;37;
;;;;;;;;;;
;2798971..2799474;;CDS;;109;109;;;168;109
;2799584..2799657;;gga;;1;;1;;;
;2799659..2799735;;aga;;407;*407;;;;
;2800143..2800343;;CDS;;;;;;67;
;;;;;;;;;;
comp;2991608..2992366;;CDS;;242;242;;;253;
;2992609..2992682;;atgi;;221;221;;;;221
;2992904..2993515;;CDS;;;;;;204;

ban cumuls[modifier | modifier le wikicode]

ban* cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;3;2;1;0;1;0;100;10
;16 23 5s 0;4;20;25;47;50;2;20;1;200;9
;16 atc gca;2;40;3;6;100;3;40;1;300;6
;16 23 5s a;5;60;4;2;150;6;60;2;400;4
;max a;21;80;0;2;200;7;80;0;500;4
;a doubles;2;100;2;0;250;8;100;1;600;1
;autres;0;120;0;0;300;3;120;4;700;1
;total aas;66;140;0;0;350;0;140;2;800;0
sans ;opérons;9;160;0;0;400;2;160;2;900;2
;1 aa;5;180;0;0;450;3;180;0;1000;0
;max a;33;200;0;0;500;0;200;2;1100;1
;a doubles;1;;0;0;;0;;4;;0
;total aas;46;;37;59;;34;;19;;38
total aas;;112;;;;;;;;;
remarques;;2;;;;;;;;;
avec jaune;;;moyenne;18;15;;232;;132;;274
;;;variance;21;14;;143;;62;;238
sans jaune;;;moyenne;14;;;165;;;;191
;;;variance;14;;;71;;;;124

ban blocs[modifier | modifier le wikicode]

ban intercalaires des 11 clusters à rrnas;;;;;;;;
cds;694’;;cds;386’;;cds;114;
16s;141;;16s;141;;aac;*;
23s;97;;23s;96;;31aas;1;
5s;4;;5s;9;;gga;75;
gta;*;;aac;*;;16s;141;
17aas;1;;9aas;10;;23s;46;
gaa;130;;ttg;207’;;5s;12;
cds;;;cds;;;atgf;3;
;;;;;;gac;174;
cds;223;;cds;404’;;cds;;
16s;141;;16s;139;;;;
23s;82;;23s;97;;cds;217;240
5s;9;;5s;4;;16s;130;130
aac;*;;gta;4;;atc;8;8
7aas;10;;19aas;*;;gca;77;76
gca;114;;gaa;59;;23s;44;44
cds;;;cds;;;5s;190;34’
;;;;;;cds;;
cds;476’;451’;294;372;;;;
16s;173;142;153;141;;;;
23s;49;46;45;45;;;;
5s;57’;99’;14’;206;;;;
cds;;;;;;;;

ban distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;tca2 5s;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;;tgc;;;;;;;;;;;;ttc;3;tcc;;tac;2;tgc;1
atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;;;;;;;;;;;;atc;3;acc;2;aac;6;agc;2
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;3;cgt;4
gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;5;ggc;6
tta;;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;4;tca;5;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;1;aga;1;;;;;;;;;;;ata;;aca;5;aaa;4;aga;
cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;5;cca;4;caa;4;cga;
gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;2;gga;1;;;;;;;;;;;gta;6;gca;4;gaa;6;gga;2
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;3
atgj;;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;;;;;;;;;;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ban;;5;;;;;5;;ban;8;;;;;;8;;;;;;;;;;;ban;;;;93;;;93
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2 1-3aas;33 -16s;;

ban données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: ban données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
  • Note du 2.12.22: correction des tRNA hors (-1, 139 tRNA-CDS) et tRNA cont (+1, 10 ttg)
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA contig;;tRNA tRNA;;CDS-CDS;400-600;;reste;Sup 600
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;effectif;;;long;long
fxt;fct;ban;fx;fc;ban;fx40;fc40;ban;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;c;aa;ban;fx;fc;fx;fc
;0;0;0;33;0;0;33;-1;;73;188;419;CDS 16s;;16s 23s;;tRNA contig;;tRNA contig;suite;tRNA tRNA;hors bloc;400;1416;3121;610;605
;0;10;16;234;1;1;38;-2;;1;130;210;295;695;5* 146;;1;gaa;20;atgf;13;gaa;410;13;11;612;605
;0;20;41;427;2;2;35;-3;;0;198;205;224;387;147;;8;aac;54;tca;**;atgj;420;10;16;616;612
;0;30;81;192;3;2;40;-4;3;241;115;242;373;477;177;;11;atc;20;tca;13;aaa;430;7;11;624;617
;0;40;134;137;4;3;33;-5;;0;174;;218;452;158;;6;tgg;16;gca;21;gaa;440;9;8;627;617
;0;50;84;97;5;1;20;-6;;0;114;;241;404;144;;9;aca;10;cca;41;gac;450;9;8;630;619
;0;60;75;97;6;0;22;-7;;3;114;;5s CDS;;23s 5s;;9;ttc;3;cgt;**;ttc;460;4;6;634;629
;0;70;35;120;7;3;10;-8;1;84;259;;190;57;2* 101;;4;gac;16;tta;1;gga;470;4;5;636;630
;0;80;36;127;8;1;7;-9;2;0;160;;206;99;100;;20;atgf;29;ggc;**;aga;480;6;6;637;634
;0;90;38;94;9;0;12;-10;;3;166;;;14;3* 50;;54;tca;13;cta;;;490;6;9;638;636
;0;100;57;108;10;3;17;-11;1;30;156;;;34;2* 49;;20;tca;5;aaa;;;500;6;7;648;641
;1;110;44;135;11;3;31;-12;1;0;139;;;;86;;16;gca;87;caa;;;510;2;5;660;642
;3;120;52;132;12;2;63;-13;;10;403;;;;2* 48;;10;cca;46;gac;;;520;8;2;665;645
;1;130;45;108;13;4;42;-14;1;19;258;;;;16s tRNA;;3;cgt;4;gta;;;530;1;4;697;646
;1;140;38;89;14;6;50;-15;;0;657;;;;2* 132;atc;16;tta;8;gaa;;;540;6;6;697;651
;0;150;55;94;15;2;62;-16;;5;109;;;;tRNA 23s;gca;29;ggc;3;agc;;;550;9;3;698;651
;2;160;37;82;16;4;37;-17;;15;410;;;;80;;22;cta;**;aac;;;560;3;6;709;654
;1;170;45;66;17;4;39;-18;;0;221;;;;79;;9;cac;10;gca;;;570;5;2;734;668
;1;180;39;55;18;5;40;-19;;3;;;;;5s tRNA;;4;aca;5;ggc;;;580;5;2;744;670
;1;190;42;62;19;3;31;-20;;15;;;;;2* 4;gta;**;gta;5;aaa;;;590;7;6;769;677
;1;200;42;51;20;8;32;-21;;0;;;;;2* 9;aac;10;ttg;65;caa;;;600;2;2;777;677
2;0;210;34;65;21;1;29;-22;;3;;;;;12;atgf;14;tgc;17;tac;;;;;;783;685
;0;220;25;48;22;6;21;-23;;10;;;;;tRNA tRNA;intra;5;ggc;5;gta;;;;;;814;691
;1;230;30;43;23;7;29;-24;;0;;;;;2* 8;atc gca;63;caa;24;gaa;;;;;;825;692
;0;240;28;35;24;10;21;-25;1;5;;;;;tRNA 16s;;19;cac;4;acc;;;;;;834;696
1;0;250;22;30;25;6;16;-26;;10;;;;;76;gaa;7;tgg;**;aac;;;;;;836;709
;2;260;25;25;26;6;18;-27;;0;;;;;;;17;tac;4;gta;;;;;;853;721
;0;270;22;36;27;9;20;-28;1;3;;;;;;;5;gta;9;aca;;;;;;856;734
;0;280;26;29;28;13;12;-29;;2;;;CDS-CDS;inf 50;;;24;gaa;22;cac;;;;;;870;737
;0;290;15;28;29;13;16;-30;;0;;;intercalaire;;;;4;acc;29;cta;;;;;;883;741
;0;300;20;28;30;10;10;-31;;1;;;c-;x-;;;**;aac;16;ggc;;;;;;897;744
;0;310;12;32;31;10;22;-32;;6;;;-95;-89;;;3;gac;3;tta;;;;;;902;770
;0;320;17;19;32;5;13;-33;;0;;;-65;;;;**;atgf;10;cgt;;;;;;956;827
;0;330;11;26;33;15;17;-34;;1;;;-59;;;;1;gga;16;cca;;;;;;963;831
;0;340;22;28;34;10;12;-35;;6;;;-59;;;;4;cca;20;gca;;;;;;1044;833
;0;350;8;27;35;18;12;-36;;0;;;-59;;;;3;cgt;54;tca;;;;;;1073;847
;0;360;19;17;36;12;16;-37;;2;;;-55;;;;16;tta;20;cta;;;;;;1140;871
;0;370;11;17;37;11;13;-38;;2;;;-53;;;;29;ggc;1;atgf;;;;;;1149;953
;0;380;13;13;38;12;13;-39;;0;;;total;intercalaires;;;14;cta;12;gac;;;;;;1159;963
;0;390;10;20;39;19;11;-40;;0;;;;749,857;;;5;aaa;14;ttc;;;;;;1195;967
;0;400;10;15;40;22;8;-41;;0;;;ADN long;5,321,900;;;87;caa;10;aca;;;;;;1641;1004
1;3;reste;163;168;reste;1307;2266;-42;1;0;;;%;14.1;;;46;gac;13;aaa;;;;;;;1078
4;18;total;1579;3289;total;1579;3289;-43;;0;;;;;;;4;gta;10;gga;;;;;;;1152
3;15;diagr;1416;3088;diagr;272;990;-44;;2;;;non RNA;9;;;1;gaa;7;atc;;;;;;;
0;0; t30;138;853;;;;-45;;0;;;;;;;8;aac;7;aac;;;;;;;
;;;;;;;;-46;;0;;;;;;;11;atc;6;agc;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;;0;;;;;;;6;tgg;**;gaa;;;;;;;
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;9;aca;;;;;;;;;
;x;1579;13;0;1592;;;-49;;1;;;;;;;8;ttc;;;;;;;;;
;c;3256;564;33;3853;;;-50;;8;;;;;;;4;gac;;;;;;;;;
;;;;;5445;173;;reste;1;0;;;;;;;suite;suite;;;;;;;;;
;;;;;;5618;;total;13;564;;;;;;;;;;;;;;;;;

ban autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: ban autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;ban;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;342504;342953;175;*;
;comp;ncRNA;343129;343312;21;*;
;comp;ncRNA;343334;343516;116;*;
fin;comp;CDS;343633;344466;;;
deb;comp;CDS;359943;361082;180;*;
;comp;ncRNA;361263;361653;87;*;
fin;comp;CDS;361741;362079;;;
deb;;CDS;618142;618366;188;*;
;;tRNA;618555;618627;419;*;gtc
fin;comp;CDS;619047;619235;;;
deb;comp;CDS;1102183;1102602;130;*;
;comp;tRNA;1102733;1102804;1;*;gaa
;comp;tRNA;1102806;1102880;8;*;aac
;comp;tRNA;1102889;1102965;11;*;atc
;comp;tRNA;1102977;1103047;6;*;tgg
;comp;tRNA;1103054;1103126;9;*;aca
;comp;tRNA;1103136;1103211;9;*;ttc
;comp;tRNA;1103221;1103296;4;*;gac
;comp;tRNA;1103301;1103377;20;*;atgf
;comp;tRNA;1103398;1103490;54;*;tca
;comp;tRNA;1103545;1103637;20;*;tca
;comp;tRNA;1103658;1103730;16;*;gca
;comp;tRNA;1103747;1103820;10;*;cca
;comp;tRNA;1103831;1103904;3;*;cgt
;comp;tRNA;1103908;1103996;16;*;tta
;comp;tRNA;1104013;1104087;29;*;ggc
;comp;tRNA;1104117;1104197;22;*;cta
;comp;tRNA;1104220;1104295;9;*;cac
;comp;tRNA;1104305;1104380;4;*;aca
;comp;tRNA;1104385;1104460;4;*;gta
;comp;rRNA;1104465;1104580;101;*;116
;comp;rRNA;1104682;1107601;146;*;2920
;comp;rRNA;1107748;1109298;695;*;1551
fin;;CDS;1109994;1113038;;0;
deb;comp;CDS;1306706;1307848;198;*;
;comp;tRNA;1308047;1308120;115;*;gga
fin;comp;CDS;1308236;1308889;;;
deb;;CDS;1312025;1312345;210;*;
;comp;tRNA;1312556;1312637;10;*;ttg
;comp;tRNA;1312648;1312718;14;*;tgc
;comp;tRNA;1312733;1312807;5;*;ggc
;comp;tRNA;1312813;1312887;63;*;caa
;comp;tRNA;1312951;1313026;19;*;cac
;comp;tRNA;1313046;1313119;7;*;tgg
;comp;tRNA;1313127;1313210;17;*;tac
;comp;tRNA;1313228;1313303;5;*;gta
;comp;tRNA;1313309;1313383;24;*;gaa
;comp;tRNA;1313408;1313480;4;*;acc
;comp;tRNA;1313485;1313559;9;*;aac
;comp;rRNA;1313569;1313684;100;*;116
;comp;rRNA;1313785;1316706;146;*;2922
;comp;rRNA;1316853;1318404;387;*;1552
fin;;CDS;1318792;1319148;;0;
deb;;CDS;1556278;1556507;57;*;
;comp;rRNA;1556565;1556680;50;*;116
;comp;rRNA;1556731;1560125;177;*;3395
;comp;rRNA;1560303;1562131;477;*;1829
fin;;CDS;1562609;1563322;;;
deb;;CDS;1566949;1567219;99;*;
;comp;rRNA;1567319;1567434;50;*;116
;comp;rRNA;1567485;1570406;147;*;2922
;comp;rRNA;1570554;1572114;452;*;1561
fin;;CDS;1572567;1574498;;;
deb;;CDS;1579539;1580615;14;*;
;comp;rRNA;1580630;1580745;49;*;116
;comp;rRNA;1580795;1583909;158;*;3115
;comp;rRNA;1584068;1585719;295;*;1652
fin;comp;CDS;1586015;1587520;;;
deb;comp;CDS;1600693;1601166;174;*;
;comp;tRNA;1601341;1601416;3;*;gac
;comp;tRNA;1601420;1601496;12;*;atgf
;comp;rRNA;1601509;1601624;50;*;116
;comp;rRNA;1601675;1604595;146;*;2921
;comp;rRNA;1604742;1606293;76;*;1552
;comp;tRNA;1606370;1606440;1;*;gga
;comp;tRNA;1606442;1606518;4;*;cca
;comp;tRNA;1606523;1606599;3;*;cgt
;comp;tRNA;1606603;1606691;16;*;tta
;comp;tRNA;1606708;1606782;29;*;ggc
;comp;tRNA;1606812;1606892;14;*;cta
;comp;tRNA;1606907;1606982;5;*;aaa
;comp;tRNA;1606988;1607062;87;*;caa
;comp;tRNA;1607150;1607225;46;*;gac
;comp;tRNA;1607272;1607347;4;*;gta
;comp;tRNA;1607352;1607426;1;*;gaa
;comp;tRNA;1607428;1607502;8;*;aac
;comp;tRNA;1607511;1607587;11;*;atc
;comp;tRNA;1607599;1607669;6;*;tgg
;comp;tRNA;1607676;1607748;9;*;aca
;comp;tRNA;1607758;1607833;8;*;ttc
;comp;tRNA;1607842;1607917;4;*;gac
;comp;tRNA;1607922;1607998;20;*;atgf
;comp;tRNA;1608019;1608111;54;*;tca
;comp;tRNA;1608166;1608258;20;*;tca
;comp;tRNA;1608279;1608351;16;*;gca
;comp;tRNA;1608368;1608441;10;*;cca
;comp;tRNA;1608452;1608525;3;*;cgt
;comp;tRNA;1608529;1608617;16;*;tta
;comp;tRNA;1608634;1608708;29;*;ggc
;comp;tRNA;1608738;1608818;13;*;cta
;comp;tRNA;1608832;1608907;5;*;aaa
;comp;tRNA;1608913;1608987;87;*;caa
;comp;tRNA;1609075;1609150;46;*;gac
;comp;tRNA;1609197;1609272;4;*;gta
;comp;tRNA;1609277;1609351;8;*;gaa
;comp;tRNA;1609360;1609450;3;*;agc
;comp;tRNA;1609454;1609528;114;*;aac
fin;comp;CDS;1609643;1610101;;0;
deb;comp;CDS;1702642;1703788;114;*;
;comp;tRNA;1703903;1703975;10;*;gca
;comp;tRNA;1703986;1704057;5;*;ggc
;comp;tRNA;1704063;1704138;5;*;aaa
;comp;tRNA;1704144;1704218;65;*;caa
;comp;tRNA;1704284;1704366;17;*;tac
;comp;tRNA;1704384;1704459;5;*;gta
;comp;tRNA;1704465;1704539;24;*;gaa
;comp;tRNA;1704564;1704636;4;*;acc
;comp;tRNA;1704641;1704715;9;*;aac
;comp;rRNA;1704725;1704840;86;*;116
;comp;rRNA;1704927;1707848;146;*;2922
;comp;rRNA;1707995;1709544;224;*;1550
fin;comp;CDS;1709769;1709987;;0;
deb;comp;CDS;1767157;1767618;206;*;
;comp;rRNA;1767825;1767940;49;*;116
;comp;rRNA;1767990;1770910;146;*;2921
;comp;rRNA;1771057;1772607;373;*;1551
fin;comp;CDS;1772981;1774480;;;
deb;comp;CDS;1787717;1790188;259;*;
;comp;tRNA;1790448;1790519;13;*;gaa
;comp;tRNA;1790533;1790606;160;*;atgj
fin;comp;CDS;1790767;1791249;;;
deb;comp;CDS;1820538;1820717;190;*;
;comp;rRNA;1820908;1821023;48;*;116
;comp;rRNA;1821072;1823993;80;*;2922
;comp;tRNA;1824074;1824149;8;*;gca
;comp;tRNA;1824158;1824234;132;*;atc
;comp;rRNA;1824367;1825918;218;*;1552
fin;comp;CDS;1826137;1826406;;;
deb;comp;CDS;1827820;1829508;132;*;
;comp;ncRNA;1829641;1829905;79;*;
fin;comp;CDS;1829985;1830485;;0;
deb;comp;CDS;1832600;1832992;166;*;
;comp;tRNA;1833159;1833251;156;*;tca
fin;comp;CDS;1833408;1834682;;;
deb;;CDS;1839668;1840669;34;*;
;comp;rRNA;1840704;1840819;48;*;116
;comp;rRNA;1840868;1843788;79;*;2921
;comp;tRNA;1843868;1843943;8;*;gca
;comp;tRNA;1843952;1844028;132;*;atc
;comp;rRNA;1844161;1845712;241;*;1552
fin;comp;CDS;1845954;1848425;;;
deb;;CDS;1873838;1875127;139;*;
;;tRNA;1875267;1875342;13;*;aaa
;;tRNA;1875356;1875427;21;*;gaa
;;tRNA;1875449;1875524;41;*;gac
;;tRNA;1875566;1875638;403;*;ttc
fin;;CDS;1876042;1876749;;;
deb;comp;CDS;2217640;2217846;205;*;
;;tRNA;2218052;2218127;258;*;cgg
fin;;CDS;2218386;2219693;;;
deb;;CDS;2250178;2250645;126;*;
;;tmRNA;2250772;2251126;407;*;
fin;;CDS;2251534;2252211;;;
deb;comp;CDS;2428815;2429495;404;*;
;;rRNA;2429900;2431454;144;*;1555
;;rRNA;2431599;2434520;101;*;2922
;;rRNA;2434622;2434737;4;*;116
;;tRNA;2434742;2434817;4;*;gta
;;tRNA;2434822;2434897;9;*;aca
;;tRNA;2434907;2434982;22;*;cac
;;tRNA;2435005;2435085;29;*;cta
;;tRNA;2435115;2435189;16;*;ggc
;;tRNA;2435206;2435294;3;*;tta
;;tRNA;2435298;2435371;10;*;cgt
;;tRNA;2435382;2435455;16;*;cca
;;tRNA;2435472;2435544;20;*;gca
;;tRNA;2435565;2435657;54;*;tca
;;tRNA;2435712;2435805;20;*;cta
;;tRNA;2435826;2435902;1;*;atgf
;;tRNA;2435904;2435979;12;*;gac
;;tRNA;2435992;2436067;14;*;ttc
;;tRNA;2436082;2436157;10;*;aca
;;tRNA;2436168;2436243;13;*;aaa
;;tRNA;2436257;2436327;10;*;gga
;;tRNA;2436338;2436414;7;*;atc
;;tRNA;2436422;2436496;7;*;aac
;;tRNA;2436504;2436594;6;*;agc
;;tRNA;2436601;2436672;657;*;gaa
fin;;CDS;2437330;2438274;;0;
deb;;CDS;2798971;2799474;109;*;
;;tRNA;2799584;2799657;1;*;gga
;;tRNA;2799659;2799732;410;*;aga
fin;;CDS;2800143;2800343;;0;
deb;comp;CDS;2991608;2992366;242;*;
;;tRNA;2992609;2992682;221;*;atgi
fin;;CDS;2992904;2993515;;;

ban séquences[modifier | modifier le wikicode]

33 aas;inter;21 aas;inter;19 aas;inter;11 aas;inter
;;;;;;;
gga;1;;;;;ttg;10
cca;4;;;;;tgc;14
cgt;3;;;;;ggc;5
tta;16;;;;;caa;63
ggc;29;;;;;cac;19
cta;14;;;;;tgg;7
aaa;5;;;;;tac;17
caa;87;;;;;gta;5
gac;46;gaa;6;;;gaa;24
gta;4;agc;7;;;acc;4
gaa;1;aac;7;gaa;1;aac;
aac;8;atc;10;aac;8;;
atc;11;gga;13;atc;11;;
tgg;6;aaa;10;tgg;6;;
aca;9;aca;14;aca;9;;
ttc;8;ttc;12;ttc;9;;
gac;4;gac;1;gac;4;;
atgf;20;atgf;20;atgf;20;;
tca;54;cta;54;tca;54;9 aas;inter
tca;20;tca;20;tca;20;;
gca;16;gca;16;gca;16;gca;10
cca;10;cca;10;cca;10;ggc;5
cgt;3;cgt;3;cgt;3;aaa;5
tta;16;tta;16;tta;16;caa;65
ggc;29;ggc;29;ggc;29;tac;17
cta;13;cta;22;cta;22;gta;5
aaa;5;cac;9;cac;9;gaa;24
caa;87;aca;4;aca;4;acc;4
gac;46;gta;;gta;;aac;
gta;4;;;;;;
gaa;8;;;;;;
agc;3;;;;;;
aac;;;;;;;

bacilli synthèse[modifier | modifier le wikicode]

bacilli données intercalaires[modifier | modifier le wikicode]

Les bacilli;;ban;bsu;lbu;lam;lmo;pmq;ppm;ppmp;;;;;* Autres intercalaires: 1456;;;ft: 271;Ici: 868;Reste: 317;;;;;;;;;;;;;;;;;;;;;;;
compilation du 18.10.22;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;fx%;fc%;CDS 16s c;CDS 16s x;5s CDS c;5s CDS x;5s 16s c;;16s 23s;;23s 5s;;16s tRNA;;tRNA 23s;;5s tRNA;;tRNA in;;tRNA contig;;tRNA hors;;Hors / contig;;;;;bacilli;HC
;effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;2;9;218;295;87;14;183;1;144;1;86;1;98;1;79;1;15;1;5;5;1;2;1;lam;;ppm;;bsu;;2;3
tot;fxt;fct;tot;fx;fc;tot;fx40;fc40;tot;x-;c-;13;85;224;349;123;34;;1;147;1;100;1;114;1;80;1;31;1;10;5;2;3;2;35;gaa;11;ttg;3;gaa;3;10
0;0;1;0;12;159;0;12;159;-1;1;525;20;114;230;387;130;36;;1;158;1;111;2;99;1;128;1;34;1;12;19;3;13;3;9;tca;11;tgc;4;gta;4;14
10;0;0;10;94;1534;1;7;264;-2;4;5;31;65;241;399;148;57;;1;177;1;113;2;127;1;129;1;36;1;14;30;4;16;4;3;atgf;6;ggc;22;aca;5;8
20;2;1;20;146;2063;2;10;262;-3;0;2;60;44;243;404;156;99;;1;231;1;133;2;132;1;130;1;38;1;19;38;5;12;5;6;gac;9;caa;4;tac;6;8
30;0;3;30;228;1179;3;9;210;-4;50;1371;47;36;258;452;175;208;;1;259;1;144;2;133;1;186;1;39;1;21;14;6;10;6;7;ttc;17;cac;*;caa;7;8
40;2;2;40;448;807;4;8;158;-5;0;1;31;33;272;477;178;277;;1;263;1;161;4;113;2;81;1;46;1;24;11;7;11;7;4;tac;7;tgg;4;aac;8;5
50;2;3;50;347;649;5;11;137;-6;5;2;27;38;289;513;190;296;;1;266;1;168;;;2;118;1;54;1;41;17;8;7;8;12;tgg;4;tac;29;agc;9;10
60;5;6;60;227;606;6;4;128;-7;1;29;29;39;291;533;206;176;;1;267;1;169;;;2;172;1;55;2;11;26;9;11;9;7;cac;22;aca;11;gaa;10;1
70;4;4;70;197;681;7;12;83;-8;5;448;28;36;295;547;237;183;;1;268;2;48;;;4;127;1;82;2;20;24;10;1;10;23;caa;35;ttc;26;caa;11;7
80;3;7;80;216;703;8;14;64;-9;5;0;33;33;298;570;298;236;;1;270;2;49;;;;;2;7;2;46;16;11;8;11;40;tgc;15;gac;11;aaa;12;4
90;9;5;90;211;646;9;9;105;-10;5;26;29;37;299;612;308;;;1;271;2;81;;;;;2;12;2;52;13;12;4;12;*;ttg;25;atgf;80;cta;13;5
100;7;4;100;245;606;10;10;123;-11;9;200;34;33;302;613;393;;;1;272;2;97;;;;;2;14;3;8;11;13;6;13;lbu;;58;gta;*;ctc;14;2
110;3;12;110;212;668;11;8;162;-12;2;0;36;29;309;649;460;;;1;290;2;101;;;;;2;18;5;69;10;14;2;14;3;aac;17;gaa;35;ttc;15;2
120;5;10;120;251;597;12;11;273;-13;1;29;30;26;318;695;767;;;1;353;2;145;;;;;2;20;;;12;15;3;15;24;cca;3;tcc;81;gac;16;2
130;6;13;130;270;531;13;15;222;-14;5;132;35;25;320;793;232;;;2;203;2;170;;;;;3;4;;;11;16;2;16;30;ggc;*;aac;9;gaa;17;5
140;4;7;140;221;470;14;21;240;-15;2;0;33;23;321;;343;;;2;218;3;50;;;;;3;43;;;12;17;5;17;2;cgt;ppmp;;*;aaa;18;0
150;2;6;150;261;458;15;15;263;-16;3;18;32;21;323;;216;;;2;280;3;71;;;;;4;9;;;3;18;0;18;3;gta;5;agc;pmq;;19;1
160;0;11;160;241;425;16;11;206;-17;4;97;28;21;344;;383;;;2;410;3;78;;;;;6;13;;;12;19;2;19;42;gaa;63;tgc;7;aac;20;0
170;3;8;170;234;388;17;17;174;-18;1;1;29;19;350;;163;;;3;167;4;69;;;;;;;;;10;20;0;20;9;tca;7;gaa;297;agc;21;1
180;3;3;180;204;376;18;18;214;-19;1;13;28;18;363;;;;;4;244;4;80;;;;;;;;;2;21;1;21;3;atgf;6;ctt;9;gaa;22;3
190;3;5;190;216;347;19;15;155;-20;3;78;27;16;364;;;;;4;269;6;70;;;;;;;;;8;22;3;22;6;gac;101;cca;*;ctc;23;1
200;2;4;200;206;327;20;15;154;-21;0;0;23;14;365;;;;;5;146;6;77;;;;;;;;;2;23;1;23;8;ttc;4;tgg;16;gca;24;1
210;6;3;210;199;293;21;10;165;-22;1;18;23;14;373;;;;;5;164;6;96;;;;;;;;;4;24;1;24;4;tac;7;tat;12;gaa;25;1
220;1;3;220;168;253;22;13;156;-23;1;55;20;13;376;;;;;7;217;8;55;;;;;;;;;5;25;1;25;13;tgg;6;caa;16;gta;26;1
230;4;7;230;169;255;23;19;126;-24;0;1;20;11;377;;;;;;;;;;;;;;;;;4;26;1;26;29;cac;5;cac;17;gac;27;0
240;2;1;240;149;243;24;28;144;-25;3;21;16;10;388;;;;;51;;66;;14;;16;;36;;24;;3;27;1;27;28;tgc;125;gac;9;cac;28;2
250;5;1;250;151;200;25;17;101;-26;5;53;17;9;408;;;;;tRNA 16s;23s tRNA;16s 5s;;;;;;;;;;5;28;2;28;*;ttg;10;gga;9;caa;29;3
260;1;3;260;121;173;26;29;102;-27;0;0;16;10;422;;;;;76;131;102;;;;;;;;;;8;29;3;29;17;ttg;4;aac;8;aaa;30;1
270;3;3;270;125;167;27;28;109;-28;1;7;12;8;445;;;;;159;;117;;;;;;;;;;2;30;1;30;28;ttg;9;tac;3;ctg;31;0
280;2;1;280;119;181;28;24;83;-29;3;32;11;7;445;;;;;170;;;;;;;;;;776;;1;31;0;31;29;tgc;82;ata;*;ggc;32;0
290;1;1;290;89;144;29;26;95;-30;0;0;12;7;451;;;;;171;;;;;;;;;;;;1;32;0;32;13;cac;5;atgi;40;ctc;33;0
300;1;0;300;82;121;30;34;98;-31;1;7;11;5;451;;;;;341;;;;;;;;;;;;1;33;3;33;4;tgg;4;aac;13;tcc;34;0
310;1;0;310;87;130;31;33;98;-32;3;28;8;7;489;;;;;;;8;;;;;;;;;;4;34;2;34;8;tac;131;tgg;19;atgj;35;3
320;0;1;320;81;95;32;30;75;-33;1;0;11;5;501;;;;;;;;;;;;;;;;;2;35;4;35;6;ttc;5;gaa;*;tcg;36;1
330;0;0;330;63;128;33;42;101;-34;1;5;8;6;510;;;;;;;;;;;;;;;;;1;36;1;36;3;gac;55;ggc;lmo;;37;0
340;3;1;340;79;91;34;33;67;-35;1;24;8;5;518;;;;;;;;;;;;;;;;;1;37;0;37;9;atgf;22;ttc;157;gaa;38;0
350;1;1;350;57;101;35;45;87;-36;2;0;6;4;520;;;;;;;;;;;;;;;;;3;38;0;38;42;tca;7;cga;9;acg;39;0
360;0;4;360;60;82;36;42;94;-37;0;8;5;5;533;;;;;;;;;;;;;;;;;2;39;0;39;261;gaa;5;cca;11;tac;40;2
370;1;1;370;47;71;37;39;62;-38;1;9;6;5;536;;;;;;;;;;;;;;;;;2;40;2;40;2;agc;5;ttg;6;caa;41;1
380;0;0;380;39;82;38;49;67;-39;1;0;5;3;562;;;;;;;;;;;;;;;;;2;41;1;41;3;atc;4;atc;*;aaa;42;2
390;1;2;390;47;88;39;66;90;-40;1;6;;;607;;;;;;;;;;;;;;;;;3;42;2;42;14;gga;5;atgf;ban;;55;1
400;0;2;400;36;59;40;69;66;-41;1;17;;;673;;;;;;;;;;;;;;;;;0;43;0;43;17;ttc;109;gca;13;aaa;58;1
reste;10;13;reste;760;973;reste;6487;12408;-42;2;0;;;744;;;;;;;;;;;;;;;;;0;44;0;44;11;atgf;3;cga;21;gaa;63;1
total;108;163;total;7415;18150;total;7415;18150;-43;0;3;;;;;;;;;;;;;;;;;;;;1;45;0;45;12;atgi;13;cta;41;gac;80;1
%reste;9,3;8,0;%reste;10,2;5,4;diagr;916;5583;-44;2;14;;;;;;;;;;;;;;;;;;;;2;46;0;46;36;atgj;8;atc;*;ttc;81;1
 t30;2;4; t30;468;4776;;;;-45;1;0;;;44;16;20;11;1;92;;;;;;;;;;;;0;47;0;47;6;cca;4;aac;;;82;1
%t30;1,9;2,5;%t30;6,3;26,3;;;;-46;0;5;;;;;;;;;;;;;;;;;;;;1;48;0;48;5;cgt;*;tgg;;;86;1
diagr;98;149;diagr;6643;17018;;;;-47;1;13;;;;;;;;;;;;;;;;;;;;2;49;1;49;15;tta;8;gac;;;101;1
;;;;;;;;;-48;0;0;;;;;;;;;;;;;;;;;;;;1;50;0;50;4;ggc;86;tac;;;109;1
;;Récapitulatif des effectifs;;;;;;;-49;0;7;;;;;;;;;;;;;;;;;;;;19;;20;;11;aca;14;aaa;;;125;1
;;>0;<0;zéro;total;*;;;-50;1;31;;;;;;;;;;;;;;;;;;;561;391;;169;;12;cta;4;gga;;;131;1
;x;7403;164;12;7472;;;;reste;23;49;;;;;;;;;;;;;;;;;;;;1;54;1;55;2;aaa;7;ttc;;;157;1
;c;17991;3390;159;21070;42610;;;total;164;3390;;;;;;;;;;;;;;;;;;;;1;54;1;58;*;gta;*;acg;;;261;1
;;;;;;1456;;;%reste;14,0;1,4;;;;;;;;;;;;;;;;;;;;1;54;1;63;;;;;;;297;1
;;;;;;44066;;;diagr;86;1 437;;;;;;;;;;;;;;;;;;;;1;55;1;80;;;;;;;;132
;;;;;;;;;%diagr;52,4;42,4;;;;;;;;;;;;;;;;;;;;1;56;1;81;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;56;1;82;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;60;2;86;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;63;1;101;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;65;1;108;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;67;1;109;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;77;1;111;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;87;1;112;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;87;1;125;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;102;1;131;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;104;1;139;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;106;1;157;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;138;1;230;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;158;1;261;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;265;1;297;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;lbu x+;151;;;;;;;;

bacilli distribution par génome[modifier | modifier le wikicode]

baci8;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
bsu;18;8;;52;2;4;;2;86
lmo;9;8;;44;;4;;2;67
lam;22;14;;16;;4;3;4;63
ppm;67;21;;68;;5;;;161
pmq;22;11;;138;;0;2;;173
lbu;49;16;;16;;10;7;;98
ban;8;5;;60;33;4;;2;112
;;;;;;;;;
total;195;83;0;394;35;31;12;10;760

bacilli distribution du total[modifier | modifier le wikicode]

baci8;Sans 2 16s, 10 13aas et 31 +16s;;;;;;717;;baci8;Le reste;;;;;;43
atgi;8;tct;;tat;;atgf;25;;atgi;;tct;;tat;;atgf;2
att;;act;2;aat;;agt;;;att;;act;;aat;;agt;
ctt;5;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;23;tcc;12;tac;24;tgc;12;;ttc;;tcc;1;tac;;tgc;
atc;16;acc;8;aac;32;agc;17;;atc;15;acc;1;aac;4;agc;
ctc;11;ccc;2;cac;21;cgt;27;;ctc;;ccc;;cac;;cgt;1
gtc;8;gcc;4;gac;34;ggc;39;;gtc;;gcc;;gac;2;ggc;3
tta;16;tca;17;taa;;tga;;;tta;;tca;;taa;;tga;
ata;1;aca;23;aaa;30;aga;9;;ata;;aca;;aaa;;aga;
cta;15;cca;27;caa;29;cga;2;;cta;;cca;;caa;;cga;
gta;36;gca;17;gaa;42;gga;19;;gta;;gca;16;gaa;;gga;1
ttg;13;tcg;10;tag;;tgg;15;;ttg;2;tcg;;tag;;tgg;
atgj;14;acg;7;aag;10;agg;3;;atgj;;acg;;aag;5;agg;
ctg;15;ccg;2;cag;1;cgg;8;;ctg;2;ccg;;cag;;cgg;
gtg;;gcg;;gag;2;ggg;4;;gtg;;gcg;;gag;;ggg;
baci8;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci8;dupli;1aa;-5s;+5s;-16s;+16s;total
type;207;83;0;394;33;0;717;;type;12;;;10;2;31;43

bacilli distribution par type[modifier | modifier le wikicode]

baci8;;;;;;;717;;baci8;;;;;;;83;;baci8;;;;;;;195;;baci8;;;;;;;12;;baci8;;;;;;;427
atgi;8;tct;0;tat;0;atgf;25;;atgi;2;tct;;tat;;atgf;;;atgi;3;tct;;tat;;atgf;7;;atgi;;tct;;tat;;atgf;;;atgi;3;tct;;tat;;atgf;18
att;0;act;2;aat;0;agt;0;;att;;act;2;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;5;cct;0;cat;0;cgc;0;;ctt;2;cct;;cat;;cgc;;;ctt;3;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;23;tcc;12;tac;24;tgc;12;;ttc;0;tcc;;tac;;tgc;;;ttc;9;tcc;3;tac;11;tgc;5;;ttc;;tcc;;tac;;tgc;;;ttc;14;tcc;9;tac;13;tgc;7
atc;16;acc;8;aac;32;agc;17;;atc;1;acc;2;aac;1;agc;1;;atc;3;acc;;aac;9;agc;6;;atc;;acc;;aac;;agc;;;atc;12;acc;6;aac;22;agc;10
ctc;11;ccc;2;cac;21;cgt;27;;ctc;3;ccc;2;cac;;cgt;1;;ctc;4;ccc;;cac;9;cgt;3;;ctc;;ccc;;cac;;cgt;;;ctc;4;ccc;;cac;12;cgt;23
gtc;8;gcc;4;gac;34;ggc;39;;gtc;5;gcc;2;gac;1;ggc;;;gtc;;gcc;1;gac;11;ggc;7;;gtc;;gcc;;gac;;ggc;3;;gtc;3;gcc;1;gac;22;ggc;29
tta;16;tca;17;taa;0;tga;0;;tta;2;tca;5;taa;;tga;;;tta;3;tca;5;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;11;tca;7;taa;;tga;
ata;1;aca;23;aaa;30;aga;9;;ata;;aca;1;aaa;;aga;7;;ata;1;aca;4;aaa;8;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;18;aaa;22;aga;1
cta;15;cca;27;caa;29;cga;2;;cta;;cca;;caa;4;cga;;;cta;3;cca;5;caa;10;cga;2;;cta;;cca;;caa;;cga;;;cta;12;cca;22;caa;15;cga;
gta;36;gca;17;gaa;42;gga;19;;gta;;gca;;gaa;;gga;5;;gta;8;gca;2;gaa;19;gga;4;;gta;;gca;;gaa;;gga;;;gta;28;gca;15;gaa;23;gga;10
ttg;13;tcg;10;tag;0;tgg;15;;ttg;;tcg;5;tag;;tgg;;;ttg;4;tcg;3;tag;;tgg;7;;ttg;2;tcg;;tag;;tgg;;;ttg;7;tcg;2;tag;;tgg;8
atgj;14;acg;7;aag;10;agg;3;;atgj;2;acg;3;aag;4;agg;3;;atgj;4;acg;2;aag;1;agg;;;atgj;;acg;;aag;5;agg;;;atgj;8;acg;2;aag;;agg;
ctg;15;ccg;2;cag;1;cgg;8;;ctg;5;ccg;;cag;;cgg;8;;ctg;1;ccg;2;cag;1;cgg;;;ctg;2;ccg;;cag;;cgg;;;ctg;7;ccg;;cag;;cgg;
gtg;0;gcg;0;gag;2;ggg;4;;gtg;;gcg;;gag;1;ggg;3;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;1
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total
;;;;;;;;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;;;;;*;;;

bacilli par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;baci8;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;43;21;5;13;;;82;
16;moyen;27;59;4;135;2;31;227;
14;fort;13;115;3;279;8;2;418;
; ;83;195;12;427;10;33;760;
10;g+cga;16;12;5;5;;;38;
2;agg+cgg;11;0;;;;;11;
4;carre ccc;12;5;;8;;;25;
5;autres;4;4;;;;;8;
;;43;21;5;13;;;82;
;total tRNAs  ‰ ;;;;;;;;
;baci8;1aa;>1aa;dup;+5s;1-3aas;autres;baci  ‰;ref. ‰
21;faible;57;28;7;17;;;108;26
16;moyen;36;78;5;178;3;41;299;324
14;fort;17;151;4;367;11;3;550;650
;;109;257;16;562;13;43;760;729
10;g+cga;21;16;7;7;;;50;10
2;agg+cgg;14;;;;;;14;
4;carre ccc;16;7;;11;;;33;16
5;autres;5;5;;;;;11;
;;57;28;7;17;;;108;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;baci8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;148;72;17;238;26;52;11;
16;moyen;93;203;14;310;324;33;30;
14;fort;45;397;10;452;650;16;59;
;;286;672;41;290;729;83;195;
10;g+cga;55;41;17;114;;37;;
2;agg+cgg;38;;;38;;26;;
4;carre ccc;41;17;;59;;28;;
5;autres;14;14;;28;;9;;
;;148;72;17;238;;43;;

bacilli, estimation des -rRNAs[modifier | modifier le wikicode]

;;;;;;;;bacilli;;;;;;;;;;;;;;;;;
32 génomes total avec rRNA;;;;baci;total;ttt;tgt;;100 génomes total avec rRNA;;;;baci;total;ttt;tgt;;;;;;;;;
effectifs;sans +16s;;;32;1889;0;0;;indices;;;;32;5903;0;0;;baci7;effectifs;;1aa+>1aa+dup;;;;290
atgi;20;tct;;tat;;atgf;91;;atgi;63;tct;;tat;;atgf;284;;atgi;5;tct;;tat;;atgf;7
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;2;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;5;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;63;tcc;30;tac;56;tgc;30;;ttc;197;tcc;94;tac;175;tgc;94;;ttc;9;tcc;3;tac;11;tgc;5
atc;92;acc;27;aac;99;agc;38;;atc;288;acc;84;aac;309;agc;119;;atc;4;acc;2;aac;10;agc;7
ctc;15;ccc;;cac;53;cgt;82;;ctc;47;ccc;;cac;166;cgt;256;;ctc;7;ccc;2;cac;9;cgt;4
gtc;3;gcc;1;gac;106;ggc;101;;gtc;9.4;gcc;3.1;gac;331;ggc;316;;gtc;5;gcc;3;gac;12;ggc;10
tta;59;tca;49;taa;;tga;;;tta;184;tca;153;taa;;tga;;;tta;5;tca;10;taa;;tga;
ata;;aca;87;aaa;84;aga;1;;ata;0;aca;272;aaa;263;aga;3.1;;ata;1;aca;5;aaa;8;aga;8
cta;54;cca;77;caa;69;cga;;;cta;169;cca;241;caa;216;cga;;;cta;3;cca;5;caa;14;cga;2
gta;113;gca;122;gaa;94;gga;49;;gta;353;gca;381;gaa;294;gga;153;;gta;8;gca;2;gaa;19;gga;9
ttg;32;tcg;2;tag;;tgg;42;;ttg;100;tcg;6.3;tag;;tgg;131;;ttg;6;tcg;8;tag;;tgg;7
atgj;32;acg;3;aag;;agg;;;atgj;100;acg;9.4;aag;;agg;;;atgj;6;acg;5;aag;10;agg;3
ctg;12;ccg;;cag;;cgg;;;ctg;37.5;ccg;;cag;;cgg;;;ctg;8;ccg;2;cag;1;cgg;8
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;3.1;;gtg;;gcg;;gag;2;ggg;3
;;693;;1171;;25;1889;;;;2166;;3659;;78;5903;;;;90;;131;;69;290
29.5.20 Tanger;;;;baci;total;ttt;tgt;;29.5.20 Tanger;;;;baci;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;49366;0,2;0;;indices;sans +16s;;;618;49366;0,2;0;;baci7;indices;;1aa+>1aa+dup;;;;
atgi;84;tct;0.3;tat;0.5;atgf;1;;atgi;146;tct;0.3;tat;0.5;atgf;285;;atgi;71;tct;;tat;;atgf;100
att;0.2;act;11;aat;0.5;agt;;;att;0.2;act;11;aat;0.5;agt;;;att;;act;29;aat;;agt;
ctt;47;cct;0.6;cat;0.2;cgc;0.2;;ctt;47;cct;0.6;cat;0.2;cgc;0.2;;ctt;71;cct;;cat;;cgc;
gtt;0.2;gct;0.5;gat;;ggt;;;gtt;0.2;gct;0.5;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;75;tcc;26;tac;64;tgc;23;;ttc;272;tcc;120;tac;239;tgc;117;;ttc;129;tcc;43;tac;157;tgc;71
atc;23;acc;8;aac;69;agc;40;;atc;310;acc;92;aac;378;agc;159;;atc;57;acc;29;aac;143;agc;100
ctc;28;ccc;6.1;cac;20;cgt;32;;ctc;75;ccc;6.1;cac;186;cgt;288;;ctc;100;ccc;29;cac;129;cgt;57
gtc;44;gcc;27;gac;55;ggc;-6;;gtc;53;gcc;30;gac;386;ggc;310;;gtc;71;gcc;43;gac;171;ggc;143
tta;27;tca;91;taa;1.1;tga;1.8;;tta;211;tca;244;taa;1.1;tga;1.8;;tta;71;tca;143;taa;;tga;
ata;2.1;aca;22;aaa;78;aga;116;;ata;2.1;aca;294;aaa;340;aga;119;;ata;14;aca;71;aaa;114;aga;114
cta;30;cca;2;caa;83;cga;6.3;;cta;199;cca;243;caa;299;cga;6.3;;cta;43;cca;71;caa;200;cga;29
gta;44;gca;62;gaa;174;gga;152;;gta;397;gca;443;gaa;468;gga;305;;gta;114;gca;29;gaa;271;gga;129
ttg;25;tcg;41;tag;0.8;tgg;6;;ttg;125;tcg;47;tag;0.8;tgg;137;;ttg;86;tcg;114;tag;;tgg;100
atgj;52;acg;38;aag;73;agg;72;;atgj;152;acg;47;aag;73;agg;72;;atgj;86;acg;71;aag;143;agg;43
ctg;22.5;ccg;19;cag;17;cgg;109;;ctg;60;ccg;19;cag;17;cgg;109;;ctg;114;ccg;29;cag;14;cgg;114
gtg;0.8;gcg;8.6;gag;16;ggg;15;;gtg;0.8;gcg;8.6;gag;16;ggg;18;;gtg;;gcg;;gag;29;ggg;43
;;654;;845;;582;2081;;;;2820;;4504;;660;7984;;;;1286;;1871;;986;4143
rapports;;23;;19;;88;26;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;baci7;indices;;1aa+>1aa+dup;;différence;;
atgi;57;tct;;tat;;atgf;0.2;;fiches;28.90625;;;fréquences;;;;;atgi;14;tct;100;tat;100;atgf;99
att;;act;100;aat;;agt;;;total des aas sans rRNA;925;;;0/0;0;;;;att;100;act;62;aat;100;agt;
ctt;100;cct;;cat;;cgc;;;avec;1902;;;10;2;;;;ctt;34;cct;100;cat;100;cgc;100
gtt;;gct;;gat;;ggt;;;genom;32;;;20;3;;;;gtt;100;gct;100;gat;;ggt;
ttc;28;tcc;22;tac;27;tgc;20;;;;;;30;1;;;;ttc;42;tcc;39;tac;59;tgc;67
atc;7;acc;8;aac;18;agc;25;;baci7;41.429;;;40;9;;;;atc;61;acc;73;aac;52;agc;60
ctc;38;ccc;100;cac;11;cgt;11;;sans;290;;;50;6;21;;;ctc;72;ccc;79;cac;84;cgt;44
gtc;82;gcc;90;gac;14;ggc;-2;;avec;470;;;60;5;;;;gtc;39;gcc;37;gac;68;ggc;104
tta;13;tca;37;taa;;tga;100;;genom;7;;;70;9;;;;tta;63;tca;36;taa;100;tga;100
ata;100;aca;8;aaa;23;aga;97;;;;;;80;5;;;;ata;85;aca;69;aaa;32;aga;1
cta;15;cca;1.0;caa;28;cga;100;;L’estimation par baci7;;;;90;3;;;;cta;29;cca;97;caa;58;cga;78
gta;11;gca;14;gaa;37;gga;50;;est  43 % au dessus;;;;100;6;;;;gta;62;gca;54;gaa;36;gga;15
ttg;20;tcg;87;tag;;tgg;4;;des aas sans;;;;;1;;;;ttg;71;tcg;64;tag;100;tgg;94
atgj;34;acg;80;aag;100;agg;100;;32;;100;;;50;;;;atgj;39;acg;47;aag;49;agg;40
ctg;38;ccg;100;cag;100;cgg;100;;atc;45;310;;;;;;;ctg;80;ccg;34;cag;16;cgg;5
gtg;100;gcg;100;gag;100;ggg;83;;gca;59;443;;;;;;;gtg;100;gcg;100;gag;44;ggg;65
;;;;;;;;;;;;;;;;;;;;867;;838;;850;2554

clostridia[modifier | modifier le wikicode]

psor[modifier | modifier le wikicode]

psor opérons[modifier | modifier le wikicode]

27.3%GC;8.8.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paeniclostridium sordellii AM370;;;;;;;;;
;9847..10620;CDS;;205;205;;;258;
;10826..12332;16s;;196;;;;;
;12529..15445;23s;;78;;;;;
;15524..15640;5s;;85;85;;;;85
;15726..15947;CDS;;;;;;74;
;;;;;;;;;
;18845..19297;CDS;;3;3;;;151;3
;19301..19393;tcc;;27;;;;;
;19421..19685;ncRNA;;152;152;;;;
;19838..21478;CDS;;;;;;*547;
;;;;;;;;;
;24343..24570;CDS;;309;309;;;76;
;24880..26386;16s;;196;;;;;
;26583..29499;23s;;122;;;;;
;29622..29738;5s;;5;;;5;;
;29744..29832;tta;+;13;;;13;;
;29846..29921;atgf;3 aaa;15;;;15;;
;29937..30011;gaa;6 atg;9;;;9;;
;30021..30094;gga;3 gta;6;;;6;;
;30101..30176;gta;1 cgt;5;;;5;;
;30182..30258;gac;1 ggc;16;;;16;;
;30275..30350;aac;2 fois suite;4;;;4;;
;30355..30429;aca;aac aca aga;4;;;4;;
;30434..30518;tac;caa cac cca;15;;;15;;
;30534..30617;cta;cta gaa gac;14;;;14;;
;30632..30708;aga;gga tac tca;7;;;7;;
;30716..30791;caa;tgc tta ttc;11;;;11;;
;30803..30878;aaa;;6;;;6;;
;30885..30973;tca;;3;;;3;;
;30977..31052;ttc;;9;;;9;;
;31062..31138;atgj;;8;;;8;;
;31147..31223;atgi;;21;;;21;;
;31245..31321;cca;;6;;;6;;
;31328..31404;cac;;4;;;4;;
;31409..31482;tgc;;25;;;25;;
;31508..31596;tta;;13;;;13;;
;31610..31685;atgf;;15;;;15;;
;31701..31775;gaa;;9;;;9;;
;31785..31858;gga;;6;;;6;;
;31865..31940;gta;;5;;;5;;
;31946..32022;gac;;16;;;16;;
;32039..32114;aac;;4;;;4;;
;32119..32193;aca;;4;;;4;;
;32198..32282;tac;;15;;;15;;
;32298..32381;cta;;11;;;11;;
;32393..32467;ggc;;13;;;13;;
;32481..32557;aga;;7;;;7;;
;32565..32640;caa;;11;;;11;;
;32652..32727;aaa;;6;;;6;;
;32734..32822;tca;;3;;;3;;
;32826..32901;ttc;;9;;;9;;
;32911..32987;atgj;;8;;;8;;
;32996..33072;atgi;;21;;;21;;
;33094..33170;cca;;6;;;6;;
;33177..33253;cac;;9;;;9;;
;33263..33338;aaa;;21;;;21;;
;33360..33433;tgc;;6;;;6;;
;33440..33516;cgt;;10;;;;;
;33527..33602;gta;;162;162;;;;162
;33765..34016;CDS;;;;;;84;
;;;;;;;;;
;34042..34455;CDS;;249;249;;;138;
;34705..36211;16s;;196;;;;;
;36408..39324;23s;;78;;;;;
;39403..39519;5s;;402;*402;;;;
comp;39922..40113;CDS;;348;348;;;64;
;40462..41968;16s;;196;;;;;
;42165..45081;23s;;78;;;;;
;45160..45276;5s;;180;180;;;;*180
;45457..47394;CDS;;;;;;*646;
;;;;;;;;;
;101428..102144;CDS;;276;276;;;239;
;102421..103927;16s;;54;;;;;
;103982..104057;gca;;114;;;;;
;104172..107096;23s;;41;;;;;
;107138..107211;gga;;11;;;;;
;107223..107339;5s;;99;99;;;;99
comp;107439..108617;CDS;;;;;;393;
;;;;;;;;;
;111345..111884;CDS;;431;*431;;;180;
;112316..113822;16s;;54;;;;;
;113877..113952;gca;;114;;;;;
;114067..116982;23s;;193;;;;;
;117176..117292;5s;;5;;;;;
;117298..117386;tta;;9;;;9;;
;117396..117472;atgi;;123;;;;;
;117596..119102;16s;;54;;;;;
;119157..119232;gca;;114;;;;;
;119347..122263;23s;;193;;;;;
;122457..122573;5s;;5;;;;;
;122579..122667;tta;;9;;;9;;
;122677..122753;atgi;;123;;;;;
;122877..124383;16s;;54;;;;;
;124438..124513;gca;;114;;;;;
;124628..127549;23s;;78;;;;;
;127628..127744;5s;;100;100;;;;100
;127845..129260;CDS;;;;;;472;
;;;;;;;;;
;215388..216260;CDS;;264;264;;;291;
;216525..218030;16s;;123;;;;;
;218154..218229;gca;;152;;;;;
;218382..221296;23s;;50;;;;;
;221347..221420;gga;;12;;;;;
;221433..221549;5s;;109;109;;;;109
;221659..221940;CDS;;525;*525;;;94;
;222466..223972;16s;;196;;;;;
;224169..227083;23s;;144;;;;;
;227228..227344;5s;;228;228;;;;*228
;227573..227989;CDS;;;;;;139;
;;;;;;;;;
;449964..450266;CDS;;253;253;;;101;
;450520..452026;16s;;196;;;;;
;452223..455139;23s;;144;;;;;
;455284..455400;5s;;112;112;;;;112
comp;455513..456616;CDS;;;;;;368;
;;;;;;;;;
;498418..499074;CDS;;189;189;;;219;
;499264..500770;16s;;118;;;;;
;500889..500964;gca;;95;;;;;
;501060..503976;23s;;144;;;;;
;504121..504237;5s;;131;131;;;;131
;504369..504551;CDS;;;;;;61;
;;;;;;;;;
;546886..550416;CDS;;41;41;;;*1177;*41
comp;550458..550544;ttg;;138;138;;;;
;550683..553325;CDS;;;;;;*881;
;;;;;;;;;
;608009..608683;CDS;;195;195;;;225;
;608879..608975;tga;;37;37;;;;37
comp;609013..609732;CDS;;;;;;240;
;;;;;;;;;
;815939..816655;CDS;;71;71;;;239;71
;816727..816800;tgc;;12;;12;;;
;816813..816888;aac;;3;;3;;;
;816892..816966;aca;;285;285;;;;
;817252..818727;CDS;;;;;;492;
;;;;;;;;;
;1284870..1288097;CDS;;111;111;;;*1076;*111
;1288209..1288297;cta;;426;*426;;;;
;1288724..1290853;CDS;;;;;;*710;
;;;;;;;;;
;1445161..1445664;CDS;;135;135;;;168;135
;1445800..1445868;other;@1;258;258;;;;
;1446127..1446813;CDS;;;;;;229;
;;;;;;;;;
;2267513..2267698;CDS;@2;306;306;;;62;*306
comp;2268005..2268088;cta;;404;*404;;;;
;2268493..2269758;CDS;;;;;;422;
;;;;;;;;;
;3094098..3094784;CDS;;40;40;;;229;40
comp;3094825..3094941;5s;;78;;;;;
comp;3095020..3097936;23s;;194;;;;;
comp;3098131..3099637;16s;;276;276;;;;
comp;3099914..3101161;CDS;;;;;;416;
;;;;;;;;;
;3159922..3160827;CDS;;37;37;;;302;37
comp;3160865..3160956;agc;;120;120;;;;
comp;3161077..3161376;CDS;;;;;;100;
;;;;;;;;;
comp;3274188..3274733;CDS;;245;245;;;182;*245
comp;3274979..3275095;5s;@3;12;;;;;
comp;3275108..3275181;gga;;107;;;;;
comp;3275289..3278214;23s;;137;;;;;
comp;3278352..3279858;16s;;253;253;;;;
comp;3280112..3280690;CDS;;;;;;193;
;;;;;;;;;
comp;3303104..3304150;CDS;;124;124;;;349;124
comp;3304275..3304459;riboswitch;@4;96;;;;;
comp;3304556..3304672;5s;;11;;;;;
comp;3304684..3304758;aca;;116;;;;;
comp;3304875..3307789;23s;;196;;;;;
comp;3307986..3309492;16s;;364;*364;;;;
;3309857..3310504;CDS;;;;;;216;
;;;;;;;;;
comp;3438683..3439531;CDS;;142;142;;;283;142
comp;3439674..3439750;aga;;7;;;7;;
comp;3439758..3439832;ggc;;9;;;9;;
comp;3439842..3439918;gac;;5;;;5;;
comp;3439924..3439999;gta;;8;;;8;;
comp;3440008..3440082;gaa;;5;;;;;
comp;3440088..3440204;5s;;40;;;;;
comp;3440245..3443168;23s;;112;;;;;
comp;3443281..3443356;gca;;109;;;;;
comp;3443466..3444972;16s;;138;;;;;
comp;3445111..3445187;atgj;+;13;;;13;;
comp;3445201..3445276;ttc;3 atg;6;;;6;;
comp;3445283..3445359;atc;2 cca;6;;;6;;
comp;3445366..3445442;cca;2 gga;31;;;31;;
comp;3445474..3445549;tgg;2 aac;11;;;11;;
comp;3445561..3445637;atgi;;6;;;6;;
comp;3445644..3445720;cca;;6;;;6;;
comp;3445727..3445817;agc;;11;;;11;;
comp;3445829..3445917;tca;;6;;;6;;
comp;3445924..3445999;aaa;;12;;;12;;
comp;3446012..3446087;caa;;6;;;6;;
comp;3446094..3446170;aga;;19;;;19;;
comp;3446190..3446263;gga;;11;;;11;;
comp;3446275..3446359;tac;;4;;;4;;
comp;3446364..3446438;aca;;4;;;4;;
comp;3446443..3446518;aac;;31;;;31;;
comp;3446550..3446625;aac;;16;;;16;;
comp;3446642..3446718;gac;;5;;;5;;
comp;3446724..3446799;gta;;6;;;6;;
comp;3446806..3446879;gga;;9;;;9;;
comp;3446889..3446963;gaa;;15;;;15;;
comp;3446979..3447054;atgf;;13;;;13;;
comp;3447068..3447156;tta;;5;;;;;
comp;3447162..3447278;5s;;213;;;;;
comp;3447492..3450406;23s;;196;;;;;
comp;3450603..3452109;16s;;239;239;;;;
comp;3452349..3452552;CDS;;;;;;68;
;;;;;;;;;
comp;3523330..3524046;CDS;;129;129;;;239;129
comp;3524176..3524251;gta;+;8;;8;;;
comp;3524260..3524334;gaa;2 fois;20;;20;;;
comp;3524355..3524430;aaa;gta gaa aaa;10;;10;;;
comp;3524441..3524515;aca;;10;;10;;;
comp;3524526..3524602;gac;;7;;7;;;
comp;3524610..3524685;gta;;9;;9;;;
comp;3524695..3524769;gaa;;5;;5;;;
comp;3524775..3524850;aaa;;289;289;;;;
;3525140..3526039;CDS;;;;;;300;

psor cumuls[modifier | modifier le wikicode]

psor cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;0;1;0;1;0;100;9
;16 23 5s 0;6;20;9;65;50;5;20;1;200;8
;16 atc gca;0;40;0;6;100;4;40;3;300;13
;16 23 5s a;2;60;0;0;150;10;60;1;400;4
;max a;44;80;0;0;200;5;80;1;500;4
;a doubles;2;100;0;0;250;5;100;3;600;1
;autres;9;120;0;0;300;8;120;3;700;1
;total aas;87;140;0;0;350;3;140;4;800;1
sans ;opérons;8;160;0;0;400;1;160;1;900;1
;1 aa;6;180;0;0;450;4;180;2;1000;0
;max a;8;200;0;0;500;0;200;0;1100;1
;a doubles;1;;0;0;;1;;3;;1
;total aas;17;;9;71;;46;;22;;44
total aas;;104;;;;;;;;;
remarques;;4;;;;;;;;;
avec jaune;;;moyenne;9;10;;206;;119;;304
;;;variance;5;6;;121;;73;;257
sans jaune;;;moyenne;;;;173;;95;;220
;;;variance;;;;90;;45;;121

psor blocs[modifier | modifier le wikicode]

I;;I2;I3;I4;;;II;;III;;IV;IV1;IV2
;;;;;;;;;;;;;
;;;;;;;;;CDS;124;;;
;;;;;;;CDS;245;riboswitch;96;;;
CDS;205;249;348;525;253;40;5s;12;5s;11;CDS;309;5
16s;196;196;196;196;196;78;gga;107;aca;116;16s;196;213
23s;78;78;78;144;144;194;23s;137;23s;196;23s;122;196
5s;85;402;180;228;112;276;16s;253;16s;364;5s;5;239
CDS;;;;;;;CDS;;CDS;;tta;;
V;;V2;VI;VI1;VII;VII1;VIII;VIII1;IX;;X;X1;
;;;;;;;;;;;;;
CDS;276;264;CDS;431;;;;;CDS;189;gaa;5;
16s;54;123;16s;54;16s;54;16s;54;16s;118;5s;40;
gca;114;152;gca;114;gca;114;gca;114;gca;95;23s;112;
23s;41;50;23s;193;23s;193;23s;78;23s;144;gca;109;
gga;11;12;5s;5;5s;5;5s;100;5s;131;16s;138;
5s;99;109;tta;9;tta;9;CDS;;CDS;;atgj;;
CDS;;;atgi;123;atgi;123;;;;;;;
;;;;;;;;;;;;;
;CDS;431;;CDS;309;;CDS;142;;CDS;264;;
VI;16s;54;IV1;16s;196;;* * * *4aas;8;V2;16s;123;;
;gca;114;;23s;122;;gaa;5;;gca;152;;
;23s;193;;5s;5;;5s;40;;23s;50;;
;5s;5;;tta;13;;23s;112;;gga;12;;
;tta;9;;* * * * 42aas;10;;gca;109;;5s;109;;
;atgi;123;;gta;162;X1;16s;138;;CDS;525;;
VII;16s;54;;CDS;25;;atgj;13;I4;16s;196;;
;gca;114;;CDS;249;;* * * *21aas;13;;23s;144;;
;23s;193;I2;16s;196;;tta;5;;5s;228;;
;5s;5;;23s;78;;5s;213;;CDS;;;
;tta;9;;5s;402;;23s;196;;;;;
;atgi;123;;CDS;348;IV2;16s;239;;;;;
VIII;16s;54;I3;16s;196;;CDS;;;;;;
;gca;114;;23s;78;;;;;;;;
;23s;78;;5s;180;;;;;;;;
;5s;100;;CDS;;;;;;;;;
;CDS;;;;;;;;;;;;

psor distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;avant 5s;atgi;3;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;3 gga;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;aca ;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;1;;;;;;;;;;1-3 aas;ttc;3;tcc;;tac;3;tgc;2
atc;;acc;;aac;;agc;1;;atc;;acc;1;aac;1;agc;;;;;;;;;;;2 tta;atc;1;acc;;aac;4;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;2 atgi;ctc;;ccc;;cac;2;cgt;1
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;2
tta;;tca;;taa;;tga;1;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;3;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;2;aaa;2;aga;;;;;;;;;;;;ata;;aca;3;aaa;4;aga;4
cta;2;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;2;cca;4;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;;;;;;;;;;;;gta;5;gca;;gaa;4;gga;4
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;;;;;;;;;;atgj;3;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
psor;;5 *;;;;;5;;psor;12;;;;;;12;;;;;;;;;;;psor;;;4;72;;7;87
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4   1-3 aas;;;

psor données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: psor données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA contig;;tRNA tRNA;;CDS-CDS;;400-700;Sup 500;Sup 600
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;psor;frequence;effectif;;long;long
fxt;fct;psor;fx;fc;psor;fx40;fc40;psor;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;c;aa;psor;fx;fc;fx;fc
;0;0;1;23;0;1;23;-1;;52;3;41;CDS 16s;;16s 23s;;tRNA contig;;tRNA contig;suite;tRNA tRNA;hors bloc;400;629;2219;503;606
;1;10;8;223;1;1;40;-2;;0;162;138;205;348;8* 196;;13;tta;13;atgj;12;tgc;410;10;11;511;608
;0;20;16;347;2;0;52;-3;;0;195;37;309;264;194;;15;atgf;6;ttc;3;aac;420;2;9;524;616
;0;30;42;182;3;0;19;-4;1;23;71;306;249;364;137;;9;gaa;6;atc;**;aca;430;5;6;534;619
2;0;40;52;86;4;0;22;-5;;3;285;404;276;;23s 5s;;6;gga;31;cca;8;gta;440;4;4;538;619
1;0;50;45;48;5;1;15;-6;;0;111;37;431;;5* 78;;5;gta;11;tgg;20;gaa;450;1;6;544;630
;0;60;21;74;6;1;3;-7;;18;426;289;525;;122;;16;gac;6;atgi;10;aaa;460;3;5;570;632
;0;70;28;60;7;1;4;-8;;50;135;;253;;2* 193;;4;aac;6;cca;10;aca;470;7;5;584;647
;1;80;19;87;8;1;15;-9;;0;258;;189;;3* 144;;4;aca;11;agc;7;gac;480;0;6;587;653
;0;90;19;67;9;3;24;-10;;2;120;;276;;40;;15;tac;6;tca;9;gta;490;2;4;603;657
;0;100;9;76;10;0;29;-11;1;31;142;;253;;213;;14;cta;12;aaa;5;gaa;500;0;6;623;659
;0;110;18;75;11;2;44;-12;;0;129;;239;;16s tRNA;;7;aga;6;caa;**;aaa;510;1;1;643;684
;2;120;15;85;12;1;46;-13;;1;;;5s CDS;;4* 54;gca;11;caa;19;aga;;;520;1;5;643;688
;1;130;12;65;13;1;34;-14;;19;;;85;402;123;gca;6;aaa;11;gga;;;530;1;4;646;691
1;1;140;24;68;14;1;41;-15;;0;;;180;99;118;gca;3;tca;4;tac;;;540;2;3;679;698
;1;150;17;63;15;1;31;-16;;3;;;100;112;109;gca;9;ttc;4;aca;;;550;1;0;704;699
;0;160;27;59;16;1;30;-17;;7;;;109;40;tRNA 23s;;8;atgj;31;aac;;;560;0;2;707;711
;1;170;26;62;17;2;34;-18;;0;;;228;;4* 114;gca;21;atgi;16;aac;CDS-CDS;inf 50;570;1;3;713;725
;0;180;19;44;18;1;36;-19;;1;;;131;;152;gca;6;cca;5;gac;intercalaire;;580;0;1;723;733
;0;190;24;48;19;3;26;-20;;7;;;245;;95;gca;4;cac;6;gta;c-;x-;590;2;4;727;754
;1;200;22;36;20;3;25;-21;;0;;;;;109;gca;25;tgc;9;gga;-113;-52;600;0;4;796;769
;0;210;20;40;21;2;20;-22;;1;;;;;5s tRNA;;13;tta;15;gaa;total;intercalaires;;;;824;821
;0;220;13;35;22;1;19;-23;;2;;;;;4* 5;tta;15;atgf;13;atgf;;450,598;;;;827;840
;0;230;18;25;23;3;22;-24;;0;;;;;5;gaa;9;gaa;**;tta;ADN long;3,550,458;;;;942;858
;0;240;15;28;24;2;24;-25;;0;;;;;tRNA 5s;;6;gga;;;%;12.7;;;;998;859
;0;250;7;18;25;3;19;-26;;4;;;;;11;gga;5;gta;;;;;;;;1035;861
;1;260;13;24;26;6;16;-27;;0;;;;;2* 12;gga;16;gac;;;non RNA;49;;;;1088;872
;0;270;8;15;27;6;18;-28;;0;;;;;11;aca;4;aac;;;;;;;;1217;876
;0;280;7;22;28;6;14;-29;;3;;;;;tRNA 16s;;4;aca;;;;;;;;1350;888
1;1;290;9;14;29;4;10;-30;;0;;;;;2* 123;atgi;15;tac;;;;;;;;;888
;0;300;13;15;30;9;20;-31;;1;;;;;138;atgj;11;cta;;;;;;;;;937
1;0;310;3;19;31;4;14;-32;;1;;;;;23s tRNA;;13;ggc;;;;;;;;;940
;0;320;9;11;32;3;12;-33;;0;;;;;41;gga;7;aga;;;;;;;;;941
;0;330;6;14;33;5;8;-34;;0;;;;;50;gga;11;caa;;;;;;;;;997
;0;340;6;10;34;5;5;-35;;0;;;;;107;gga;6;aaa;;;;;;;;;1082
;0;350;4;9;35;7;13;-36;;0;;;;;116;aca;3;tca;;;;;;;;;1115
;0;360;4;10;36;5;8;-37;;0;;;;;tRNA tRNA;intra;9;ttc;;;;;;;;;1170
;0;370;6;8;37;5;2;-38;;0;;;;;2* 9;tta atgi;8;atgj;;;;;;;;;1283
;0;380;2;9;38;8;8;-39;;0;;;;;;;21;atgi;;;;;;;;;1310
;0;390;1;8;39;2;7;-40;;0;;;;;;;6;cca;;;;;;;;;1445
;0;400;2;7;40;8;9;-41;;1;;;;;;;9;cac;;;;;;;;;1537
1;1;reste;63;131;reste;574;1489;-42;;0;;;;;;;21;aaa;;;;;;;;;2038
7;12;total;693;2350;total;693;2350;-43;;0;;;;;;;6;tgc;;;;;;;;;
6;11;diagr;629;2196;diagr;118;838;-44;;0;;;;;;;10;cgt;;;;;;;;;
0;1; t30;66;752;;;;-45;;0;;;;;;;**;gta;;;;;;;;;
;;;;;;;;-46;;0;;;;;;;7;aga;;;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;;3;;;;;;;9;ggc;;;;;;;;;
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;5;gac;;;;;;;;;
;x;692;3;1;696;;;-49;;0;;;;;;;8;gta;;;;;;;;;
;c;2327;235;23;2585;;;-50;;1;;;;;;;**;gaa;;;;;;;;;
;;;;;3281;226;;reste;1;1;;;;;;;;;;;;;;;;;
;;;;;;3507;;total;3;235;;;;;;;;;;;;;;;;;

psor autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: psor autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;psor;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;aas
fin;;CDS;1;1332;;
deb;;CDS;9847;10620;205;
;;rRNA;10826;12332;196;1507
;;rRNA;12529;15445;78;2917
;;rRNA;15524;15640;85;117
fin;;CDS;15726;15947;;
deb;;CDS;18845;19297;3;
;;tRNA;19301;19393;27;tcc
;;ncRNA;19421;19685;152;
fin;;CDS;19838;21478;;
deb;;CDS;24343;24570;309;
;;rRNA;24880;26386;196;1507
;;rRNA;26583;29499;122;2917
;;rRNA;29622;29738;5;117
;;tRNA;29744;29832;13;tta
;;tRNA;29846;29921;15;atgf
;;tRNA;29937;30011;9;gaa
;;tRNA;30021;30094;6;gga
;;tRNA;30101;30176;5;gta
;;tRNA;30182;30258;16;gac
;;tRNA;30275;30350;4;aac
;;tRNA;30355;30429;4;aca
;;tRNA;30434;30518;15;tac
;;tRNA;30534;30617;14;cta
;;tRNA;30632;30708;7;aga
;;tRNA;30716;30791;11;caa
;;tRNA;30803;30878;6;aaa
;;tRNA;30885;30973;3;tca
;;tRNA;30977;31052;9;ttc
;;tRNA;31062;31138;8;atgj
;;tRNA;31147;31223;21;atgi
;;tRNA;31245;31321;6;cca
;;tRNA;31328;31404;4;cac
;;tRNA;31409;31482;25;tgc
;;tRNA;31508;31596;13;tta
;;tRNA;31610;31685;15;atgf
;;tRNA;31701;31775;9;gaa
;;tRNA;31785;31858;6;gga
;;tRNA;31865;31940;5;gta
;;tRNA;31946;32022;16;gac
;;tRNA;32039;32114;4;aac
;;tRNA;32119;32193;4;aca
;;tRNA;32198;32282;15;tac
;;tRNA;32298;32381;11;cta
;;tRNA;32393;32467;13;ggc
;;tRNA;32481;32557;7;aga
;;tRNA;32565;32640;11;caa
;;tRNA;32652;32727;6;aaa
;;tRNA;32734;32822;3;tca
;;tRNA;32826;32901;9;ttc
;;tRNA;32911;32987;8;atgj
;;tRNA;32996;33072;21;atgi
;;tRNA;33094;33170;6;cca
;;tRNA;33177;33253;9;cac
;;tRNA;33263;33338;21;aaa
;;tRNA;33360;33433;6;tgc
;;tRNA;33440;33516;10;cgt
;;tRNA;33527;33602;162;gta
fin;;CDS;33765;34016;;
deb;;CDS;34042;34455;249;
;;rRNA;34705;36211;196;1507
;;rRNA;36408;39324;78;2917
;;rRNA;39403;39519;402;117
deb;comp;CDS;39922;40113;348;
;;rRNA;40462;41968;196;1507
;;rRNA;42165;45081;78;2917
;;rRNA;45160;45276;180;117
fin;;CDS;45457;47394;;
deb;;CDS;101428;102144;276;
;;rRNA;102421;103927;54;1507
;;tRNA;103982;104057;114;gca
;;rRNA;104172;107096;41;2925
;;tRNA;107138;107211;11;gga
;;rRNA;107223;107339;99;117
fin;comp;CDS;107439;108617;;
deb;;CDS;111345;111884;431;
;;rRNA;112316;113822;54;1507
;;tRNA;113877;113952;114;gca
;;rRNA;114067;116982;193;2916
;;rRNA;117176;117292;5;117
;;tRNA;117298;117386;9;tta
;;tRNA;117396;117472;123;atgi
;;rRNA;117596;119102;54;1507
;;tRNA;119157;119232;114;gca
;;rRNA;119347;122263;193;2917
;;rRNA;122457;122573;5;117
;;tRNA;122579;122667;9;tta
;;tRNA;122677;122753;123;atgi
;;rRNA;122877;124383;54;1507
;;tRNA;124438;124513;114;gca
;;rRNA;124628;127549;78;2922
;;rRNA;127628;127744;100;117
fin;;CDS;127845;129260;;
deb;;CDS;157173;157352;467;
;;regulatory;157820;157903;46;
fin;;CDS;157950;158441;;
deb;comp;CDS;215388;216260;264;
;;rRNA;216525;218030;123;1506
;;tRNA;218154;218229;152;gca
;;rRNA;218382;221296;50;2915
;;tRNA;221347;221420;12;gga
;;rRNA;221433;221549;109;117
deb;;CDS;221659;221940;525;
;;rRNA;222466;223972;196;1507
;;rRNA;224169;227083;144;2915
;;rRNA;227228;227344;228;117
fin;;CDS;227573;227989;;
deb;;CDS;349139;349594;119;
;;tmRNA;349714;350063;508;
fin;;CDS;350572;351813;;
deb;;CDS;449964;450266;253;
;;rRNA;450520;452026;196;1507
;;rRNA;452223;455139;144;2917
;;rRNA;455284;455400;112;117
fin;comp;CDS;455513;456616;;
deb;;CDS;498418;499074;189;
;;rRNA;499264;500770;118;1507
;;tRNA;500889;500964;95;gca
;;rRNA;501060;503976;144;2917
;;rRNA;504121;504237;131;117
fin;;CDS;504369;504551;;
deb;;CDS;535194;536090;85;
;;ncRNA;536176;536362;27;
fin;comp;CDS;536390;537400;;
deb;;CDS;546886;550416;41;
;comp;tRNA;550458;550544;138;ttg
fin;;CDS;550683;553325;;
deb;;CDS;608009;608683;195;
;;tRNA;608879;608975;37;tga
fin;comp;CDS;609013;609732;;
deb;;CDS;664519;665208;281;
;;regulatory;665490;665566;155;
fin;;CDS;665722;667788;;
deb;;CDS;815939;816655;71;
;;tRNA;816727;816800;12;tgc
;;tRNA;816813;816888;3;aac
;;tRNA;816892;816966;285;aca
fin;;CDS;817252;818727;;
deb;;CDS;871627;872337;134;
;;regulatory;872472;872649;13;
fin;;CDS;872663;873685;;
deb;;CDS;982641;983897;103;
;;regulatory;984001;984104;104;
fin;;CDS;984209;985012;;
deb;;CDS;1284870;1288097;111;
;;tRNA;1288209;1288297;426;cta
fin;;CDS;1288724;1290853;;
deb;;CDS;1445161;1445664;135;
;;tRNA;1445800;1445868;258;other
fin;;CDS;1446127;1446813;;
deb;comp;CDS;2027435;2028427;53;
;comp;regulatory;2028481;2028580;345;
fin;;CDS;2028926;2029534;;
deb;comp;CDS;2147128;2147418;106;
;comp;regulatory;2147525;2147625;50;
fin;comp;CDS;2147676;2148425;;
deb;comp;CDS;2251779;2252747;98;
;comp;regulatory;2252846;2252890;465;
fin;;CDS;2253356;2254267;;
deb;;CDS;2267513;2267698;306;
;comp;tRNA;2268005;2268088;404;cta
fin;;CDS;2268493;2269758;;
deb;comp;CDS;2360030;2361127;237;
;comp;regulatory;2361365;2361480;190;
fin;comp;CDS;2361671;2362552;;
deb;comp;CDS;2523189;2523929;207;
;comp;regulatory;2524137;2524320;75;
fin;comp;CDS;2524396;2525256;;
deb;comp;CDS;2548808;2552788;57;
;comp;regulatory;2552846;2552929;39;
;comp;regulatory;2552969;2553052;39;
;comp;regulatory;2553092;2553175;39;
;comp;regulatory;2553215;2553298;63;
fin;comp;CDS;2553362;2554816;;
deb;comp;CDS;2701048;2701620;93;
;comp;regulatory;2701714;2701815;171;
fin;comp;CDS;2701987;2702790;;
deb;comp;CDS;2732519;2732845;274;
;comp;regulatory;2733120;2733211;363;
fin;comp;CDS;2733575;2735470;;
deb;comp;CDS;2850976;2851347;95;
;comp;regulatory;2851443;2851563;450;
fin;comp;CDS;2852014;2853708;;
deb;comp;CDS;3090637;3091464;131;
;comp;ncRNA;3091596;3091935;54;
fin;comp;CDS;3091990;3093003;;
deb;;CDS;3094098;3094784;40;
;comp;rRNA;3094825;3094941;78;117
;comp;rRNA;3095020;3097936;194;2917
;comp;rRNA;3098131;3099637;276;1507
fin;comp;CDS;3099914;3101161;;
deb;;CDS;3159922;3160827;37;
;comp;tRNA;3160865;3160956;120;agc
fin;comp;CDS;3161077;3161376;;
deb;comp;CDS;3274188;3274733;245;
;comp;rRNA;3274979;3275095;12;117
;comp;tRNA;3275108;3275181;107;gga
;comp;rRNA;3275289;3278214;137;2926
;comp;rRNA;3278352;3279858;253;1507
fin;comp;CDS;3280112;3280690;;
deb;comp;CDS;3299331;3300842;101;
;comp;regulatory;3300944;3301122;20;
fin;comp;CDS;3301143;3301745;;
deb;comp;CDS;3303104;3304150;124;
;comp;regulatory;3304275;3304459;96;
;comp;rRNA;3304556;3304672;11;117
;comp;tRNA;3304684;3304758;116;aca
;comp;rRNA;3304875;3307789;196;2915
;comp;rRNA;3307986;3309492;364;1507
fin;;CDS;3309857;3310504;;
deb;comp;CDS;3368437;3369900;236;
;comp;regulatory;3370137;3370238;63;
fin;comp;CDS;3370302;3370706;;
deb;comp;CDS;3407639;3408244;120;
;comp;regulatory;3408365;3408485;61;
fin;comp;CDS;3408547;3409716;;
deb;comp;CDS;3420136;3421329;134;
;comp;regulatory;3421464;3421568;139;
fin;;CDS;3421708;3422217;;
deb;comp;CDS;3438683;3439531;142;
;comp;tRNA;3439674;3439750;7;aga
;comp;tRNA;3439758;3439832;9;ggc
;comp;tRNA;3439842;3439918;5;gac
;comp;tRNA;3439924;3439999;8;gta
;comp;tRNA;3440008;3440082;5;gaa
;comp;rRNA;3440088;3440204;40;117
;comp;rRNA;3440245;3443168;112;2924
;comp;tRNA;3443281;3443356;109;gca
;comp;rRNA;3443466;3444972;138;1507
;comp;tRNA;3445111;3445187;13;atgj
;comp;tRNA;3445201;3445276;6;ttc
;comp;tRNA;3445283;3445359;6;atc
;comp;tRNA;3445366;3445442;31;cca
;comp;tRNA;3445474;3445549;11;tgg
;comp;tRNA;3445561;3445637;6;atgi
;comp;tRNA;3445644;3445720;6;cca
;comp;tRNA;3445727;3445817;11;agc
;comp;tRNA;3445829;3445917;6;tca
;comp;tRNA;3445924;3445999;12;aaa
;comp;tRNA;3446012;3446087;6;caa
;comp;tRNA;3446094;3446170;19;aga
;comp;tRNA;3446190;3446263;11;gga
;comp;tRNA;3446275;3446359;4;tac
;comp;tRNA;3446364;3446438;4;aca
;comp;tRNA;3446443;3446518;31;aac
;comp;tRNA;3446550;3446625;16;aac
;comp;tRNA;3446642;3446718;5;gac
;comp;tRNA;3446724;3446799;6;gta
;comp;tRNA;3446806;3446879;9;gga
;comp;tRNA;3446889;3446963;15;gaa
;comp;tRNA;3446979;3447054;13;atgf
;comp;tRNA;3447068;3447156;5;tta
;comp;rRNA;3447162;3447278;213;117
;comp;rRNA;3447492;3450406;196;2915
;comp;rRNA;3450603;3452109;239;1507
fin;comp;CDS;3452349;3452552;;
deb;comp;CDS;3479880;3480509;30;
;comp;regulatory;3480540;3480623;335;
fin;comp;CDS;3480959;3484165;;
deb;comp;CDS;3523330;3524046;129;
;comp;tRNA;3524176;3524251;8;gta
;comp;tRNA;3524260;3524334;20;gaa
;comp;tRNA;3524355;3524430;10;aaa
;comp;tRNA;3524441;3524515;10;aca
;comp;tRNA;3524526;3524602;7;gac
;comp;tRNA;3524610;3524685;9;gta
;comp;tRNA;3524695;3524769;5;gaa
;comp;tRNA;3524775;3524850;289;aaa
fin;;CDS;3525140;3526039;;
deb;comp;CDS;3549752;3549886;0;

cdc[modifier | modifier le wikicode]

cdc opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  10 ;83 aas;doubles;intercalaires;CDS;cds pbs;avec aa;cdsa;cdsd;protéines
Peptoclostridium difficile CD196;;;;;;;;;;;
dir    ;9857..10630;;cds;;179;179;774;;258;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;10810..12317;;16s;;52;;1508;;;;
dir    ;12370..12445;;gca;;249;;76;;;;
dir    ;12695..15596;;23s;;111;;2902;;;;
dir    ;15708..15824;;5s;;126;126;117;;;126;
dir    ;15951..16460;;cds;;;;510;;170;;transcription repressor NadR
;;;;;;;;;;;
dir   ;19402..19857;;cds;;0;0;456;;152;0;nucleoside deaminase
dir   ;19858..19949;;tcc;;37;;92;;;;
dir   ;19987..20251;;ncRNA;@1;76;76;265;;;;
dir   ;20328..21965;;cds;;;;1638;;546;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;23419..24624;;cds;;505;*505;1206;;402;;glycosyl transferase
dir    ;25130..26637;;16s;;279;;1508;;;;
dir    ;26917..29816;;23s;+;180;;2900;;;;
dir    ;29997..30113;;5s;3 aaa;6;;117;;;;
dir    ;30120..30194;;aac;3 gta;6;;75;6;;;
dir    ;30201..30286;;tta;;15;;86;15;;;
dir    ;30302..30377;;atgf;;7;;76;7;;;
dir    ;30385..30459;;gaa;;9;;75;9;;;
dir    ;30469..30542;;gga;;5;;74;5;;;
dir    ;30548..30623;;gta;;5;;76;5;;;
dir    ;30629..30705;;gac;;9;;77;9;;;
dir    ;30715..30789;;aca;;14;;75;14;;;
dir    ;30804..30888;;tac;;8;;85;8;;;
dir    ;30897..30980;;cta;;29;;84;29;;;
dir    ;31010..31086;;aga;;7;;77;7;;;
dir    ;31094..31169;;caa;;88;;76;88;;;
dir    ;31258..31346;;tca;;3;;89;3;;;
dir    ;31350..31425;;ttc;;6;;76;6;;;
dir    ;31432..31508;;atgj;;11;;77;11;;;
dir    ;31520..31596;;atgi;;23;;77;23;;;
dir    ;31620..31696;;cca;;7;;77;7;;;
dir    ;31704..31780;;cac;;8;;77;8;;;
dir    ;31789..31864;;aaa;;7;;76;7;;;
dir    ;31872..31945;;tgc;;6;;74;6;;;
dir    ;31952..32026;;aac;;5;;75;5;;;
dir    ;32032..32117;;tta;;15;;86;15;;;
dir    ;32133..32208;;atgf;;7;;76;7;;;
dir    ;32216..32290;;gaa;;9;;75;9;;;
dir    ;32300..32373;;gga;;5;;74;5;;;
dir    ;32379..32454;;gta;;5;;76;5;;;
dir    ;32460..32536;;gac;;9;;77;9;;;
dir    ;32546..32620;;aca;;14;;75;14;;;
dir    ;32635..32719;;tac;;9;;85;9;;;
dir    ;32729..32812;;cta;;23;;84;23;;;
dir    ;32836..32910;;ggc;;24;;75;24;;;
dir    ;32935..33011;;aga;;9;;77;9;;;
dir    ;33021..33096;;caa;;8;;76;8;;;
dir    ;33105..33180;;aaa;;2;;76;2;;;
dir    ;33183..33271;;tca;;3;;89;3;;;
dir    ;33275..33350;;ttc;;6;;76;6;;;
dir    ;33357..33433;;atgj;;11;;77;11;;;
dir    ;33445..33521;;atgi;;17;;77;17;;;
dir    ;33539..33615;;cac;;8;;77;8;;;
dir    ;33624..33699;;aaa;;7;;76;7;;;
dir    ;33707..33780;;tgc;;7;;74;7;;;
dir    ;33788..33864;;cgt;;12;;77;12;;;
dir    ;33877..33952;;gta;;75;75;76;;;75;
dir    ;34028..34441;;cds;;308;308;414;;138;;hp
dir    ;34750..38181;;cds;;;;3432;;1144;;pyruvate carboxylase
;;;;;;;;;;;
dir    ;127011..127715;;cds;;281;281;705;;235;;N-acetylmuramoyl-L-alanine amidase CwlD
dir    ;127997..129505;;16s;;279;;1509;;;;
dir    ;129785..132685;;23s;+;131;;2901;;;;
dir    ;132817..132933;;5s;2 cca;6;;117;;;;
dir    ;132940..133014;;aac;;4;;75;4;;;
dir    ;133019..133093;;gaa;;5;;75;5;;;
dir    ;133099..133174;;gta;;5;;76;5;;;
dir    ;133180..133256;;gac;;10;;77;10;;;
dir    ;133267..133341;;aca;;14;;75;14;;;
dir    ;133356..133440;;tac;;9;;85;9;;;
dir    ;133450..133523;;gga;;10;;74;10;;;
dir    ;133534..133610;;aga;;9;;77;9;;;
dir    ;133620..133695;;caa;;11;;76;11;;;
dir    ;133707..133782;;aaa;;2;;76;2;;;
dir    ;133785..133873;;tca;;17;;89;17;;;
dir    ;133891..133981;;agc;;8;;91;8;;;
dir    ;133990..134066;;cca;;85;;77;85;;;
dir    ;134152..134227;;tgg;;60;;76;60;;;
dir    ;134288..134364;;cca;;6;;77;6;;;
dir    ;134371..134447;;atc;;3;;77;3;;;
dir    ;134451..134526;;ttc;;7;;76;7;;;
dir    ;134534..134610;;atgj;;114;;77;;;;
dir    ;134725..136115;;16s;;68;;1391;;;;
dir    ;136184..136259;;gca;;271;;76;;;;
dir    ;136531..139430;;23s;;126;;2900;;;;
dir    ;139557..139673;;5s;;213;213;117;;;213;
comp;139887..141071;;cds;;372;*372;1185;;395;;pyridoxal phosphate-dependent aminotransferase
dir    ;141444..143795;;cds;;21;21;2352;;784;;anaerobic ribonucleoside triphosphate reductase
dir    ;143817..144356;;cds;;776;*776;540;;180;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;145133..146640;;16s;;52;;1508;;;;
dir    ;146693..146768;;gca;;373;;76;;;;
dir    ;147142..150041;;23s;;126;;2900;;;;
dir    ;150168..150284;;5s;;7;;117;7;;;
dir    ;150292..150366;;aac;;5;;75;5;;;
dir    ;150372..150457;;tta;;15;;86;15;;;
dir    ;150473..150548;;atgf;;7;;76;7;;;
dir    ;150556..150630;;gaa;;14;;75;14;;;
dir    ;150645..150718;;gga;;5;;74;5;;;
dir    ;150724..150799;;gta;;5;;76;5;;;
dir    ;150805..150881;;gac;;10;;77;10;;;
dir    ;150892..150966;;ggc;;9;;75;9;;;
dir    ;150976..151049;;aga;;975;*975;74;;;;
dir    ;152025..152864;;cds;;;;840;;280;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;378341..380728;;cds;;583;*583;2388;;796;;cadmium-translocating P-type ATPase
dir   ;381312..382819;;16s;;311;;1508;;;;
dir   ;383131..386030;;23s;;126;;2900;;;;
dir   ;386157..386273;;5s;;177;177;117;;;177;
dir   ;386451..387059;;cds;;;;609;;203;;DedA family protein
;;;;;;;;;;;
comp;833130..833894;;cds;;258;258;765;;255;;DeoR/GlpR transcriptional regulator
dir    ;834153..834243;;agc;;87;87;91;;;87;
dir    ;834331..835119;;cds;;;;789;;263;;flagellar motor protein
;;;;;;;;;;;
dir    ;1089165..1090139;;cds;;239;239;975;;325;239;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1090379..1091886;;16s;;320;;1508;;;;
dir    ;1092207..1095106;;23s;;91;;2900;;;;
dir    ;1095198..1095271;;gga;@2;8;;74;;;;
dir    ;1095280..1095396;;5s;;273;273;117;;;;
dir    ;1095670..1097688;;cds;;;;2019;;673;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1181549..1182958;;cds;;1374;*1374;1410;;470;;MBOAT family protein
comp;1184333..1184415;;ttg;;318;318;83;;;318;
dir    ;1184734..1187382;;cds;;;;2649;;883;;DNA polymerase I
;;;;;;;;;;;
dir   ;1835768..1837498;;cds;;109;109;1731;;577;109;Na+/H+ antiporter NhaC family protein
dir   ;1837608..1837688;;cta;;231;231;81;;;;
<dir   ;1837920..1838093;;cds;;;;174;;58;;HXXEE domain-containing protein
;;;;;;;;;;;
dir   ;2981767..2982444;;cds;;159;159;678;;226;159;sortase SrtB
comp;2982604..2982678;;aca;@3;94;;75;;;;
comp;2982773..2985672;;23s;;184;;2900;;;;
comp;2985857..2987364;;16s;;340;340;1508;;;;
dir   ;2987705..2988643;;cds;;;;939;;313;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
comp;3787361..3788431;;cds;;454;*454;1071;;357;;ABC transporter ATP-binding protein
comp;3788886..3789002;;5s;;126;;117;;;;
comp;3789129..3792028;;23s;;281;;2900;;;;
comp;3792310..3793817;;16s;;191;191;1508;;;191;
comp;3794009..3794587;;cds;;;;579;;193;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;3944262..3944453;;cds;;119;119;192;;64;119;DUF378 domain-containing protein
comp;3944573..3944689;;5s;;126;;117;;;;
comp;3944816..3947715;;23s;;217;;2900;;;;
comp;3947933..3949440;;16s;;282;282;1508;;;;
comp;3949723..3950004;;cds;;221;221;282;;94;;hp
comp;3950226..3951755;;cds;;;;1530;;510;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4084445..4085437;;cds;;382;*382;993;;331;;DNA replication protein DnaC
comp;4085820..4085894;;aca;;33;;75;;;;
comp;4085928..4086003;;gta;;4;;76;;;;
comp;4086008..4086082;;gaa;;6;;75;;;;
comp;4086089..4086164;;aaa;;326;326;76;;;326;
comp;4086491..4087780;;cds;;;;1290;;430;;adenylosuccinate synthase

cdc cumuls[modifier | modifier le wikicode]

cdc cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;;0;1;1;1;1;100;3
;16 23 5s 0;3;20;2;61;50;1;20;0;200;5
;16 gca 235;3;40;1;4;100;3;40;0;300;7
;16 23 5s a;2;60;;1;150;3;60;0;400;5
;max a;43;80;;0;200;4;80;1;500;3
;a doubles;2;100;;2;250;4;100;1;600;3
;autres;2;120;;0;300;4;120;2;700;1
;total aas;75;140;;0;350;4;140;1;800;2
sans ;opérons;5;160;;0;400;2;160;1;900;1
;1 aa;4;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;1;200;1;1100;0
;a doubles;0;;;0;;5;;4;;1
;total aas;8;;3;68;;32;;13;;31
total aas;;83;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;14;12;;313;;165;;378
;;;variance;;15;;283;;94;;259
sans jaune;;;moyenne;;9;;206;;;;286
;;;variance;;5;;107;;;;144

cdc blocs[modifier | modifier le wikicode]

7.11.19 Tanger;;;;;;;;;;;;;;
cdc blocs;groupes;;types;;;;absents;;;;;;;
;cds;281;I;;;;;II;;III;;IV;IV1;IV2
IV2;16s;279;;;;;;;;;;;;
;23s;131;CDS;583;454;119;;cds;239;;;;;
;5s;6;16s;311;126;126;;16s;320;cds;159;cds;505;281
;aac;4;23s;126;281;217;;23s;91;aca;94;16s;279;279
;**16aas;3;5s;177;191;282;;gga;8;23s;184;23s;180;131
;ttc;7;CDS;;;;;5s;273;16s;340;5s;6;6
;atgj;114;;;;;;cds;;cds;;aac;6;4
VIII1;16s;68;;;;;;;;;;;;
;gca;271;;;;;;V;;V2;VI;VI1;VII;VII1
;23s;126;;;;;;;;;;;;
;5s;213;;;;;;;;;;;;
;cds;372;;;;;;;;;;;;
;cds;21;;;;;;VIII;VIII1;IX;;X;X1;
;cds;776;;;;;;;;;;cds;21;
X1;16s;52;;;;;;atgj;114;cds;179;cds;776;
;gca;373;;;;;;16s;68;16s;52;16s;52;
;23s;126;;;;;;gca;271;gca;249;gca;373;
;5s;7;;;;;;23s;126;23s;111;23s;126;
;aac;5;;;;;;5s;213;5s;126;5s;7;
;**7aas;9;;;;;;cds;372;cds;;aac;5;
;aga;975;;;;;;;;;;;;
;cds;;;;;;;;;;;;;

cdc distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;avant 5s;atgi;2;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;gga 1;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;aca 1;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;;;;;;;;;;ttc;3;tcc;;tac;3;tgc;2
atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;;;;;;;;;;;;atc;1;acc;2;aac;2;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;1
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;2
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;3;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;;;;;;;;;;;;ata;;aca;3;aaa;4;aga;4
cta;1;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;2;cca;3;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;1;gga;;;;;;;;;;;;gta;5;gca;;gaa;4;gga;4
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;;;;;;;;;;atgj;3;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cdc;;4 *;;;;;4;;cdc;4;;;;;;4;;;;;;;;;;;cdc;;;2 *;70;;3;75

cdc données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cdc données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA contig;;tRNA tRNA;;CDS-CDS;;400-600;Sup 600;Sup 600;Sup 700
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;frequence;effectif;;long;long;long
fxt;fct;cdc;fx;fc;cdc;fx40;fc40;cdc;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;c;aa;cdc;fx;fc;fx;fc;fc
;1;0;0;37;0;0;37;-1;;59;0;258;CDS 16s;;16s 23s;;tRNA contig;;tRNA contig;suite;tRNA tRNA;hors bloc;400;515;2343;603;606;705
;0;10;3;242;1;0;52;-2;;0;75;318;181;507;2* 283;;6;aac;4;aac;33;aca;410;2;14;606;608;707
;0;20;0;311;2;0;55;-3;;1;975;159;283;342;315;;15;tta;5;gaa;4;gta;420;8;9;609;611;718
;0;30;0;210;3;1;21;-4;1;44;87;382;778;;324;;7;atgf;5;gta;6;gaa;430;4;11;625;611;721
;0;40;1;134;4;2;26;-5;;0;1374;;585;;188;;9;gaa;10;gac;**;aaa;440;5;10;638;611;722
;0;50;2;79;5;0;15;-6;;0;109;;241;;285;;5;gga;14;aca;;;450;6;5;649;613;724
;0;60;7;80;6;0;6;-7;;16;150;;193;;221;;5;gta;9;tac;;;460;2;11;651;618;727
;0;70;7;66;7;0;11;-8;;61;242;;284;;23s 5s;;9;gac;10;gga;;;470;9;10;655;619;741
;1;80;10;68;8;0;12;-9;;0;326;;5s CDS;;114;;14;aca;9;aga;;;480;7;8;657;622;743
;1;90;17;63;9;0;20;-10;;3;;;126;213;181;;8;tac;11;caa;;;490;3;11;658;625;744
;0;100;17;67;10;0;24;-11;;30;;;177;;132;;29;cta;2;aaa;;;500;4;8;675;628;753
;1;110;13;85;11;0;35;-12;;0;;;273;;5* 127;;7;aga;17;tca;CDS-CDS;inf 50;510;0;5;676;629;767
;0;120;25;74;12;0;45;-13;;7;;;454;;16s tRNA;;88;caa;8;agc;intercalaire;;520;1;10;677;630;770
;0;130;22;55;13;0;25;-14;;17;;;119;;3* 55;gca;3;tca;85;cca;c-;x-;530;2;8;679;630;790
;0;140;20;44;14;0;41;-15;;0;;;;;tRNA 23s;;6;ttc;60;tgg;-85;-52;540;1;4;686;631;796
;1;150;16;50;15;0;30;-16;;2;;;;;250;gca;14;atgj;6;cca;-83;;550;2;6;689;634;800
1;0;160;25;41;16;0;26;-17;;12;;;;;272;gca;23;atgi;3;atc;-71;;560;4;2;694;634;808
;0;170;23;34;17;0;35;-18;;0;;;;;374;gca;7;cca;7;ttc;-62;;570;1;6;702;634;816
;0;180;19;39;18;0;29;-19;;1;;;;;5s tRNA;;8;cac;**;atgj;-52;;580;4;3;722;636;817
;0;190;24;46;19;0;21;-20;;8;;;;;2* 6;aac;7;aaa;5;aac;total;intercalaires;590;5;2;723;636;817
;0;200;13;39;20;0;24;-21;;0;;;;;7;aac;6;tgc;15;tta;;636,447;600;6;4;730;636;820
;0;210;20;29;21;0;25;-22;;0;;;;;tRNA 5s;;5;aac;7;atgf;ADN long;4,110,554;;49;99;737;637;821
;0;220;27;40;22;0;18;-23;;5;;;;;8;gga;15;tta;14;gaa;%;15.5;;;;769;637;823
;0;230;16;32;23;0;24;-24;;1;;;;;tRNA 16s;;7;atgf;5;gga;;;;;;769;638;826
;0;240;8;27;24;0;22;-25;;1;;;;;116;atgj;9;gaa;5;gta;non RNA;156;;;;790;638;830
;1;250;12;28;25;0;22;-26;;5;;;;;23s tRNA;;5;gga;10;gac;;;;;;791;638;837
1;0;260;18;32;26;0;17;-27;;0;;;;;92;gga;5;gta;9;ggc;;;;;;792;638;885
;0;270;19;31;27;0;18;-28;;0;;;;;95;aca;9;gac;**;aga;;;;;;797;640;903
;0;280;16;22;28;0;23;-29;;6;;;;;;;14;aca;;;;;;;;798;644;905
;0;290;12;34;29;0;23;-30;;0;;;;;;;9;tac;;;;;;;;805;645;908
;0;300;14;24;30;0;18;-31;;0;;;;;;;23;cta;;;;;;;;805;645;922
;0;310;8;24;31;0;21;-32;;5;;;;;;;24;ggc;;;;;;;;821;647;924
1;0;320;14;24;32;0;17;-33;;0;;;;;;;9;aga;;;;;;;;850;647;940
;1;330;12;24;33;0;12;-34;;0;;;;;;;8;caa;;;;;;;;871;647;962
;0;340;13;17;34;0;12;-35;;1;;;;;;;2;aaa;;;;;;;;876;657;965
;0;350;6;15;35;0;18;-36;;0;;;;;;;3;tca;;;;;;;;877;659;968
;0;360;11;15;36;0;14;-37;;1;;;;;;;6;ttc;;;;;;;;882;660;973
;0;370;9;17;37;0;10;-38;;0;;;;;;;14;atgj;;;;;;;;885;664;976
;0;380;6;16;38;0;11;-39;;0;;;;;;;17;atgi;;;;;;;;910;667;992
1;0;390;7;16;39;0;10;-40;;1;;;;;;;8;cac;;;;;;;;924;677;1016
;0;400;3;12;40;1;9;-41;;0;;;;;;;7;aaa;;;;;;;;941;681;1021
;2;reste;125;246;reste;636;1655;-42;;0;;;;;;;7;tgc;;;;;;;;950;684;1023
4;9;total;640;2589;total;640;2589;-43;;0;;;;;;;12;cgt;;;;;;;;985;691;1048
4;6;diagr;515;2306;diagr;4;897;-44;;1;;;;;;;**;gta;;;;;;;;999;700;1063
0;0; t30;3;763;;;;-45;;0;;;;;;;;;;;;;;;;1060;;1093
;;;;;;;;-46;;0;;;;;;;;;;;;;;;;1100;;1119
;;Récapitulatif des effectifs;;;;;;-47;;3;;;;;;;;;;;;;;;;1100;;1133
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;;;;;;;;1127;;1171
;x;640;2;0;642;;;-49;;0;;;;;;;;;;;;;;;;1208;;1192
;c;2552;296;37;2885;;;-50;;0;;;;;;;;;;;;;;;;;;1295
;;;;;3527;282;;reste;1;5;;;;;;;;;;;;;;;;;;1324
;;;;;;3809;;total;2;296;;;;;;;;;;;;;;;;;;1346
;;;;;;;;;;;;;;;;;;;;;;;;;;;;1412
;;;;;;;;;;;;;;;;;;;;;;;;;;;;1588
;;;;;;;;;;;;;;;;;;;;;;;;;;;;1907

cdc autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cdc autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cdc;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;9857;10630;181;*;
;;rRNA;10812;12314;55;*;1503
;;tRNA;12370;12445;250;*;gca
;;rRNA;12696;15593;114;*;2898
;;rRNA;15708;15824;126;*;117
fin;;CDS;15951;16460;;;
deb;;CDS;16472;17353;126;*;
;;misc_b;17480;17686;124;*;
fin;;CDS;17811;19082;;;
deb;;CDS;19402;19857;0;*;
;;tRNA;19858;19949;37;*;tcc
;;ncRNA;19987;20251;76;*;
fin;;CDS;20328;21965;;;
deb;comp;CDS;23419;24624;507;*;
;;rRNA;25132;26634;283;*;1503
;;rRNA;26918;29815;181;*;2898
;;rRNA;29997;30113;6;*;117
;;tRNA;30120;30194;6;*;aac
;;tRNA;30201;30286;15;*;tta
;;tRNA;30302;30377;7;*;atgf
;;tRNA;30385;30459;9;*;gaa
;;tRNA;30469;30542;5;*;gga
;;tRNA;30548;30623;5;*;gta
;;tRNA;30629;30705;9;*;gac
;;tRNA;30715;30789;14;*;aca
;;tRNA;30804;30888;8;*;tac
;;tRNA;30897;30980;29;*;cta
;;tRNA;31010;31086;7;*;aga
;;tRNA;31094;31169;88;*;caa
;;tRNA;31258;31346;3;*;tca
;;tRNA;31350;31425;6;*;ttc
;;tRNA;31432;31505;14;*;atgj
;;tRNA;31520;31596;23;*;atgi
;;tRNA;31620;31696;7;*;cca
;;tRNA;31704;31780;8;*;cac
;;tRNA;31789;31864;7;*;aaa
;;tRNA;31872;31945;6;*;tgc
;;tRNA;31952;32026;5;*;aac
;;tRNA;32032;32117;15;*;tta
;;tRNA;32133;32208;7;*;atgf
;;tRNA;32216;32290;9;*;gaa
;;tRNA;32300;32373;5;*;gga
;;tRNA;32379;32454;5;*;gta
;;tRNA;32460;32536;9;*;gac
;;tRNA;32546;32620;14;*;aca
;;tRNA;32635;32719;9;*;tac
;;tRNA;32729;32812;23;*;cta
;;tRNA;32836;32910;24;*;ggc
;;tRNA;32935;33011;9;*;aga
;;tRNA;33021;33096;8;*;caa
;;tRNA;33105;33180;2;*;aaa
;;tRNA;33183;33271;3;*;tca
;;tRNA;33275;33350;6;*;ttc
;;tRNA;33357;33430;14;*;atgj
;;tRNA;33445;33521;17;*;atgi
;;tRNA;33539;33615;8;*;cac
;;tRNA;33624;33699;7;*;aaa
;;tRNA;33707;33780;7;*;tgc
;;tRNA;33788;33864;12;*;cgt
;;tRNA;33877;33952;75;*;gta
fin;;CDS;34028;34441;;;
deb;;CDS;72345;72830;94;*;
;;misc_b;72925;73133;63;*;
fin;;CDS;73197;74912;;;
deb;;CDS;90506;91204;51;*;
;;misc_f;91256;91384;42;*;
fin;;CDS;91427;91933;;;
deb;;CDS;127011;127715;283;*;
;;rRNA;127999;129502;283;*;1504
;;rRNA;129786;132684;132;*;2899
;;rRNA;132817;132933;6;*;117
;;tRNA;132940;133014;4;*;aac
;;tRNA;133019;133093;5;*;gaa
;;tRNA;133099;133174;5;*;gta
;;tRNA;133180;133256;10;*;gac
;;tRNA;133267;133341;14;*;aca
;;tRNA;133356;133440;9;*;tac
;;tRNA;133450;133523;10;*;gga
;;tRNA;133534;133610;9;*;aga
;;tRNA;133620;133695;11;*;caa
;;tRNA;133707;133782;2;*;aaa
;;tRNA;133785;133873;17;*;tca
;;tRNA;133891;133981;8;*;agc
;;tRNA;133990;134066;85;*;cca
;;tRNA;134152;134227;60;*;tgg
;;tRNA;134288;134364;6;*;cca
;;tRNA;134371;134447;3;*;atc
;;tRNA;134451;134526;7;*;ttc
;;tRNA;134534;134610;116;*;atgj
;;rRNA;134727;136128;55;*;1402
;;tRNA;136184;136259;272;*;gca
;;rRNA;136532;139429;127;*;2898
;;rRNA;139557;139673;213;*;117
fin;comp;CDS;139887;141071;;0;
deb;;CDS;143817;144356;778;*;
;;rRNA;145135;146637;55;*;1503
;;tRNA;146693;146768;374;*;gca
;;rRNA;147143;150040;127;*;2898
;;rRNA;150168;150284;7;*;117
;;tRNA;150292;150366;5;*;aac
;;tRNA;150372;150457;15;*;tta
;;tRNA;150473;150548;7;*;atgf
;;tRNA;150556;150630;14;*;gaa
;;tRNA;150645;150718;5;*;gga
;;tRNA;150724;150799;5;*;gta
;;tRNA;150805;150881;10;*;gac
;;tRNA;150892;150966;9;*;ggc
;;tRNA;150976;151049;975;*;aga
fin;;CDS;152025;152864;;;
deb;comp;CDS;171557;172066;188;*;
;;regulatory;172255;172358;136;*;
fin;;CDS;172495;173688;;;
deb;;CDS;193614;194780;59;*;
;;regulatory;194840;194957;124;*;
fin;;CDS;195082;195687;;;
deb;;CDS;253195;254327;59;*;
;;regulatory;254387;254488;220;*;
fin;;CDS;254709;256244;;;
deb;;CDS;309184;310275;308;*;
;;regulatory;310584;310674;406;*;
fin;;CDS;311081;311398;;;
deb;;CDS;378341;380728;585;*;
;;rRNA;381314;382816;315;*;1503
;;rRNA;383132;386029;127;*;2898
;;rRNA;386157;386273;177;*;117
fin;;CDS;386451;387059;;0;
deb;;CDS;393173;394945;131;*;
;;regulatory;395077;395269;188;*;
fin;;CDS;395458;396210;;;
deb;comp;CDS;518815;519642;205;*;
;;regulatory;519848;519954;69;*;
fin;;CDS;520024;520344;;0;
deb;;CDS;601016;601618;560;*;
;;misc_b;602179;602417;63;*;
fin;;CDS;602481;604400;;;
deb;;CDS;703255;703989;800;*;
;;regulatory;704790;704866;264;*;
fin;;CDS;705131;706387;;;
deb;;CDS;774245;775042;343;*;
;;misc_b;775386;775620;49;*;
fin;;CDS;775670;776689;;;
deb;comp;CDS;833130;833894;258;*;
;;tRNA;834153;834243;87;*;agc
fin;;CDS;834331;835119;;;
deb;;CDS;840990;843056;591;*;
;;misc_b;843648;843858;225;*;
fin;;CDS;844084;844899;;;
deb;;CDS;1027707;1028153;147;*;
;;misc_b;1028301;1028547;123;*;
fin;;CDS;1028671;1030413;;;
deb;;CDS;1089165;1090139;241;*;
;;rRNA;1090381;1091883;324;*;1503
;;rRNA;1092208;1095105;92;*;2898
;;tRNA;1095198;1095271;8;*;gga
;;rRNA;1095280;1095396;273;*;117
fin;;CDS;1095670;1097688;;;
deb;;CDS;1140023;1140928;114;*;
;;ncRNA;1141043;1141223;182;*;
fin;;CDS;1141406;1142623;;0;
deb;comp;CDS;1181549;1182958;1374;*;
;comp;tRNA;1184333;1184415;318;*;ttg
fin;;CDS;1184734;1187382;;;
deb;;CDS;1221766;1222134;91;*;
;;regulatory;1222226;1222332;102;*;
fin;;CDS;1222435;1223640;;0;
deb;;CDS;1292920;1293819;907;*;
;;repeat_region;1294727;1295680;1216;*;
fin;;CDS;1296897;1297052;;;
deb;;CDS;1347580;1348659;142;*;
;;misc_b;1348802;1349040;67;*;
fin;;CDS;1349108;1351747;;;
deb;;CDS;1503182;1503538;530;*;
;;repeat_region;1504069;1504755;391;*;
fin;comp;CDS;1505147;1506880;;;
deb;comp;CDS;1512381;1512557;53;*;
;comp;regulatory;1512611;1512707;354;*;
fin;comp;CDS;1513062;1513736;;;
deb;;CDS;1583597;1584714;449;*;
;;regulatory;1585164;1585270;105;*;
fin;;CDS;1585376;1586341;;;
deb;;CDS;1612685;1614778;660;*;
;;repeat_region;1615439;1615732;167;*;
fin;comp;CDS;1615900;1616184;;0;
deb;;CDS;1620655;1621623;151;*;
;;misc_b;1621775;1622027;71;*;
fin;;CDS;1622099;1623307;;0;
deb;;CDS;1668527;1669288;160;*;
;;misc_b;1669449;1669706;112;*;
fin;;CDS;1669819;1670058;;;
deb;;CDS;1708973;1709134;741;*;
;;repeat_region;1709876;1710232;238;*;
fin;;CDS;1710471;1710659;;;
deb;;CDS;1710778;1711644;452;*;
;;repeat_region;1712097;1712386;122;*;
fin;;CDS;1712509;1713036;;;
deb;;CDS;1745654;1747510;82;*;
;;misc_b;1747593;1747833;65;*;
;;misc_b;1747899;1748134;84;*;
fin;;CDS;1748219;1749436;;;
deb;;CDS;1770800;1771111;92;*;
;;regulatory;1771204;1771296;99;*;
fin;;CDS;1771396;1772190;;;
deb;comp;CDS;1833191;1833988;112;*;
;comp;regulatory;1834101;1834206;91;*;
deb;comp;CDS;1834298;1835284;163;*;
;;regulatory;1835448;1835624;143;*;
deb;;CDS;1835768;1837498;109;*;
;;tRNA;1837608;1837688;896;*;cta
;;regulatory;1838585;1838689;209;*;
fin;;CDS;1838899;1839933;;;
deb;comp;CDS;1847745;1849016;646;*;
;;repeat_region;1849663;1850878;408;*;
fin;;CDS;1851287;1851574;;0;
deb;comp;CDS;1869839;1870468;364;*;
;;regulatory;1870833;1870876;100;*;
fin;;CDS;1870977;1871945;;;
deb;comp;CDS;1886422;1887495;161;*;
;comp;regulatory;1887657;1887778;188;*;
deb;;CDS;1887967;1890450;87;*;
;;regulatory;1890538;1890649;141;*;
fin;;CDS;1890791;1892092;;;
deb;;CDS;1903300;1903731;430;*;
;;misc_b;1904162;1904373;162;*;
fin;;CDS;1904536;1905825;;;
deb;;CDS;1963260;1964567;85;*;
;;misc_b;1964653;1964915;125;*;
fin;;CDS;1965041;1965844;;;
deb;;CDS;1974995;1975732;110;*;
;;misc_b;1975843;1976050;252;*;
fin;;CDS;1976303;1977502;;;
deb;;CDS;2015338;2017995;53;*;
;;regulatory;2018049;2018151;109;*;
fin;;CDS;2018261;2019526;;;
deb;comp;CDS;2142818;2143108;130;*;
;comp;regulatory;2143239;2143338;619;*;
;;regulatory;2143958;2144047;52;*;
fin;;CDS;2144100;2144276;;0;
deb;comp;CDS;2153631;2154182;150;*;
;comp;misc_b;2154333;2154596;435;*;
fin;comp;CDS;2155032;2155430;;;
deb;comp;CDS;2155785;2156270;82;*;
;comp;regulatory;2156353;2156446;556;*;
deb;comp;CDS;2157003;2157185;226;*;
;;regulatory;2157412;2157509;54;*;
fin;;CDS;2157564;2157740;;;
deb;comp;CDS;2192160;2193194;253;*;
;comp;misc_b;2193448;2193661;222;*;
fin;comp;CDS;2193884;2194648;;0;
deb;comp;CDS;2199791;2200075;110;*;
;;repeat_region;2200186;2200869;830;*;
fin;comp;CDS;2201700;2202572;;;
deb;comp;CDS;2207935;2209128;81;*;
;comp;regulatory;2209210;2209378;110;*;
fin;comp;CDS;2209489;2210106;;;
deb;comp;CDS;2274866;2276242;93;*;
;comp;regulatory;2276336;2276438;249;*;
fin;;CDS;2276688;2278034;;;
deb;comp;CDS;2289838;2290746;801;*;
;;misc_b;2291548;2291779;107;*;
fin;;CDS;2291887;2293368;;;
deb;comp;CDS;2432824;2434221;76;*;
;comp;misc_b;2434298;2434531;168;*;
fin;comp;CDS;2434700;2434903;;;
deb;comp;CDS;2473840;2475960;427;*;
;;regulatory;2476388;2476476;189;*;
fin;;CDS;2476666;2478033;;0;
deb;comp;CDS;2501260;2501931;184;*;
;;regulatory;2502116;2502205;53;*;
fin;;CDS;2502259;2502435;;;
deb;comp;CDS;2524251;2524823;182;*;
;comp;regulatory;2525006;2525107;105;*;
fin;comp;CDS;2525213;2526364;;;
deb;comp;CDS;2555495;2555866;103;*;
;comp;regulatory;2555970;2556080;331;*;
fin;comp;CDS;2556412;2558106;;0;
deb;comp;CDS;2595509;2596213;63;*;
;comp;regulatory;2596277;2596371;195;*;
fin;comp;CDS;2596567;2597583;;;
deb;comp;CDS;2695506;2696213;150;*;
;comp;tRNA;2696364;2696460;242;*;tga
fin;comp;CDS;2696703;2697542;;;
deb;comp;CDS;2719492;2720808;86;*;
;comp;misc_b;2720895;2721106;78;*;
fin;comp;CDS;2721185;2721980;;0;
deb;comp;CDS;2845118;2845816;42;*;
;comp;misc_b;2845859;2846099;90;*;
fin;comp;CDS;2846190;2847593;;0;
deb;comp;CDS;2854480;2857587;92;*;
;comp;misc_b;2857680;2857912;174;*;
fin;comp;CDS;2858087;2858614;;;
deb;comp;CDS;2947183;2948184;58;*;
;comp;misc_b;2948243;2948498;133;*;
fin;comp;CDS;2948632;2949822;;;
deb;comp;CDS;2957885;2958538;329;*;
;;regulatory;2958868;2958969;72;*;
fin;;CDS;2959042;2960385;;;
deb;comp;CDS;2978480;2981023;277;*;
;comp;ncRNA;2981301;2981635;131;*;
deb;;CDS;2981767;2982444;159;*;
;comp;tRNA;2982604;2982678;95;*;aca
;comp;rRNA;2982774;2985671;188;*;2898
;comp;rRNA;2985860;2987362;342;*;1503
fin;;CDS;2987705;2988643;;0;
deb;comp;CDS;3090012;3095975;123;*;
;comp;regulatory;3096099;3096184;171;*;
fin;comp;CDS;3096356;3097759;;;
deb;comp;CDS;3135811;3136473;99;*;
;comp;regulatory;3136573;3136658;185;*;
deb;comp;CDS;3136844;3139798;112;*;
;comp;regulatory;3139911;3139996;125;*;
fin;comp;CDS;3140122;3141300;;0;
deb;comp;CDS;3244007;3244435;189;*;
;;repeat_region;3244625;3246042;183;*;
fin;comp;CDS;3246226;3246492;;;
deb;comp;CDS;3274824;3275954;227;*;
;comp;regulatory;3276182;3276363;52;*;
fin;comp;CDS;3276416;3277309;;;
deb;comp;CDS;3405889;3407280;143;*;
;comp;regulatory;3407424;3407603;271;*;
fin;comp;CDS;3407875;3409527;;;
deb;comp;CDS;3489429;3490850;579;*;
;;repeat_region;3491430;3492052;252;*;
fin;comp;CDS;3492305;3494290;;;
deb;;CDS;3508604;3509509;673;*;
;comp;tmRNA;3510183;3510532;157;*;
fin;comp;CDS;3510690;3511145;;0;
deb;;CDS;3600566;3601447;77;*;
;;regulatory;3601525;3601699;172;*;
fin;;CDS;3601872;3602873;;;
deb;comp;CDS;3636881;3639547;75;*;
;comp;misc_b;3639623;3639885;300;*;
fin;comp;CDS;3640186;3641013;;;
deb;comp;CDS;3654516;3655193;579;*;
;comp;regulatory;3655773;3655856;232;*;
fin;comp;CDS;3656089;3656931;;;
deb;comp;CDS;3689422;3690501;287;*;
;;regulatory;3690789;3690904;174;*;
fin;;CDS;3691079;3692449;;0;
deb;comp;CDS;3749041;3749442;795;*;
;;regulatory;3750238;3750334;53;*;
fin;;CDS;3750388;3750564;;;
deb;comp;CDS;3787361;3788431;454;*;
;comp;rRNA;3788886;3789002;127;*;117
;comp;rRNA;3789130;3792027;285;*;2898
;comp;rRNA;3792313;3793815;193;*;1503
fin;comp;CDS;3794009;3794587;;;
deb;comp;CDS;3810367;3811866;129;*;
;comp;regulatory;3811996;3812175;66;*;
fin;comp;CDS;3812242;3812856;;;
deb;comp;CDS;3905129;3905650;161;*;
;comp;regulatory;3905812;3905897;839;*;
fin;comp;CDS;3906737;3907687;;;
deb;comp;CDS;3931996;3933933;83;*;
;comp;misc_b;3934017;3934263;65;*;
fin;comp;CDS;3934329;3934850;;;
deb;comp;CDS;3944262;3944453;119;*;
;comp;rRNA;3944573;3944689;127;*;117
;comp;rRNA;3944817;3947714;221;*;2898
;comp;rRNA;3947936;3949438;284;*;1503
fin;comp;CDS;3949723;3949917;;;
deb;;CDS;4084445;4085437;382;*;
;comp;tRNA;4085820;4085894;33;*;aca
;comp;tRNA;4085928;4086003;4;*;gta
;comp;tRNA;4086008;4086082;6;*;gaa
;comp;tRNA;4086089;4086164;326;*;aaa
fin;comp;CDS;4086491;4087780;;;

cdc psor[modifier | modifier le wikicode]

cdc-psor  comparaison;;7.11.19 Tanger;;;comparaisons internes cdc, psor;;;;
cdc;intercal;psor;intercal;diff;cdc;intercal;cdc;intercal;diff
cds;505;CDS;309;;cds;505;cds;281;
16s;279;16s;196;;16s;279;16s;279;
23s;180;23s;122;;23s;180;23s;131;
5s;6;5s;5;;5s;6;5s;6;
aac;6;tta;13;;aac;6;aac;4;
tta;15;atg;15;-2;tta;15;gaa;5;
atgf;7;gaa;9;8;atgf;7;gta;5;
gaa;9;gga;6;0;gaa;9;gac;10;
gga;5;gta;5;1;gga;5;aca;14;
gta;5;gac;16;;gta;5;tac;9;0
gac;9;aac;4;;gac;9;gga;10;1
aca;14;aca;4;-10;aca;14;aga;9;0
tac;8;tac;15;7;tac;8;caa;11;
cta;29;cta;14;-15;cta;29;aaa;2;
aga;7;aga;7;0;aga;7;tca;17;2
caa;88;caa;11;;caa;88;agc;8;
tca;3;aaa;6;;tca;3;cca;85;
ttc;6;tca;3;0;ttc;6;tgg;60;
atgj;11;ttc;9;3;atgj;11;cca;6;
atgi;23;atg;8;-3;atgi;23;atc;3;
cca;7;atg;21;-2;cca;7;ttc;7;
cac;8;cca;6;-1;cac;8;atgj;114;
aaa;7;cac;4;;aaa;7;16s;;
tgc;6;tgc;25;;tgc;6;cds;776;
aac;5;tta;13;-2;aac;5;16s;52;
tta;15;atg;15;8;tta;15;gca;373;
atgf;7;gaa;9;0;atgf;7;23s;126;
gaa;9;gga;6;1;gaa;9;5s;7;
gga;5;gta;5;0;gga;5;aac;5;
gta;5;gac;16;;gta;5;tta;15;0
gac;9;aac;4;;gac;9;atgf;7;1
aca;14;aca;4;-10;aca;14;gaa;14;0
tac;9;tac;15;6;tac;9;gga;5;
cta;23;cta;11;-12;cta;23;gta;5;
ggc;24;ggc;13;-11;ggc;24;gac;10;
aga;9;aga;7;-2;aga;9;ggc;9;0
caa;8;caa;11;3;caa;8;aga;975;3
aaa;2;aaa;6;4;aaa;2;cds;;0
tca;3;tca;3;0;tca;3;;;
ttc;6;ttc;9;3;ttc;6;;;
atgj;11;atg;8;-3;atgj;11;;;
atgi;17;atg;21;;atgi;17;;;
cac;8;cca;6;;cac;8;;;
aaa;7;cac;9;1;aaa;7;;;
tgc;7;aaa;21;14;tgc;7;;;
cgt;12;tgc;6;-1;cgt;12;;;
gta;75;cgt;10;-2;gta;75;;;
cds;;gta;162;;cds;;;;
;;CDS;;;;;;;
;;;;;psor;;psor;intercal;diff
cds;776;;;;CDS;309;CDS;239;
16s;52;;;;16s;196;16s;196;
gca;373;;;;23s;122;23s;213;
23s;126;;;;5s;5;5s;5;
5s;7;atg;138;;tta;13;tta;13;0
aac;5;16s;109;;atg;15;atg;15;0
tta;15;gca;112;;gaa;9;gaa;9;0
atgf;7;23s;40;;gga;6;gga;6;0
gaa;14;5s;5;;gta;5;gta;5;0
gga;5;gaa;8;;gac;16;gac;16;0
gta;5;gta;5;0;aac;4;aac;31;
gac;10;gac;9;-1;aca;4;aac;4;
ggc;9;ggc;7;-2;tac;15;aca;4;0
aga;975;aga;142;;cta;14;tac;11;-4
cds;;CDS;;;aga;7;gga;19;5
;;;;;caa;11;aga;6;-1
cds;281;CDS;239;;aaa;6;caa;12;1
16s;279;16s;196;;tca;3;aaa;6;0
23s;131;23s;213;;ttc;9;tca;11;
5s;6;5s;5;;atg;8;agc;6;
aac;4;tta;13;;atg;21;cca;6;
gaa;5;atg;15;;cca;6;atg;11;
gta;5;gaa;9;;cac;4;tgg;31;
gac;10;gga;6;;tgc;25;cca;6;
aca;14;gta;5;;tta;13;atc;6;0
tac;9;gac;16;;atg;15;ttc;13;0
gga;10;aac;31;;gaa;9;atg;138;0
aga;9;aac;4;;gga;6;16s;;0
caa;11;aca;4;-10;gta;5;atg;138;0
aaa;2;tac;11;2;gac;16;16s;109;0
tca;17;gga;19;9;aac;4;gca;112;
agc;8;aga;6;-3;aca;4;23s;40;0
cca;85;caa;12;1;tac;15;5s;5;
tgg;60;aaa;6;4;cta;11;gaa;8;
cca;6;tca;11;-6;ggc;13;gta;5;
atc;3;agc;6;-2;aga;7;gac;9;-1
ttc;7;cca;6;;caa;11;ggc;7;1
atgj;114;atg;11;;aaa;6;aga;142;0
16s;;tgg;31;-29;tca;3;CDS;;
;;cca;6;0;ttc;9;;;
;;atc;6;3;atg;8;;;
;;ttc;13;6;atg;21;;;
;;atg;138;;cca;6;;;
;;16s;;;cac;9;;;
;;;;;aaa;21;;;
;;CDS;129;;tgc;6;;;
;;gta;8;;cgt;10;;;
;;gaa;20;;gta;162;;;
;;aaa;10;;CDS;;;;
cds;382;aca;10;;;;;;
aca;33;gac;7;;;;;;
gta;4;gta;9;5;;;;;
gaa;6;gaa;5;-1;;;;;
aaa;326;aaa;289;;;;;;
cds;;CDS;;;;;;;
;;;;;;;;;
cdc-psor  coservation des cds;;;;;fréquence des diff psor-cdc des intercalaires;;;;
cdc;intercal;psor;intercal;protéines;;gamme;fréquence;;
cds;0;CDS;3;151 – 152;;-15;2;;
tcc;37;tcc;27;;;-14;;;
ncRNA;76;ncRNA;152;547 – 546;;-13;;;
cds;;CDS;;;;-12;1;;
;;;;;;-11;1;;
cds;1374;CDS;41;470 – 1177;;-10;3;;
ttg;318;ttg;138;883 – 881;;-9;;;
cds;;CDS;;;;-8;;;
;;;;;;-7;;;
cds;109;CDS;111;577 – 1076;;-6;1;;
cta;231;cta;426;;;-5;;;
cds;;CDS;;58 – 577;;-4;;;
;;;;;;-3;3;;
cds;258;CDS;37;255 – 302;;-2;7;;
agc;87;agc;120;;;-1;4;;
cds;;CDS;;263 – 100;;0;8;;
;;;;;;1;4;;
;;CDS;306;62;;2;1;;
;;cta;404;422;;3;4;;
;;CDS;;;;4;2;;
;;;;;;5;1;;
;;CDS;135;;;6;2;;
;;other;258;;;7;1;;
;;CDS;;;;8;2;;
;;;;;;9;1;;
;;CDS;195;;;10;;;
;;tga;37;;;11;;;
;;CDS;;;;12;;;
;;;;;;13;;;
;;CDS;71;;;14;1;;
;;tgc;12;;;15;;;
;;aac;3;;;;;;
;;aca;285;;;total;49;;
;;CDS;;;;sous t.  -2+2;24;;

cdc8[modifier | modifier le wikicode]

cdc8 opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  16 ;110 aas;doubles;intercalaires;CDS;aa;avec aa;pbs;CDS dirigé;protéines
Peptoclostridium difficile M68;;;;;;;;;;;
dir   ;4299490..4300134;;cds;;214;214;;;645;;tyrosine-type recombinase/integrase
dir   ;4300349..4300807;;cds;@1;554;*554;;;459;;helix-turn-helix domain-containing protein
dir   ;4301362..4303101;;cds;;0;0;;;*1740;;hypothetical protein
dir   ;4303102..4303305;;cds;;167;167;;;204;;hp
dir   ;4303473..4304299;;23s°;;132;;;;827;;
dir   ;4304432..4304548;;5s;+;6;;;;117;;
dir   ;4304555..4304629;;aac;;4;;;4;75;;
dir   ;4304634..4304708;;gaa;2 cca;5;;;5;75;;
dir   ;4304714..4304789;;gta;;5;;;5;76;;
dir   ;4304795..4304871;;gac;;11;;;11;77;;
dir   ;4304883..4304957;;aca;;14;;;14;75;;
dir   ;4304972..4305056;;tac;;9;;;9;85;;
dir   ;4305066..4305139;;gga;;10;;;10;74;;
dir   ;4305150..4305226;;aga;;9;;;9;77;;
dir   ;4305236..4305311;;caa;;11;;;11;76;;
dir   ;4305323..4305398;;aaa;;2;;;2;76;;
dir   ;4305401..4305489;;tca;;18;;;18;89;;
dir   ;4305508..4305598;;agc;;8;;;8;91;;
dir   ;4305607..4305683;;cca;;85;;;*85;77;;
dir   ;4305769..4305844;;tgg;;60;;;*60;76;;
dir   ;4305905..4305981;;cca;;5;;;5;77;;
dir   ;4305987..4306063;;atc;;3;;;3;77;;
dir   ;4306067..4306142;;ttc;;7;;;7;76;;
dir   ;4306150..4306226;;atgj;;114;;;;77;;
dir   ;4306341..4307538;;16s;;0;0;;;1198;0;
dir   ;4307539..4308225;;cds;;100;100;;;687;;xylose isomerase
dir   ;1..796;4308325;23s°;;181;;;;796;;
dir   ;978..1094;;5s;;6;;;;117;;
dir   ;1101..1175;;aac;+;6;;;6;75;;
dir   ;1182..1267;;tta;3 aaa;15;;;15;86;;
dir   ;1283..1358;;atgf;3 gta;7;;;7;76;;
dir   ;1366..1440;;gaa;;9;;;9;75;;
dir   ;1450..1523;;gga;;5;;;5;74;;
dir   ;1529..1604;;gta;;5;;;5;76;;
dir   ;1610..1686;;gac;;9;;;9;77;;
dir   ;1696..1770;;aca;;14;;;14;75;;
dir   ;1785..1869;;tac;;10;;;10;85;;
dir   ;1880..1963;;cta;;28;;;28;84;;
dir   ;1992..2068;;aga;;7;;;7;77;;
dir   ;2076..2151;;caa;;89;;;*89;76;;
dir   ;2241..2329;;tca;;3;;;3;89;;
dir   ;2333..2408;;ttc;;6;;;6;76;;
dir   ;2415..2491;;atgj;;11;;;11;77;;
dir   ;2503..2579;;atgi;;29;;;29;77;;
dir   ;2609..2685;;cca;;7;;;7;77;;
dir   ;2693..2769;;cac;;8;;;8;77;;
dir   ;2778..2853;;aaa;;7;;;7;76;;
dir   ;2861..2934;;tgc;;6;;;6;74;;
dir   ;2941..3015;;aac;;6;;;6;75;;
dir   ;3022..3107;;tta;;15;;;15;86;;
dir   ;3123..3198;;atgf;;7;;;7;76;;
dir   ;3206..3280;;gaa;;9;;;9;75;;
dir   ;3290..3363;;gga;;5;;;5;74;;
dir   ;3369..3444;;gta;;5;;;5;76;;
dir   ;3450..3526;;gac;;9;;;9;77;;
dir   ;3536..3610;;aca;;14;;;14;75;;
dir   ;3625..3709;;tac;;9;;;9;85;;
dir   ;3719..3802;;cta;;24;;;24;84;;
dir   ;3827..3901;;ggc;;24;;;24;75;;
dir   ;3926..4002;;aga;;9;;;9;77;;
dir   ;4012..4087;;caa;;8;;;8;76;;
dir   ;4096..4171;;aaa;;2;;;2;76;;
dir   ;4174..4262;;tca;;3;;;3;89;;
dir   ;4266..4341;;ttc;;6;;;6;76;;
dir   ;4348..4424;;atgj;;11;;;11;77;;
dir   ;4436..4512;;atgi;;17;;;17;77;;
dir   ;4530..4606;;cac;;8;;;8;77;;
dir   ;4615..4690;;aaa;;7;;;7;76;;
dir   ;4698..4771;;tgc;;7;;;7;74;;
dir   ;4779..4855;;cgt;;12;;;12;77;;
dir   ;4868..4943;;gta;;75;75;;;76;75;
dir   ;5019..5432;;cds;;308;308;;;414;;hp
dir   ;5741..9172;;cds;;;;;;*3432;;pyruvate carboxylase
;;;;;;;;;;;
dir   ;94032..94736;;cds;;281;281;;;705;281;N-acetylmuramoyl-L-alanine amidase CwlD
dir   ;95018..95994;;16s°;;100;;;;977;;
dir   ;96095..97613;;23s°;;126;;;;1519;;
dir   ;97740..97856;;5s;;7;;;;117;;
dir   ;97864..97938;;aac;;6;;;6;75;;
dir   ;97945..98030;;tta;;15;;;15;86;;
dir   ;98046..98121;;atgf;;7;;;7;76;;
dir   ;98129..98203;;gaa;;8;;;8;75;;
dir   ;98212..98285;;gga;;4;;;4;74;;
dir   ;98290..98365;;gta;;5;;;5;76;;
dir   ;98371..98447;;gac;;10;;;10;77;;
dir   ;98458..98532;;ggc;;9;;;9;75;;
dir   ;98542..98615;;aga;;954;*954;;;74;;
dir   ;99570..100409;;cds;;;;;;840;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;306829..309216;;cds;;733;;;;*2388;;cadmium-translocating P-type ATPase
<> comp;309950..310076;;cds;;1;1;;;127;1;glycine/sarcosine/betaine reductase complex  selenoprotein A
dir   ;310078..311313;;23s°;;126;;;;1236;;
dir   ;311440..311556;;5s;;177;177;;;117;;
dir   ;311734..312342;;cds;;;;;;609;;DedA family protein
;;;;;;;;;;;
comp;861856..862620;;cds;;258;258;;;765;;DeoR/GlpR transcriptional regulator
dir   ;862879..862969;;agc;;87;87;;;91;87;
dir   ;863057..863845;;cds;;;;;;789;;flagellar motor protein
;;;;;;;;;;;
dir    ;1106477..1107451;;cds;;238;238;;;975;238;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1107690..1109197;;16s;@2;320;;;;1508;;
dir    ;1109518..1112416;;23s;;91;;;;2899;;
dir    ;1112508..1112581;;gga;;8;;;;74;;
dir    ;1112590..1112706;;5s;;273;273;;;117;;
dir    ;1112980..1114998;;cds;;;;;;*2019;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1196804..1198213;;cds;;1378;*1378;;;*1410;;MBOAT family protein
comp;1199592..1199674;;ttg;;318;318;;;83;318;
dir    ;1199993..1202641;;cds;;;;;;*2649;;DNA polymerase I
;;;;;;;;;;;
dir    ;1850896..1852626;;cds;;109;109;;;*1731;109;Na+/H+ antiporter NhaC family protein
dir    ;1852736..1852816;;cta;;334;334;;;81;;
dir    ;1853151..1853666;;cds;;;;;;516;;HXXEE domain-containing protein
;;;;;;;;;;;
dir    ;3024038..3024715;;cds;;150;150;;;678;150;sortase SrtB
comp;3024866..3024940;;aca;@3;93;;;;75;;
comp;3025034..3027933;;23s;;184;;;;2900;;
comp;3028118..3029625;;16s;;374;374;;;1508;;
dir    ;3030000..3030938;;cds;;;;;;939;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
dir    ;3805298..3806743;;cds;;208;208;;;*1446;;tyrosine-type recombinase/integrase
comp;3806952..3807028;;agg;;61;61;;;77;61;
<comp;3807090..3808790;;cds;;;;;;*1701;;formate dehydrogenase subunit alpha
;;;;;;;;;;;
comp;3875816..3876886;;cds;;452;*452;;;1071;;ABC transporter ATP-binding protein
comp;3877339..3877455;;5s;;125;;;;117;;
comp;3877581..3880480;;23s;;261;;;;2900;;
comp;3880742..3882249;;16s;;190;190;;;1508;190;
comp;3882440..3883018;;cds;;;;;;579;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;4017523..4017714;;cds;;118;118;;;192;118;DUF378 domain-containing protein
comp;4017833..4017949;;5s;;126;;;;117;;
comp;4018076..4020975;;23s;;321;;;;2900;;
comp;4021297..4022804;;16s;;292;292;;;1508;;
comp;4023097..4023378;;cds;;221;221;;;282;;hp
comp;4023600..4025129;;cds;;;;;;*1530;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4135881..4136873;;cds;;383;383;;;993;;DNA replication protein DnaC
comp;4137257..4137331;;aca;;33;;33;;75;;
comp;4137365..4137440;;gta;;4;;4;;76;;
comp;4137445..4137519;;gaa;;6;;6;;75;;
comp;4137526..4137601;;aaa;;331;331;;;76;331;
comp;4137933..4139222;;cds;;;;;;*1290;;adenylosuccinate synthase
;;;;;;;;;;;
dir    ;4178197..4178970;;cds;;179;179;;;774;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;4179150..4180587;;16s;;161;;;;1438;;
comp;4180749..4180865;;5s;;201;;;;117;;
comp;4181067..4183959;;23s;;217;;;;2893;;
comp;4184177..4185684;;16s;;108;;;;1508;;
comp;4185793..4185869;;atgi;;11;;;11;77;;
comp;4185881..4185969;;tta;;5;;;;89;;
comp;4185975..4186091;;5s;;201;;;;117;;
comp;4186293..4189192;;23s;;375;;;;2900;;
comp;4189568..4189643;;gca;;52;;;;76;;
comp;4189696..4190959;;16s’;@4;100;;;;1264;;
dir    ;4191060..4192225;;16s’;;52;;;;1166;;
dir    ;4192278..4192353;;gca;;248;;;;76;;
dir    ;4192602..4193197;;23s°;;100;;;;596;;
dir    ;4193298..4193874;;16s°;;321;;;;577;;
dir    ;4194196..4196423;;23s’;;100;;;;2228;;
dir    ;4196524..4197091;;16s°;;320;;;;568;;
dir    ;4197412..4199044;;23s°;;100;;;;1633;;
dir    ;4199145..4201593;;23s’;;126;;;;2449;;
dir    ;4201720..4201836;;5s;;127;127;;;117;127;
dir    ;4201964..4202473;;cds;;;;;;510;;transcription repressor NadR
;;;;;;;;;;;
dir    ;4205417..4205872;;cds;;0;0;;;456;0;nucleoside deaminase
dir    ;4205873..4205964;;tcc;@5;37;;;;92;;
dir    ;4206002..4206266;;ncRNA;;76;76;;;265;;
dir    ;4206343..4207980;;cds;;;;;;*1638;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;4209435..4210639;;cds;;496;*496;;;1205;;glycosyl transferase
;4211136..4212643;;16s;;321;;;;1508;;
;4212965..4213127;;23s°;;100;100;;;163;100;
<>comp;4213228..4213849;;cds;;111;;;;622;;CHAP domain-containing protein
;;;;;;;;;;;
comp;4213961..4214620;;cds;;228;228;;;660;228;type A-1 chloramphenicol O-acetyltransferase
dir    ;4214849..4216199;;16s;;321;;;;1351;;
dir    ;4216521..4217008;;23s°;;101;;;;488;;
comp;4217110..4218529;;23s°;;250;;;;1420;;
comp;4218780..4218855;;gca;;52;;;;76;;
comp;4218908..4219471;;16s°;;100;;;;564;;
comp;4219572..4219856;;23s°;;217;;;;285;;
comp;4220074..4221581;;16s;;179;179;;;1508;179;
>comp;4221761..4222206;;cds;;386;386;;;446;386;B/F/G family RNA polymerase sigma-70 factor
dir    ;4222593..4224100;;16s;;321;;;;1508;;
dir    ;4224422..4227321;;23s;;181;;;;2900;;
dir    ;4227503..4227619;;5s;;6;;;;117;;
dir    ;4227626..4227700;;aac;;6;;;6;75;;
dir    ;4227707..4227792;;tta;;15;;;15;86;;
dir    ;4227808..4227883;;atgf;;7;;;7;76;;
dir    ;4227891..4227965;;gaa;;9;;;9;75;;
dir    ;4227975..4228048;;gga;;5;;;5;74;;
dir    ;4228054..4228129;;gta;;5;;;5;76;;
dir    ;4228135..4228211;;gac;;9;;;9;77;;
dir    ;4228221..4228295;;aca;;14;;;14;75;;
dir    ;4228310..4228394;;tac;;10;;;10;85;;
dir    ;4228405..4228488;;cta;;28;;;28;84;;
dir    ;4228517..4228593;;aga;;7;;;7;77;;
dir    ;4228601..4228676;;caa;;89;;;*89;76;;
dir    ;4228766..4228854;;tca;;3;;;3;89;;
dir    ;4228858..4228933;;ttc;;6;;;6;76;;
dir    ;4228940..4229016;;atgj;;11;;;11;77;;
dir    ;4229028..4229104;;atgi;;29;;;29;77;;
dir    ;4229134..4229210;;cca;;7;;;7;77;;
dir    ;4229218..4229294;;cac;;8;;;8;77;;
dir    ;4229303..4229378;;aaa;;353;;;;76;;
comp;4229732..4229848;;5s;;126;;;;117;;
comp;4229975..4232010;;23s’;;582;;;;2036;;
dir    ;4232593..4234098;;16s;@6;217;;;;1506;;
dir    ;4234316..4237215;;23s;;126;;;;2900;;
dir    ;4237342..4237458;;5s;;216;216;;;117;216;
comp;4237675..4238859;;cds;;372;372;;;1185;;pyridoxal phosphate-dependent aminotransferase
dir    ;4239232..4241583;;cds;;21;21;;;*2352;;anaerobic ribonucleoside triphosphate reductase
dir    ;4241605..4242144;;cds;;778;*778;;;540;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;4242923..4244459;;16s;@7;261;;;;1537;;
dir    ;4244721..4247619;;23s;;201;;;;2899;;
dir    ;4247821..4247937;;5s;;5;;;;117;;
dir    ;4247943..4248031;;tta;;11;;;11;89;;
dir    ;4248043..4248119;;atgi;;108;;;;77;;
dir    ;4248228..4249735;;16s;;184;;;;1508;;
dir    ;4249920..4250564;;23s°;;100;100;;;645;100;
<dir    ;4250665..4250923;;cds;;112;112;;;259;112;hp
comp;4251036..4253145;;23s’;;375;;;;2110;;
comp;4253521..4253596;;gca;;52;;;;76;;
comp;4253649..4254226;;16s°;;282;282;;;578;;
dir    ;4254509..4254712;;cds;;12;12;;;204;;hp
dir    ;4254725..4256002;;cds;;;;;;*1278;;phage portal protein

cdc8 cumuls[modifier | modifier le wikicode]

cdc8 cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;21;1;;0;1;4;1;3;100;6
;16 23 5s 0;4;20;2;77;50;2;20;0;200;8
;16 gca 235;2;40;1;6;100;7;40;0;300;11
;16 23 5s a;5;60;;0;150;5;60;0;400;5
;max a;43;80;;1;200;5;80;2;500;5
;a doubles;2;100;;3;250;6;100;3;600;5
;autres;10;120;;0;300;5;120;3;700;1
;total aas;98;140;;0;350;4;140;1;800;1
sans ;opérons;6;160;;0;400;4;160;1;900;1
;1 aa;5;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;2;200;1;1100;0
;a doubles;0;;;0;;4;;7;;1
;total aas;9;;3;87;;48;;22;;44
total aas;;108;;;;;;;;;
remarques;;7;;;;;;;;;
avec jaune;;;moyenne;14;14;;256;;155;;330
;;;variance;;16;;252;;109;;234
sans jaune;;;moyenne;;10;;182;;;;208
;;;variance;;6;;117;;;;97

cdc8 blocs[modifier | modifier le wikicode]

cdc8 blocs;;;;;;;;
Bloc type;groupes;intercal;Bloc type;groupes;intercal;Bloc type;groupe;intercal
;cds;554;;cds;150;;cds;496
;cds;0;;aca;93;;16s;321
;cds;168;;23s;184;;23s°;100
;23s°;133;III;16s;374;;cds;111
IV2;5s;7;;cds;;;cds;228
;aac;5;;;;;16s;321
;**16aas;8;;cds;452;;23s°;101
;atgj;115;;5s;125;;23s°;250
IV1;16s;1;;23s;261;;gca;52
;cds;100;I2;16s;190;;16s°;100
;23s°;182;;cds;;;23s°;217
;5s;7;;;;;16s;179
;aac;7;;cds;118;;cds;386
;**41aas;13;;5s;126;IV3;16s;321
;gta;76;;23s;321;;23s;181
;cds;308;I3;16s;292;;5s;6
;cds;;;cds;;;aac;6
;;;;;;;**17aas;8
;cds;281;;cds;179;;aaa;353
;16s°;100;;16s;161;;5s;126
;23s°;126;;5s;201;;23s;582
X1;5s;7;I1;23s;217;I4;16s;217
;aac;6;;16s;108;;23s;126
;**7aas;9;;atgi;11;;5s;216
;aga;954;;tta;5;;cds;372
;cds;;;5s;201;;cds;21
;;;;23s;375;;cds;778
;cds;733;VII1;gca;52;IV4;16s;261
;cds;1;;16s’;100;;23s;201
;23s°;126;;16s’;52;;5s;5
;5s;177;;gca;248;;tta;11
;cds;;;23s°;100;;atgi;108
;;;;16s°;321;;16s;184
;cds;238;;23s;100;;23s°;100
II;16s;320;;16s°;320;;cds;112
;23s;91;;23s°;100;;23s’;375
;gga;8;;23s’;126;;gca;52
;5s;273;;5s;127;;16s°;282
;cds;;;cds;;;cds;

cdc8 cdc psor 43[modifier | modifier le wikicode]

cdc8;43aas;cdc;43aas;;;cdc8;43aas;psor;44aas;
16s;1;;;;;16s;1;;;
cds;100;16s;279;;;cds;100;16s;196;
23s°;181;23s;180;-1;;23s°;181;23s;122;
5s;6;5s;6;0;;5s;6;5s;5;
aac;6;aac;6;0;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;10;tac;8;-2;;tac;10;tac;15;5
cta;28;cta;29;1;;cta;28;cta;14;-14
aga;7;aga;7;0;;aga;7;aga;7;0
caa;89;caa;88;-1;;caa;89;caa;11;
tca;3;tca;3;0;;tca;3;aaa;6;
ttc;6;ttc;6;0;;ttc;6;tca;3;0
atgj;11;atgj;11;0;;atgj;11;ttc;9;3
atgi;29;atgi;23;-6;;atgi;29;atg;8;-3
cca;7;cca;7;0;;cca;7;atg;21;-8
cac;8;cac;8;0;;cac;8;cca;6;-1
aaa;7;aaa;7;0;;aaa;7;cac;4;
tgc;6;tgc;6;0;;tgc;6;tgc;25;
aac;6;aac;5;-1;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;9;tac;9;0;;tac;9;tac;15;6
cta;24;cta;23;-1;;cta;24;cta;11;-13
ggc;24;ggc;24;0;;ggc;24;ggc;13;-11
aga;9;aga;9;0;;aga;9;aga;7;-2
caa;8;caa;8;0;;caa;8;caa;11;3
aaa;2;aaa;2;0;;aaa;2;aaa;6;4
tca;3;tca;3;0;;tca;3;tca;3;0
ttc;6;ttc;6;0;;ttc;6;ttc;9;3
atgj;11;atgj;11;0;;atgj;11;atg;8;-3
atgi;17;atgi;17;0;;atgi;17;atg;21;
cac;8;cac;8;0;;cac;8;cca;6;
aaa;7;aaa;7;0;;aaa;7;cac;9;1
tgc;7;tgc;7;0;;tgc;7;aaa;21;14
cgt;12;cgt;12;0;;cgt;12;tgc;6;-1
gta;75;gta;75;0;;gta;75;cgt;10;-2
cds;;cds;;;;cds;;gta;162;
;;;;;;;;cds;;

cdc8 cdc psor 18[modifier | modifier le wikicode]

cdc8;18aas;;;;;cdc8;19aas;psor;23aas;
cds;214;;;;;16s;321;16s;196;
cds;554;;;;;23s;181;23s;213;
cds;0;cdc;18aas;;;5s;6;5s;5;
cds;167;16s;279;;;aac;6;tta;13;-2
23s°;132;23s;131;-1;;tta;15;atg;15;8
5s;6;5s;6;0;;atgf;7;gaa;9;0
aac;4;aac;4;0;;gaa;9;gga;6;1
gaa;5;gaa;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;11;gac;10;-1;;gac;9;aac;31;
aca;14;aca;14;0;;aca;14;aac;4;
tac;9;tac;9;0;;tac;10;aca;4;-10
gga;10;gga;10;0;;cta;28;tac;11;
aga;9;aga;9;0;;aga;7;gga;19;
caa;11;caa;11;0;;caa;89;aga;6;-1
aaa;2;aaa;2;0;;tca;3;caa;12;
tca;18;tca;17;-1;;ttc;6;aaa;6;
agc;8;agc;8;0;;atgj;11;tca;11;
cca;85;cca;85;0;;atgi;29;agc;6;
tgg;60;tgg;60;0;;cca;7;cca;6;
cca;5;cca;6;1;;cac;8;atg;11;
atc;3;atc;3;0;;aaa;353;tgg;31;
ttc;7;ttc;7;0;;;;cca;6;
atgj;114;atgj;114;0;;;;atc;6;
;;;;;;;;ttc;13;
;;psor;23aas;;;;;atg;138;
;;16s;196;;;;;;;
cdc8;18aas;23s;213;;;;;cdc8;18aas;
cds;214;5s;5;;;;;cds;214;
cds;554;tta;13;;;;;cds;554;
cds;0;atg;15;;;cdc8;19aas;cds;0;
cds;167;gaa;9;;;16s;321;cds;167;
23s°;132;gga;6;;;23s;181;23s°;132;
5s;6;gta;5;0;;5s;6;5s;6;
aac;4;gac;16;;;aac;6;aac;4;
gaa;5;aac;31;;;tta;15;gaa;5;
gta;5;aac;4;;;atgf;7;gta;5;0
gac;11;aca;4;-10;;gaa;9;gac;11;2
aca;14;tac;11;2;;gga;5;aca;14;0
tac;9;gga;19;9;;gta;5;tac;9;
gga;10;aga;6;-3;;gac;9;gga;10;
aga;9;caa;12;1;;aca;14;aga;9;2
caa;11;aaa;6;4;;tac;10;caa;11;
aaa;2;tca;11;-7;;cta;28;aaa;2;
tca;18;agc;6;-2;;aga;7;tca;18;
agc;8;cca;6;;;caa;89;agc;8;
cca;85;atg;11;;;tca;3;cca;85;
tgg;60;tgg;31;-29;;ttc;6;tgg;60;
cca;5;cca;6;1;;atgj;11;cca;5;
atc;3;atc;6;3;;atgi;29;atc;3;
ttc;7;ttc;13;6;;cca;7;ttc;7;
atgj;114;atg;138;24;;cac;8;atgj;114;
;;;;;;aaa;353;;;

cdc8 cdc psor 9[modifier | modifier le wikicode]

cdc8;18aas;cdc8;9aas;;;cdc8;9aas;cdc;9aas;
cds;214;;;;;cds;281;16s;52;
cds;554;;;;;16s°;100;gca;373;
cds;0;cds;281;;;23s°;126;23s;126;
cds;167;16s°;100;;;5s;7;5s;7;
23s°;132;23s°;126;;;aac;6;aac;5;-1
5s;6;5s;7;;;tta;15;tta;15;0
aac;4;aac;6;;;atgf;7;atgf;7;0
gaa;5;tta;15;;;gaa;8;gaa;14;6
gta;5;atgf;7;;;gga;4;gga;5;1
gac;11;gaa;8;;;gta;5;gta;5;0
aca;14;gga;4;;;gac;10;gac;10;0
tac;9;gta;5;0;;ggc;9;ggc;9;0
gga;10;gac;10;;;aga;954;aga;975;21
aga;9;ggc;9;;;cds;;cds;;
caa;11;aga;954;;;;;;;
aaa;2;cds;;;;cdc8;I4;cdc;VIII1;
tca;18;;;;;;;16s;68;
agc;8;;;;;16s;217;gca;271;
cca;85;;;;;23s;126;23s;126;0
tgg;60;;;;;5s;216;5s;213;-3
cca;5;;;;;cds;372;cds;372;0
atc;3;;;;;cds;21;cds;21;0
ttc;7;;;;;cds;778;cds;776;-2
atgj;114;;;;;16s;261;16s;52;
;;;;;;23s;201;gca;373;
cdc8;19aas;cdc8;9aas;;;5s;5;23s;126;-75
;;cds;281;;;;;5s;7;2
16s;321;16s°;100;;;;;;;
23s;181;23s°;126;;;psor;VII1;cdc8;VII1;
5s;6;5s;7;;;CDS;431;cds;179;
aac;6;aac;6;0;;16s;54;16s;161;
tta;15;tta;15;9;;gca;114;5s;201;
atgf;7;atgf;7;-8;;23s;193;23s;217;
gaa;9;gaa;8;1;;5s;5;16s;108;
gga;5;gga;4;-5;;tta;9;atgi;11;2
gta;5;gta;5;0;;atg;123;tta;5;0
gac;9;gac;10;;;16s;54;5s;201;8
aca;14;ggc;9;;;gca;114;23s;375;261
tac;10;aga;954;;;23s;193;gca;52;-2
cta;28;cds;;;;5s;5;16s’;100;-23
aga;7;;;;;tta;9;16s’;52;
caa;89;;;;;atg;123;gca;248;
tca;3;;;;;16s;54;23s°;100;-2
ttc;6;;;;;gca;114;16s°;321;134
atgj;11;;;;;23s;78;23s;100;
atgi;29;;;;;5s;100;16s°;320;
cca;7;;;;;CDS;;23s°;100;
cac;8;;;;;;;23s’;126;
aaa;353;;;;;;;5s;127;
;;;;;;;;cds;;

cdc8 cdc protéines[modifier | modifier le wikicode]

Alignement sur cdc[modifier | modifier le wikicode]
;cdc;;;;;;cdc8;;;;;
ordre;Peptoclostridium difficile CD196;;;;;;Peptoclostridium difficile M68;;;;;
0;dir    ;9857..10630;cds;179;774;SigB;dir    ;4194196..4196423;23s’;100;2228;
;dir    ;10810..12317;16s;52;1508;;dir    ;4196524..4197091;16s°;320;568;
;dir    ;12370..12445;gca;249;76;;dir    ;4197412..4199044;23s°;100;1633;
1;dir    ;12695..15596;23s;111;2902;;dir    ;4199145..4201593;23s’;126;2449;
;dir    ;15708..15824;5s;126;117;;dir    ;4201720..4201836;5s;127;117;
;dir    ;15951..16460;cds;11;510;NadR;dir    ;4201964..4202473;cds;11;510;NadR
;dir    ;16472..17353;cds;457;882;mecano;dir    ;4202485..4203366;cds;458;882;mecano
;dir    ;17811..19082;cds;319;1272;S-ligase;dir    ;4203825..4205096;cds;320;1272;S-ligase
;dir   ;19402..19857;cds;0;456;Nuc-de;dir    ;4205417..4205872;cds;0;456;Nuc-de
;dir   ;19858..19949;tcc;37;92;;dir    ;4205873..4205964;tcc;37;92;
2;dir   ;19987..20251;ncRNA;76;265;;dir    ;4206002..4206266;ncRNA;76;265;
;dir   ;20328..21965;cds;;1638;III-tau;dir    ;4206343..4207980;cds;;1638;III-tau
;;;;;;;;;;;;
;comp;23419..24624;cds;505;1206;Glyco-tr;dir   ;4306341..4307538;16s;0;1198;
;dir    ;25130..26637;16s;279;1508;;dir   ;4307539..4308225;cds;100;687;xylose
;dir    ;26917..29816;23s;180;2900;;dir   ;1..796;23s°;181;796;
;dir    ;29997..30113;5s;6;117;;dir   ;978..1094;5s;6;117;
3;dir    ;30120..30194;aac;6;75;;dir   ;1101..1175;aac;6;75;
;dir    ;;**41aas;12;;;dir   ;;**41aas;12;;
;dir    ;33877..33952;gta;75;76;;dir   ;4868..4943;gta;75;76;
;dir    ;34028..34441;cds;308;414;hp-414;dir   ;5019..5432;cds;308;414;hp-414
;dir    ;34750..38181;cds;;3432;pyruvate;dir   ;5741..9172;cds;;3432;pyruvate
;;;;;;;;;;;;
;;;;;;;dir;4300349..4300807;cds;554;459;Helix
;dir    ;127011..127715;cds;281;705;CwlD;dir   ;4301362..4303101;cds;0;1740;hp-1740
;dir    ;127997..129505;16s;279;1509;;dir   ;4303102..4303305;cds;167;204;hp-204
;dir    ;129785..132685;23s;131;2901;;dir   ;4303473..4304299;23s°;132;827;
;dir    ;132817..132933;5s;6;117;;dir   ;4304432..4304548;5s;6;117;
4;dir    ;132940..133014;aac;4;75;;dir   ;4304555..4304629;aac;4;75;
;dir    ;;**16aas;8;;;dir   ;;**16aas;8;;
;dir    ;134534..134610;atgj;114;77;;dir   ;4306150..4306226;atgj;114;77;
;dir    ;134725..136115;16s;68;1391;;;;;;;
;dir    ;136184..136259;gca;271;76;;dir    ;4232593..4234098;16s;217;1506;
;dir    ;136531..139430;23s;126;2900;;dir    ;4234316..4237215;23s;126;2900;
;dir    ;139557..139673;5s;213;117;;dir    ;4237342..4237458;5s;216;117;
;comp;139887..141071;cds;372;1185;B6;comp;4237675..4238859;cds;372;1185;B6
5;dir    ;141444..143795;cds;21;2352;Art-red;dir    ;4239232..4241583;cds;21;2352;Art-red
;dir    ;143817..144356;cds;776;540;Art-reda;dir    ;4241605..4242144;cds;778;540;Art-reda
;dir    ;145133..146640;16s;52;1508;;dir   ;94032..94736;cds;281;705;CwlD
;dir    ;146693..146768;gca;373;76;;dir   ;95018..95994;16s°;100;977;
;dir    ;147142..150041;23s;126;2900;;dir   ;96095..97613;23s°;126;1519;
;dir    ;150168..150284;5s;7;117;;dir   ;97740..97856;5s;7;117;
6;dir    ;150292..150366;aac;5;75;;dir   ;97864..97938;aac;6;75;
;dir    ;;**7aas;6;;;dir   ;;**7aas;6;;
;dir    ;150976..151049;aga;975;74;;dir   ;98542..98615;aga;954;74;
;dir    ;152025..152864;cds;;840;TIGR;dir   ;99570..100409;cds;;840;TIGR
;;;;;;;;;;;;
;dir   ;378341..380728;cds;583;2388;cad;dir   ;306829..309216;cds;733;2388;cad
;dir   ;381312..382819;16s;311;1508;;<> comp;309950..310076;cds;1;127;seleno
;dir   ;383131..386030;23s;126;2900;;dir   ;310078..311313;23s°;126;1236;
7;dir   ;386157..386273;5s;177;117;;dir   ;311440..311556;5s;177;117;
;dir   ;386451..387059;cds;;609;DedA;dir   ;311734..312342;cds;;609;DedA
;;;;;;;;;;;;
;comp;833130..833894;cds;258;765;DeoR;comp;861856..862620;cds;258;765;DeoR
8;dir    ;834153..834243;agc;87;91;;dir   ;862879..862969;agc;87;91;
;dir    ;834331..835119;cds;;789;flagellar;dir   ;863057..863845;cds;;789;flagellar
;;;;;;;;;;;;
;dir    ;1089165..1090139;cds;239;975;Mannosyl;dir    ;1106477..1107451;cds;238;975;Mannosyl
;dir    ;1090379..1091886;16s;320;1508;;dir    ;1107690..1109197;16s;320;1508;
;dir    ;1092207..1095106;23s;91;2900;;dir    ;1109518..1112416;23s;91;2899;
;dir    ;1095198..1095271;gga;8;74;;dir    ;1112508..1112581;gga;8;74;
9;dir    ;1095280..1095396;5s;273;117;;dir    ;1112590..1112706;5s;273;117;
;dir    ;1095670..1097688;cds;;2019;Ala amid;dir    ;1112980..1114998;cds;;2019;Ala amid
;;;;;;;;;;;;
;comp;1181549..1182958;cds;1374;1410;MBOAT;comp;1196804..1198213;cds;1378;1410;MBOAT
10;comp;1184333..1184415;ttg;318;83;;comp;1199592..1199674;ttg;318;83;
;dir    ;1184734..1187382;cds;;2649;PolyI;dir    ;1199993..1202641;cds;;2649;PolyI
;;;;;;;;;;;;
;dir   ;1835768..1837498;cds;109;1731; NhaC;dir    ;1850896..1852626;cds;109;1731; NhaC
11;dir   ;1837608..1837688;cta;231;81;;dir    ;1852736..1852816;cta;334;81;
;<dir   ;1837920..1838093;cds;;174;HXXEE;dir    ;1853151..1853666;cds;;516;HXXEE
;;;;;;;;;;;;
;dir   ;2981767..2982444;cds;159;678;SrtB;dir    ;3024038..3024715;cds;150;678;SrtB
;comp;2982604..2982678;aca;94;75;;comp;3024866..3024940;aca;93;75;
;comp;2982773..2985672;23s;184;2900;;comp;3025034..3027933;23s;184;2900;
12;comp;2985857..2987364;16s;340;1508;;comp;3028118..3029625;16s;374;1508;
;dir   ;2987705..2988643;cds;;939;lactam;dir    ;3030000..3030938;cds;;939;lactam
;;;;;;;;;;;;
;comp;3787361..3788431;cds;454;1071;ABC;comp;3875816..3876886;cds;452;1071;ABC
;comp;3788886..3789002;5s;126;117;;comp;3877339..3877455;5s;125;117;
13;comp;3789129..3792028;23s;281;2900;;comp;3877581..3880480;23s;261;2900;
;comp;3792310..3793817;16s;191;1508;;comp;3880742..3882249;16s;190;1508;
;comp;3794009..3794587;cds;;579;precorrin;comp;3882440..3883018;cds;;579;precorrin
;;;;;;;;;;;;
;comp;3944262..3944453;cds;119;192;DUF378;comp;4017523..4017714;cds;118;192;DUF378
;comp;3944573..3944689;5s;126;117;;comp;4017833..4017949;5s;126;117;
14;comp;3944816..3947715;23s;217;2900;;comp;4018076..4020975;23s;321;2900;
;comp;3947933..3949440;16s;282;1508;;comp;4021297..4022804;16s;292;1508;
;comp;3949723..3950004;cds;221;282;hp-282;comp;4023097..4023378;cds;221;282;hp-282
;comp;3950226..3951755;cds;;1530;K-ligase;comp;4023600..4025129;cds;;1530;K-ligase
;;;;;;;;;;;;
;dir    ;4084445..4085437;cds;382;993; DnaC;dir    ;4135881..4136873;cds;383;993; DnaC
;comp;4085820..4085894;aca;33;75;;comp;4137257..4137331;aca;33;75;
15;comp;4085928..4086003;gta;4;76;;comp;4137365..4137440;gta;4;76;
;comp;4086008..4086082;gaa;6;75;;comp;4137445..4137519;gaa;6;75;
;comp;4086089..4086164;aaa;326;76;;comp;4137526..4137601;aaa;331;76;
;comp;4086491..4087780;cds;;1290;succinate;comp;4137933..4139222;cds;;1290;succinate
Alignement sur cdc8[modifier | modifier le wikicode]
;cdc8;;;;;;;cdc8;;;;;;;psor;;;;
ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;;ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;adresse;gène;intercal;pbs;abrégé
insert;dir   ;4299490..4300134;cds;214;645;Y-r1;;0;dir    ;4178197..4178970;cds;179;774;SigB;127845..129260;CDS;100;1416;R-deca
insert;dir   ;4300349..4300807;cds;554;459;Helix;;insert;dir    ;4179150..4180587;16s;161;1438;;127628..127744;5s;78;;
;dir   ;4301362..4303101;cds;0;1740;hp-1740;;insert;comp;4180749..4180865;5s;201;117;;124628..127549;23s;114;;
;dir   ;4303102..4303305;cds;167;204;hp-204;;insert;comp;4181067..4183959;23s;217;2893;;124438..124513;gca;54;;
;dir   ;4303473..4304299;23s°;132;827;;;insert;comp;4184177..4185684;16s;108;1508;;122877..124383;16s;123;;
4;dir   ;4304432..4304548;5s;6;117;;;insert;comp;4185793..4185869;atgi;11;77;;122677..122753;atg;9;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4185881..4185969;tta;5;89;;122579..122667;tta;5;;
;dir   ;4304634..4304708;gaa;5;75;;;insert;comp;4185975..4186091;5s;201;117;;122457..122573;5s;193;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4186293..4189192;23s;375;2900;;119347..122263;23s;114;;
;dir   ;;**16aas;8;;;;insert;comp;4189568..4189643;gca;52;76;;119157..119232;gca;54;;
;dir   ;4306150..4306226;atgj;114;77;;;insert;comp;4189696..4190959;16s’;100;1264;;117596..119102;16s;123;;
;dir   ;4306341..4307538;16s;0;1198;;;insert;dir    ;4191060..4192225;16s’;52;1166;;117396..117472;atg;9;;
;dir   ;4307539..4308225;cds;100;687;xylose;;insert;dir    ;4192278..4192353;gca;248;76;;117298..117386;tta;5;;
;dir   ;1..796;23s°;181;796;;;insert;dir    ;4192602..4193197;23s°;100;596;;117176..117292;5s;193;;
3;dir   ;978..1094;5s;6;117;;;insert;dir    ;4193298..4193874;16s°;321;577;;114067..116982;23s;114;;
;dir    ;1101..1175;aac;6;75;;;insert;dir    ;4194196..4196423;23s’;100;2228;;113877..113952;gca;54;;
;dir    ;;**41aas;12;;;;;dir    ;4196524..4197091;16s°;320;568;;112316..113822;16s;431;;
;dir    ;4868..4943;gta;75;76;;;1;dir    ;4197412..4199044;23s°;100;1633;;111345..111884;CDS;;540;Art-reda
;dir    ;5019..5432;cds;308;414;hp-414;;;dir    ;4199145..4201593;23s’;126;2449;;;;;;
;dir    ;5741..9172;cds;;3432;pyruvate ;;;dir    ;4201720..4201836;5s;127;117;;;;;;
;;;;;;;;;dir    ;4201964..4202473;cds;11;510;NadR;;;;;
;dir   ;94032..94736;cds;281;705;CwlD;;;dir    ;4202485..4203366;cds;458;882;mecano;;;;;
;dir   ;95018..95994;16s°;100;977;;;;dir    ;4203825..4205096;cds;320;1272;S-ligase;;;;;
;dir   ;96095..97613;23s°;126;1519;;;;dir    ;4205417..4205872;cds;0;456;Nuc-de;;;;;
6;dir   ;97740..97856;5s;7;117;;;;dir    ;4205873..4205964;tcc;37;92;;;;;;
;dir   ;97864..97938;aac;6;75;;;2;dir    ;4206002..4206266;ncRNA;76;265;;;;;;
;dir   ;;**7aas;6;;;;;dir    ;4206343..4207980;cds;;1638;III-tau;;;;;
;dir   ;98542..98615;aga;954;74;;;;;;;;;;;;;;
;dir   ;99570..100409;cds;;840;TIGR;;insert;comp;4209435..4210639;cds;496;1205;Glyco-tr;;;;;
;;;;;;;;insert;;4211136..4212643;16s;321;1508;;;;;;
;<> cp;309950..310076;cds;1;127;seleno;;insert;;4212965..4213127;23s°;100;163;;;;;;
;dir   ;310078..311313;23s°;126;1236;;;insert;<>comp;4213228..4213849;cds;;622;CHAP;;;;;
7;dir   ;311440..311556;5s;177;117;;;insert;;;;;;;;;;;
;dir   ;311734..312342;cds;;609;DedA;;insert;comp;4213961..4214620;cds;228;660;A-1chlor;;;;;
;;;;;;;;insert;dir    ;4214849..4216199;16s;321;1351;;;;;;
;comp;861856..862620;cds;258;765;DeoR;;insert;dir    ;4216521..4217008;23s°;101;488;;;;;;
8;dir   ;862879..862969;agc;87;91;;;insert;comp;4217110..4218529;23s°;250;1420;;;;;;
;dir   ;863057..863845;cds;;789;flagellar;;insert;comp;4218780..4218855;gca;52;76;;;;;;
;;;;;;;;insert;comp;4218908..4219471;16s°;100;564;;;;;;
;dir    ;1106477..1107451;cds;238;975;Mannosyl;;insert;comp;4219572..4219856;23s°;217;285;;;;;;
;dir    ;1107690..1109197;16s;320;1508;;;insert;comp;4220074..4221581;16s;179;1508;;;;;;
;dir    ;1109518..1112416;23s;91;2899;;;insert;>comp;4221761..4222206;cds;386;446;SigB2;3452349..3452552;CDS;239;204;hp-204
;dir    ;1112508..1112581;gga;8;74;;;insert;dir    ;4222593..4224100;16s;321;1508;;3450603..3452109;16s;196;;
9;dir    ;1112590..1112706;5s;273;117;;;insert;dir    ;4224422..4227321;23s;181;2900;;3447492..3450406;23s;213;;
;dir    ;1112980..1114998;cds;;2019;Ala amid;;insert;dir    ;4227503..4227619;5s;6;117;;3447162..3447278;5s;5;;
;;;;;;;;insert;dir    ;4227626..4227700;aac;6;75;;3447068..3447156;tta;13;;
;comp;1196804..1198213;cds;1378;1410;MBOAT;;insert;dir    ;4227707..4227792;tta;15;86;;3446979..3447054;atg;15;;
10;comp;1199592..1199674;ttg;318;83;;;insert;dir    ;4227808..4227883;atgf;7;76;;3446889..3446963;gaa;9;;
;dir    ;1199993..1202641;cds;;2649;PolyI;;insert;dir    ;4227891..4227965;gaa;9;75;;3446806..3446879;gga;6;;
;;;;;;;;insert;dir    ;4227975..4228048;gga;5;74;;3446724..3446799;gta;5;;
;dir    ;1850896..1852626;cds;109;1731; NhaC;;insert;dir    ;4228054..4228129;gta;5;76;;3446642..3446718;gac;16;;
11;dir    ;1852736..1852816;cta;334;81;;;insert;dir    ;4228135..4228211;gac;9;77;;3446550..3446625;aac;31;;
;dir    ;1853151..1853666;cds;;516;HXXEE;;insert;dir    ;4228221..4228295;aca;14;75;;3446443..3446518;aac;4;;
;;;;;;;;insert;dir    ;4228310..4228394;tac;10;85;;3446364..3446438;aca;4;;
;dir    ;3024038..3024715;cds;150;678;SrtB;;insert;dir    ;4228405..4228488;cta;28;84;;3446275..3446359;tac;11;;
;comp;3024866..3024940;aca;93;75;;;insert;dir    ;4228517..4228593;aga;7;77;;3446190..3446263;gga;19;;
12;comp;3025034..3027933;23s;184;2900;;;insert;dir    ;4228601..4228676;caa;89;76;;3446094..3446170;aga;6;;
;comp;3028118..3029625;16s;374;1508;;;insert;dir    ;4228766..4228854;tca;3;89;;3446012..3446087;caa;12;;
;dir    ;3030000..3030938;cds;;939;lactam;;insert;dir    ;4228858..4228933;ttc;6;76;;3445924..3445999;aaa;6;;
;;;;;;;;insert;dir    ;4228940..4229016;atgj;11;77;;3445829..3445917;tca;11;;
;dir    ;3805298..3806743;cds;208;1446;Y-r2;;insert;dir    ;4229028..4229104;atgi;29;77;;3445727..3445817;agc;6;;
;comp;3806952..3807028;agg;61;77;;;insert;dir    ;4229134..4229210;cca;7;77;;3445644..3445720;cca;6;;
;<comp;3807090..3808790;cds;;1701;fdHa;;insert;dir    ;4229218..4229294;cac;8;77;;3445561..3445637;atg;11;;
;;;;;;;;insert;dir    ;4229303..4229378;aaa;353;76;;3445474..3445549;tgg;31;;
;comp;3875816..3876886;cds;452;1071;ABC;;insert;comp;4229732..4229848;5s;126;117;;3445366..3445442;cca;6;;
;comp;3877339..3877455;5s;125;117;;;insert;comp;4229975..4232010;23s’;582;2036;;3445283..3445359;atc;6;;
13;comp;3877581..3880480;23s;261;2900;;;;dir    ;4232593..4234098;16s;217;1506;;3445201..3445276;ttc;13;;
;comp;3880742..3882249;16s;190;1508;;;;dir    ;4234316..4237215;23s;126;2900;;3445111..3445187;atg;;;
;comp;3882440..3883018;cds;;579;precorrin;;;dir    ;4237342..4237458;5s;216;117;;;;;;
;;;;;;;;;comp;4237675..4238859;cds;372;1185;B6;;;;;
;comp;4017523..4017714;cds;118;192;DUF378;;5;dir    ;4239232..4241583;cds;21;2352;Art-red;;;;;
;comp;4017833..4017949;5s;126;117;;;;dir    ;4241605..4242144;cds;778;540;Art-reda;;;;;
14;comp;4018076..4020975;23s;321;2900;;;insert;dir    ;4242923..4244459;16s;261;1537;;;;;;
;comp;4021297..4022804;16s;292;1508;;;insert;dir    ;4244721..4247619;23s;201;2899;;;;;;
;comp;4023097..4023378;cds;221;282;hp-282;;insert;dir    ;4247821..4247937;5s;5;117;;111345..111884;CDS;431;540;Art-reda
;comp;4023600..4025129;cds;;1530;K-ligase;;insert;dir    ;4247943..4248031;tta;11;89;;112316..113822;16s;54;;
;;;;;;;;insert;dir    ;4248043..4248119;atgi;108;77;;113877..113952;gca;114;;
;dir    ;4135881..4136873;cds;383;993; DnaC;;insert;dir    ;4248228..4249735;16s;184;1508;;114067..116982;23s;193;;
;comp;4137257..4137331;aca;33;75;;;insert;dir    ;4249920..4250564;23s°;100;645;;117176..117292;5s;5;;
15;comp;4137365..4137440;gta;4;76;;;insert;<dir    ;4250665..4250923;cds;112;259;hp-259;117298..117386;tta;9;;
;comp;4137445..4137519;gaa;6;75;;;insert;comp;4251036..4253145;23s’;375;2110;;117396..117472;atg;123;;
;comp;4137526..4137601;aaa;331;76;;;insert;comp;4253521..4253596;gca;52;76;;117596..119102;16s;54;;
;comp;4137933..4139222;cds;;1290;succinate;;insert;comp;4253649..4254226;16s°;282;578;;119157..119232;gca;114;;
;;;;;;;;insert;dir    ;4254509..4254712;cds;12;204;hp-204;119347..122263;23s;193;;
;;;;;;;;insert;dir    ;4254725..4256002;cds;;1278;phagePP;122457..122573;5s;5;;
;;;;;;;;;;;;;;;122579..122667;tta;9;;
;;;;;;;;début;début;début;début;début;début;début;122677..122753;atg;123;;
;;;;;;;;insert;dir   ;4299490..4300134;cds;214;645;Y-r1;122877..124383;16s;54;;
;;;;;;;;insert;dir   ;4300349..4300807;cds;554;459;Helix;124438..124513;gca;114;;
;;;;;;;;;dir   ;4301362..4303101;cds;0;1740;hp-1740;124628..127549;23s;78;;
;;;;;;;;;dir   ;4303102..4303305;cds;167;204;hp-204;127628..127744;5s;100;;
;;;;;;;;4;dir   ;4303473..4304299;23s°;132;827;;127845..129260;CDS;;1416;R-deca

cdc8 cdc création de cds[modifier | modifier le wikicode]

;;création de cds;;;;
;cdc8;pbs;cdc;pbs;psor;pbs
seleno A;309950..310076;127;0;;-;
Y-r;457663..457878;216;457207..457422;216;-;
;1237414..1237986;573;1223841..1224413;573;;
;1291413..1292327;915;1277836..1278750;915;;
;1418672..1419580;909;1405262..1406170;909;;
;2120221..2121348;1128;;;;
;2785863..2786042;180;;;;
;3564835..3565434;600;;;;
Y-r2;3805298..3806743;1446;;;;
Y-r1;4299490..4300134;645;;;;
Helix;351106..351336;231;391813..392001;189;-;
;379952..380503;552;429510..430061;552;;
;456588..456776;189;461727..462398;672;;
;1187185..1187736;552;1169984..1170535;552;;
;1466364..1466783;420;1292255..1292926;672;;
;1467749..1468147;399;1454375..1454773;399;;
;1605760..1606344;585;1517855..1518619;765;;
;1694358..1694750;393;1592306..1592890;585;;
;1936722..1937267;546;1682266..1682658;393;;
;2105662..2106711;1050;1695592..1696284;693;;
;2196549..2198204;1656;1916424..1916630;207;;
;2342487..2342690;204;1922813..1923358;546;;
;2353934..2354578;645;2164151..2165806;1656;;
;2378761..2379891;1131;2308386..2308589;204;;
;2721795..2722316;522;2319833..2320477;645;;
;3485137..3486024;888;2344477..2345607;1131;;
;3570953..3571183;231;2501260..2501931;672;;
;3571660..3571878;219;2688255..2688776;522;;
;3804379..3804627;249;3459701..3460588;888;;
;3804878..3805279;402;3475449..3475589;141;;
;4286854..4287222;369;;;;
;4288799..4289518;720;;;;
;4300349..4300807;459;;;;
xylose;3383443..3384780;1338;3349843..3351180;1338;0;
;<4307539..4308225;687;;;;
CHAP;<4213228..>4213849;622;0;;-;
A-1chlor;4213961..4214620;660;0;;0;
SigB2;4221761..4222206;446;0;;0;
fdHa;4221761..4222206;1701;3711229..3713373;2145;-;
R-deca;0;;0;;127845..129260;1416
;;;;;876023..877522;1500
phagePP;1448919..1449983;1065;1435547..1436611;1065;1489507..1490769;1263
;1450539..1450985;447;1437167..1437613;447;;
;1709611..1711050;1440;1697521..1698963;1443;;
;1718404..1718844;441;1708192..1708632;441;;
;3560756..3561910;1155;3841162..3842367;1206;;
;4254725..4256002;1278;;;;
;4260531..4261586;1056;;;;
;4262058..4262474;417;;;;
hp-204;4254509..4254712;204;;;;
phagePP;4254725..4256002;1278;;;;
phageHM;4255980..4256741;762;;;;
hp;;;3840525..3841067;543;;
phagePP;;;3841162..3842367;1206;;
hydrolase;;;3842345..3842512;168;;
terminase;;;;;1487770..1489491;1722
phagePP;;;;;1489507..1490769;1263
Clp;;;;;1490762..1491607;846

cdc8 cdc abrégé protéines[modifier | modifier le wikicode]

A-1chlor;type A-1 chloramphenicol O-acetyltransferase
ABC;ABC transporter ATP-binding protein
Ala amid;N-acetylmuramoyl-L-alanine amidase
Art-red;anaerobic ribonucleoside triphosphate reductase
Art-reda;anaerobic ribonucleoside-triphosphate reductase activating protein
B6;pyridoxal phosphate-dependent aminotransferase
cad;cadmium-translocating P-type ATPase
CHAP;CHAP domain-containing protein
CwlD;N-acetylmuramoyl-L-alanine amidase CwlD
DedA;DedA family protein
DeoR;DeoR/GlpR transcriptional regulator
DnaC;DNA replication protein DnaC
DUF378;DUF378 domain-containing protein
fdHa;formate dehydrogenase subunit alpha
flagellar;flagellar motor protein
Glyco-tr;glycosyl transferase
Helix;helix-turn-helix domain-containing protein
hp-1740;hp-1740
hp-204;hp-204
hp-282;hp-282
hp-414;hp-414
HXXEE;HXXEE domain-containing protein
III-tau;DNA polymerase III subunit gamma/tau
K-ligase;lysine--tRNA ligase
S-ligase;serine--tRNA ligase
lactam;delta-lactam-biosynthetic de-N-acetylase
Mannosyl;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
MBOAT;MBOAT family protein
mecano;mechanosensitive ion channel
NadR;transcription repressor NadR
NhaC;Na+/H+ antiporter NhaC family protein
Nuc-de;nucleoside deaminase
phagePP;phage portal protein
PolyI;DNA polymerase I
precorrin;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
pyruvate;pyruvate carboxylase
R-deca;arginine decarboxylase
seleno;glycine/sarcosine/betaine reductase complex  selenoprotein A
SigB;SigB/SigF/SigG family RNA polymerase sigma factor
SigB2;B/F/G family RNA polymerase sigma-70 factor
SrtB;sortase SrtB
succinate;adenylosuccinate synthase
TIGR;TIGR00159 family protein
xylose;xylose isomerase
Y-r1;tyrosine-type recombinase/integrase – 1
Y-r2;tyrosine-type recombinase/integrase – 2

cdc8 cdc psor stats[modifier | modifier le wikicode]

NCBI du 13.11.19;cdc8;cdc;psor
date;15-MAR-2017;18-MAY-2017;08-JAN-2018
DNA circulaire;4 308 325;4 110 554;3 550 458
Genes (total)         ;4 025;3 807;3 528
CDS (total)           ;3 870;3 691;3 368
Genes (coding)        ;3 763;3 615;3 327
CDS (coding)          ;3 763;3 615;3 327
Genes (RNA)           ;155;116;160
RRNAs  (5S, 16S, 23S); 14, 16, 13; 9, 10, 10;17, 17, 17
complete rRNAs        ; 14, 16, 13; 9, 10, 10;17, 17, 17
tRNAs     ;108;83;105
ncRNAs    ;4;4;4
Pseudo Genes (total)  ;107;76;41
Pseudo Genes (ambiguous residues) ; 0 of 107; 0 of 76; 0 of 41
Pseudo Genes (frameshifted)       ; 60 of 107; 42 of 76; 4 of 41
Pseudo Genes (incomplete)         ; 35 of 107; 30 of 76; 18 of 41
Pseudo Genes (internal stop)      ; 31 of 107; 18 of 76; 22 of 41
Pseudo Genes (multiple problems)  ; 18 of 107; 12 of 76; 3 of 41
CRISPR Arrays         ;4;9; - 
;;;
Décompte du 19.11.19;;;
hypothetical protein;609;523;1 256
hp / cds (total);0,16;0,14;0,37

cdc8 distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;
cta;1;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;1;gga;
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;;aag;;agg;1;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cdc8;;5;;;;;5;;cdc8;4;;;;;;9

cdc8 données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cdc8 données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;;tRNA contig;;tRNA contig;;tRNA tRNA;;CDS-CDS;;400-600;Sup 600;Sup 600;Sup 800
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;;intercalaire;;intercalaire;;intercalaire;;frequence;effectif;;long;long;long
fxt;fct;cdc8;fx;fc;cdc8;fx40;fc40;cdc8;x-;c-;c;x;c;x;c;x;aa;c;aa;c;aa;c;aa;cdc8;fx;fc;fx;fc;fc
;1;0;0;39;0;0;39;-1;;71;75;258;CDS 16s;;16s 23s;;;tRNA contig;;tRNA contig;suite;tRNA tRNA;hors bloc;400;548;2485;608;601;805
;0;10;5;241;1;0;48;-2;;0;954;318;240;376;324;;;6;aac;6;aac;33;aca;410;6;9;625;602;808
;0;20;3;344;2;0;53;-3;;1;87;150;192;498;188;;;15;tta;15;tta;4;gta;420;7;15;636;602;815
;0;30;4;232;3;1;24;-4;1;51;1378;208;294;81;2* 265;;;7;atgf;7;atgf;6;gaa;430;7;8;646;604;816
;0;40;0;138;4;2;29;-5;;0;109;383;181;388;2* 325;;;9;gaa;9;gaa;**;aaa;440;7;12;655;606;826
;0;50;4;89;5;0;15;-6;;0;334;;181;;2* 221;;;5;gga;5;gga;;;450;4;13;658;610;828
;0;60;9;87;6;0;7;-7;;15;150;;780;;23s 5s;;;5;gta;5;gta;;;460;1;12;671;612;844
;1;70;6;73;7;0;11;-8;1;68;264;;5s CDS;;126;;;9;gac;9;gac;;;470;13;5;674;618;865
;1;80;11;66;8;0;13;-9;;0;67;;177;216;2* 127;;;14;aca;14;aca;;;480;7;4;677;619;871
;1;90;15;73;9;1;21;-10;;2;331;;273;;3* 202;;;10;tac;10;tac;;;490;2;10;679;624;884
;0;100;21;72;10;1;20;-11;;32;0;;452;;182;;;28;cta;28;cta;CDS-CDS;inf 50;500;5;5;685;628;890
;1;110;16;84;11;0;38;-12;;0;;;118;;16s tRNA;;;7;aga;7;aga;intercalaire;;510;2;3;689;630;910
;0;120;23;86;12;0;46;-13;;7;;;127;;55;;gca;89;caa;89;caa;c-;x-;520;1;11;695;634;916
;0;130;25;53;13;1;30;-14;;15;;;5s 16s;;tRNA 23s;;;3;tca;3;tca;-89;néant;530;1;9;695;635;962
;0;140;21;49;14;0;39;-15;;0;;;;161;376;;gca;6;ttc;6;ttc;-82;;540;3;5;702;637;964
1;1;150;15;53;15;0;36;-16;;2;;;16s CDS;;390;;gca;14;atgj;14;atgj;-71;;550;3;7;716;637;966
;0;160;23;44;16;0;28;-17;1;14;;;2;;5s tRNA;;;29;atgi;29;atgi;-62;;560;5;6;722;637;972
;0;170;24;38;17;1;45;-18;;0;;;294;;3* 6;;aac;7;cca;7;cca;-52;;570;1;4;723;641;987
;0;180;22;44;18;1;31;-19;;1;;;23s CDS;87;7;;aac;8;cac;8;cac;total;intercalaires;580;5;6;731;641;1001
;0;190;26;43;19;0;27;-20;;7;;;;;2* 5;;tta;7;aaa;**;aaa;;663,874;590;3;6;733;641;1003
;0;200;18;43;20;0;24;-21;;0;;;;;tRNA 5s;;;6;tgc;4;aac;ADN long;4,308,325;600;5;4;733;644;1007
1;0;210;22;36;21;1;24;-22;1;0;;;;;8;;gga;6;aac;5;gaa;%;15.4;;50;88;753;646;1018
;0;220;25;39;22;0;22;-23;;6;;;;;tRNA 16s;;;15;tta;5;gta;;;;;;766;646;1024
;0;230;14;30;23;0;28;-24;;1;;;;;2* 110;;atgi;7;atgf;11;gac;non RNA;191;;;;782;647;1044
;0;240;9;27;24;0;21;-25;;0;;;;;116;;atgj;9;gaa;14;aca;;;;;;787;648;1048
;0;250;15;30;25;1;27;-26;;6;;;;;23s tRNA;;;5;gga;9;tac;;;;;;789;648;1057
1;0;260;15;30;26;1;19;-27;;0;;;;;94;;aca;5;gta;10;gga;;;;;;798;649;1064
;1;270;18;30;27;0;19;-28;;1;;;;;8;;gga;9;gac;9;aga;;;;;;799;661;1082
;0;280;12;19;28;1;26;-29;;8;;;;;5s tRNA;;;14;aca;11;caa;;;;;;804;667;1117
;0;290;16;38;29;0;24;-30;;0;;;;;;353;aaa;9;tac;2;aaa;;;;;;805;685;1211
;0;300;17;23;30;0;22;-31;;1;;;;;tRNA tRNA;;intra;24;cta;18;tca;;;;;;837;689;1218
;0;310;7;29;31;0;20;-32;;5;;;;;2* 11;;atgi;24;ggc;8;agc;;;;;;873;695;1243
1;0;320;18;22;32;0;18;-33;;0;;;;;**;;tta;9;aga;85;cca;;;;;;877;702;1262
;0;330;14;30;33;0;13;-34;;0;;;;;;;;8;caa;60;tgg;;;;;;881;704;1347
;2;340;9;13;34;0;12;-35;;2;;;;;;;;2;aaa;5;cca;;;;;;885;708;1357
;0;350;6;15;35;0;17;-36;;0;;;;;;;;3;tca;3;atc;;;;;;887;716;1398
;0;360;16;18;36;0;14;-37;;0;;;;;;;;6;ttc;7;ttc;;;;;;899;718;1411
;0;370;7;16;37;0;13;-38;;1;;;;;;;;14;atgj;**;atgj;;;;;;903;723;1554
;0;380;6;17;38;0;11;-39;;0;;;;;;;;17;atgi;;;;;;;;918;731;1856
1;0;390;7;14;39;0;10;-40;;1;;;;;;;;8;cac;;;;;;;;927;743;
;0;400;4;18;40;0;10;-41;;0;;;;;;;;7;aaa;;;;;;;;940;752;
;2;reste;138;242;reste;674;1733;-42;;0;;;;;;;;7;tgc;;;;;;;;987;760;
5;11;total;686;2727;total;686;2727;-43;;0;;;;;;;;12;cgt;;;;;;;;1011;763;
5;8;diagr;548;2446;diagr;12;955;-44;;1;;;;;;;;**;gta;;;;;;;;1033;765;
0;0; t30;12;817;;;;-45;;0;;;;;;;;6;aac;;;;;;;;1078;774;
;;;;;;;;-46;;0;;;;;;;;15;tta;;;;;;;;1101;775;
;;Récapitulatif des effectifs;;;;;;-47;;2;;;;;;;;7;atgf;;;;;;;;1219;783;
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;8;gaa;;;;;;;;1258;795;
;x;686;4;0;690;;;-49;;0;;;;;;;;4;gga;;;;;;;;1271;796;
;c;2688;326;39;3053;;;-50;;0;;;;;;;;5;gta;;;;;;;;1405;;
;;;;;3743;348;;reste;;5;;;;;;;;10;gac;;;;;;;;;;
;;;;;;4091;;total;4;326;;;;;;;;9;ggc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;**;aga;;;;;;;;;;

cdc8 autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cdc8 autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cdc8;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
;;misc_f;1;795;182;*;
;;rRNA;978;1094;6;*;117
;;tRNA;1101;1175;6;*;aac
;;tRNA;1182;1267;15;*;tta
;;tRNA;1283;1358;7;*;atgf
;;tRNA;1366;1440;9;*;gaa
;;tRNA;1450;1523;5;*;gga
;;tRNA;1529;1604;5;*;gta
;;tRNA;1610;1686;9;*;gac
;;tRNA;1696;1770;14;*;aca
;;tRNA;1785;1869;10;*;tac
;;tRNA;1880;1963;28;*;cta
;;tRNA;1992;2068;7;*;aga
;;tRNA;2076;2151;89;*;caa
;;tRNA;2241;2329;3;*;tca
;;tRNA;2333;2408;6;*;ttc
;;tRNA;2415;2488;14;*;atgj
;;tRNA;2503;2579;29;*;atgi
;;tRNA;2609;2685;7;*;cca
;;tRNA;2693;2769;8;*;cac
;;tRNA;2778;2853;7;*;aaa
;;tRNA;2861;2934;6;*;tgc
;;tRNA;2941;3015;6;*;aac
;;tRNA;3022;3107;15;*;tta
;;tRNA;3123;3198;7;*;atgf
;;tRNA;3206;3280;9;*;gaa
;;tRNA;3290;3363;5;*;gga
;;tRNA;3369;3444;5;*;gta
;;tRNA;3450;3526;9;*;gac
;;tRNA;3536;3610;14;*;aca
;;tRNA;3625;3709;9;*;tac
;;tRNA;3719;3802;24;*;cta
;;tRNA;3827;3901;24;*;ggc
;;tRNA;3926;4002;9;*;aga
;;tRNA;4012;4087;8;*;caa
;;tRNA;4096;4171;2;*;aaa
;;tRNA;4174;4262;3;*;tca
;;tRNA;4266;4341;6;*;ttc
;;tRNA;4348;4421;14;*;atgj
;;tRNA;4436;4512;17;*;atgi
;;tRNA;4530;4606;8;*;cac
;;tRNA;4615;4690;7;*;aaa
;;tRNA;4698;4771;7;*;tgc
;;tRNA;4779;4855;12;*;cgt
;;tRNA;4868;4943;75;*;gta
fin;;CDS;5019;5432;;;
deb;;CDS;43312;43797;94;*;
;;misc_b;43892;44100;63;*;
fin;;CDS;44164;45882;;;
deb;;CDS;57549;58247;51;*;
;;misc_f;58299;58427;42;*;
fin;;CDS;58470;58976;;;
deb;;CDS;93984;94736;291;*;
;;misc_f;95028;95862;232;*;
;;misc_f;96095;96344;50;*;
;;misc_f;96395;96725;9;*;
;;misc_f;96735;97600;139;*;
;;rRNA;97740;97856;7;*;117
;;tRNA;97864;97938;6;*;aac
;;tRNA;97945;98030;15;*;tta
;;tRNA;98046;98121;7;*;atgf
;;tRNA;98129;98203;8;*;gaa
;;tRNA;98212;98285;4;*;gga
;;tRNA;98290;98365;5;*;gta
;;tRNA;98371;98447;10;*;gac
;;tRNA;98458;98532;9;*;ggc
;;tRNA;98542;98615;954;*;aga
fin;;CDS;99570;100409;;;
deb;comp;CDS;119142;119651;188;*;
;;regulatory;119840;119943;135;*;
fin;;CDS;120079;121272;;;
deb;;CDS;141169;142335;59;*;
;;regulatory;142395;142512;124;*;
fin;;CDS;142637;143242;;;
deb;;CDS;192887;194019;59;*;
;;regulatory;194079;194180;220;*;
fin;;CDS;194401;195936;;;
deb;;CDS;240412;241887;526;*;
;;regulatory;242414;242504;406;*;
fin;;CDS;242911;243228;;;
deb;comp;CDS;309950;310076;16;*;
;;misc_f;310093;310425;9;*;
;;misc_f;310435;311300;139;*;
;;rRNA;311440;311556;177;*;117
fin;;CDS;311734;312342;;0;
deb;;CDS;318620;320392;131;*;
;;regulatory;320524;320716;181;*;
fin;;CDS;320898;321650;;;
deb;comp;CDS;522666;523493;205;*;
;;regulatory;523699;523805;69;*;
fin;;CDS;523875;524195;;0;
deb;;CDS;605941;606543;375;*;
;;misc_b;606919;607151;63;*;
fin;;CDS;607215;609134;;;
deb;;CDS;727895;728629;644;*;
;;regulatory;729274;729350;262;*;
fin;;CDS;729613;730869;;;
deb;;CDS;801271;802068;383;*;
;;misc_b;802452;802685;49;*;
fin;;CDS;802735;803754;;;
deb;comp;CDS;861856;862620;258;*;
;;tRNA;862879;862969;87;*;agc
fin;;CDS;863057;863845;;;
deb;;CDS;869869;871935;594;*;
;;misc_b;872530;872740;225;*;
fin;;CDS;872966;873781;;;
deb;;CDS;1044480;1044926;147;*;
;;misc_b;1045074;1045320;122;*;
fin;;CDS;1045443;1047185;;;
deb;;CDS;1106477;1107451;240;*;
;;rRNA;1107692;1109194;324;*;1503
;;rRNA;1109519;1112415;92;*;2897
;;tRNA;1112508;1112581;8;*;gga
;;rRNA;1112590;1112706;273;*;117
fin;;CDS;1112980;1114998;;;
deb;;CDS;1157234;1158145;114;*;
;;ncRNA;1158260;1158440;182;*;
fin;;CDS;1158623;1159840;;0;
deb;comp;CDS;1196804;1198213;1378;*;
;comp;tRNA;1199592;1199674;318;*;ttg
fin;;CDS;1199993;1202641;;;
deb;;CDS;1235339;1235707;91;*;
;;regulatory;1235799;1235905;102;*;
fin;;CDS;1236008;1237213;;0;
deb;;CDS;1360996;1362075;141;*;
;;misc_b;1362217;1362455;67;*;
fin;;CDS;1362523;1365162;;;
deb;comp;CDS;1527009;1527185;53;*;
;comp;regulatory;1527239;1527335;341;*;
fin;comp;CDS;1527677;1528351;;;
deb;;CDS;1597387;1598331;288;*;
;;regulatory;1598620;1598726;105;*;
fin;;CDS;1598832;1599797;;;
deb;;CDS;1625872;1627965;660;*;
;;repeat_region;1628626;1629050;897;*;
fin;;CDS;1629948;1630766;;0;
deb;;CDS;1634212;1635180;151;*;
;;misc_b;1635332;1635584;72;*;
fin;;CDS;1635657;1636865;;0;
deb;;CDS;1682039;1682800;159;*;
;;misc_b;1682960;1683217;112;*;
fin;;CDS;1683330;1683569;;;
deb;;CDS;1719185;1719346;735;*;
;;repeat_region;1720082;1720376;117;*;
fin;;CDS;1720494;1721246;;;
deb;;CDS;1767472;1769328;81;*;
;;misc_b;1769410;1769650;65;*;
;;misc_b;1769716;1769951;84;*;
fin;;CDS;1770036;1771253;;;
deb;;CDS;1792609;1792920;92;*;
;;regulatory;1793013;1793105;99;*;
fin;;CDS;1793205;1793999;;;
deb;comp;CDS;1848320;1849117;112;*;
;comp;regulatory;1849230;1849335;91;*;
deb;comp;CDS;1849427;1850413;163;*;
;;regulatory;1850577;1850753;142;*;
deb;;CDS;1850896;1852626;109;*;
;;tRNA;1852736;1852816;334;*;cta
deb;;CDS;1853151;1853666;475;*;
;;regulatory;1854142;1854246;209;*;
fin;;CDS;1854456;1855490;;;
deb;comp;CDS;1862461;1863732;644;*;
;;repeat_region;1864377;1864796;406;*;
fin;;CDS;1865203;1865490;;0;
deb;comp;CDS;1883751;1884380;364;*;
;;regulatory;1884745;1884788;100;*;
fin;;CDS;1884889;1885857;;;
deb;comp;CDS;1900325;1901437;131;*;
;comp;regulatory;1901569;1901690;188;*;
deb;;CDS;1901879;1904362;88;*;
;;regulatory;1904451;1904562;141;*;
fin;;CDS;1904704;1906005;;;
deb;;CDS;1917211;1917642;430;*;
;;misc_b;1918073;1918284;162;*;
fin;;CDS;1918447;1919736;;;
deb;;CDS;1979975;1981282;85;*;
;;misc_b;1981368;1981630;125;*;
fin;;CDS;1981756;1982559;;;
deb;;CDS;1991720;1992457;110;*;
;;misc_b;1992568;1992775;252;*;
fin;;CDS;1993028;1994227;;;
deb;;CDS;2033932;2036589;53;*;
;;regulatory;2036643;2036745;109;*;
fin;;CDS;2036855;2038120;;;
deb;comp;CDS;2174937;2175227;130;*;
;comp;regulatory;2175358;2175457;617;*;
;;regulatory;2176075;2176164;52;*;
fin;;CDS;2176217;2176393;;0;
deb;comp;CDS;2183867;2184418;151;*;
;comp;misc_b;2184570;2184833;435;*;
fin;comp;CDS;2185269;2185667;;;
deb;comp;CDS;2186020;2186505;82;*;
;comp;regulatory;2186588;2186681;177;*;
fin;;CDS;2186859;2186990;;0;
deb;comp;CDS;2226535;2227569;253;*;
;comp;misc_b;2227823;2228036;218;*;
fin;comp;CDS;2228255;2229019;;0;
deb;comp;CDS;2242205;2243398;81;*;
;comp;regulatory;2243480;2243648;110;*;
fin;comp;CDS;2243759;2244376;;;
deb;comp;CDS;2309004;2310380;93;*;
;comp;regulatory;2310474;2310576;248;*;
fin;;CDS;2310825;2312171;;;
deb;comp;CDS;2323975;2324883;801;*;
;;misc_b;2325685;2325916;107;*;
fin;;CDS;2326024;2327505;;;
deb;comp;CDS;2460052;2461448;76;*;
;comp;misc_b;2461525;2461758;168;*;
fin;comp;CDS;2461927;2462130;;;
deb;comp;CDS;2499750;2501870;427;*;
;;regulatory;2502298;2502386;188;*;
fin;;CDS;2502575;2503942;;0;
deb;;CDS;2537491;2537691;179;*;
;;regulatory;2537871;2537960;53;*;
fin;;CDS;2538014;2538190;;;
deb;comp;CDS;2560005;2560577;182;*;
;comp;regulatory;2560760;2560861;105;*;
fin;comp;CDS;2560967;2562118;;;
deb;comp;CDS;2591255;2591626;103;*;
;comp;regulatory;2591730;2591840;331;*;
fin;comp;CDS;2592172;2593866;;0;
deb;comp;CDS;2628443;2629147;63;*;
;comp;regulatory;2629211;2629305;195;*;
fin;comp;CDS;2629501;2630373;;;
deb;comp;CDS;2730963;2731670;150;*;
;comp;tRNA;2731821;2731917;264;*;tga
fin;comp;CDS;2732182;2733021;;;
deb;comp;CDS;2754962;2756278;86;*;
;comp;misc_b;2756365;2756576;78;*;
fin;comp;CDS;2756655;2757476;;0;
deb;comp;CDS;2776950;2777333;227;*;
;;regulatory;2777561;2777658;54;*;
fin;;CDS;2777713;2777889;;;
deb;comp;CDS;2781702;2781962;296;*;
;;repeat_region;2782259;2782547;284;*;
fin;comp;CDS;2782832;2782990;;;
deb;comp;CDS;2886981;2887679;42;*;
;comp;misc_b;2887722;2887962;90;*;
fin;comp;CDS;2888053;2889456;;0;
deb;comp;CDS;2894447;2897554;91;*;
;comp;misc_b;2897646;2897878;174;*;
fin;comp;CDS;2898053;2898580;;;
deb;comp;CDS;2989453;2990454;58;*;
;comp;misc_b;2990513;2990768;133;*;
fin;comp;CDS;2990902;2992092;;;
deb;comp;CDS;3000110;3000763;328;*;
;;regulatory;3001092;3001193;72;*;
fin;;CDS;3001266;3002609;;;
deb;comp;CDS;3020733;3023294;277;*;
;comp;ncRNA;3023572;3023906;131;*;
deb;;CDS;3024038;3024715;150;*;
;comp;tRNA;3024866;3024940;94;*;aca
;comp;rRNA;3025035;3027932;188;*;2898
;comp;rRNA;3028121;3029623;376;*;1503
fin;;CDS;3030000;3030938;;0;
deb;comp;CDS;3132071;3137992;123;*;
;comp;regulatory;3138116;3138201;171;*;
fin;comp;CDS;3138373;3139776;;;
deb;comp;CDS;3174601;3175263;99;*;
;comp;regulatory;3175363;3175448;185;*;
deb;comp;CDS;3175634;3178552;117;*;
;comp;regulatory;3178670;3178755;127;*;
fin;comp;CDS;3178883;3180061;;;
deb;comp;CDS;3301782;3302912;227;*;
;comp;regulatory;3303140;3303320;52;*;
fin;comp;CDS;3303373;3304266;;;
deb;comp;CDS;3438913;3440304;144;*;
;comp;regulatory;3440449;3440628;271;*;
fin;comp;CDS;3440900;3442552;;;
deb;;CDS;3574620;3575798;143;*;
;comp;tmRNA;3575942;3576291;157;*;
fin;comp;CDS;3576449;3576904;;0;
deb;;CDS;3665386;3666267;77;*;
;;regulatory;3666345;3666519;177;*;
fin;;CDS;3666697;3667698;;;
deb;comp;CDS;3691428;3693545;581;*;
;comp;regulatory;3694127;3694212;402;*;
fin;comp;CDS;3694615;3695928;;;
deb;comp;CDS;3704323;3706989;75;*;
;comp;misc_b;3707065;3707327;301;*;
fin;comp;CDS;3707629;3708456;;;
deb;comp;CDS;3721959;3722636;579;*;
;comp;regulatory;3723216;3723299;232;*;
fin;comp;CDS;3723532;3724374;;;
deb;comp;CDS;3756858;3757937;295;*;
;;regulatory;3758233;3758348;174;*;
fin;;CDS;3758523;3759893;;0;
deb;;CDS;3805298;3806743;208;*;
;comp;tRNA;3806952;3807028;67;*;agg
fin;comp;CDS;3807096;3808790;;;
deb;comp;CDS;3837718;3838119;795;*;
;;regulatory;3838915;3839011;53;*;
fin;;CDS;3839065;3839241;;;
deb;comp;CDS;3875816;3876886;452;*;
;comp;rRNA;3877339;3877455;126;*;117
;comp;rRNA;3877582;3880479;265;*;2898
;comp;rRNA;3880745;3882247;192;*;1503
fin;comp;CDS;3882440;3883018;;;
deb;comp;CDS;3898798;3900297;129;*;
;comp;regulatory;3900427;3900606;66;*;
fin;comp;CDS;3900673;3901287;;;
deb;comp;CDS;3978202;3978723;161;*;
;comp;regulatory;3978885;3978970;840;*;
fin;comp;CDS;3979811;3980761;;;
deb;comp;CDS;4005267;4007204;83;*;
;comp;misc_b;4007288;4007534;65;*;
fin;comp;CDS;4007600;4008121;;;
deb;comp;CDS;4017523;4017714;118;*;
;comp;rRNA;4017833;4017949;127;*;117
;comp;rRNA;4018077;4020974;325;*;2898
;comp;rRNA;4021300;4022802;294;*;1503
fin;comp;CDS;4023097;4023291;;;
deb;;CDS;4135881;4136873;383;*;
;comp;tRNA;4137257;4137331;33;*;aca
;comp;tRNA;4137365;4137440;4;*;gta
;comp;tRNA;4137445;4137519;6;*;gaa
;comp;tRNA;4137526;4137601;331;*;aaa
fin;comp;CDS;4137933;4139222;;;
deb;;CDS;4178197;4178970;181;*;
;;rRNA;4179152;4180587;161;*;1436
;comp;rRNA;4180749;4180865;202;*;117
;comp;rRNA;4181068;4183958;221;*;2891
;comp;rRNA;4184180;4185682;110;*;1503
;comp;tRNA;4185793;4185869;11;*;atgi
;comp;tRNA;4185881;4185969;5;*;tta
;comp;rRNA;4185975;4186091;202;*;117
;comp;rRNA;4186294;4189191;376;*;2898
;comp;tRNA;4189568;4189643;68;*;gca
;comp;misc_f;4189712;4190683;11;*;
;comp;misc_f;4190695;4190811;54;*;
;;rRNA;4190866;4192222;55;*;1357
;;tRNA;4192278;4192353;944;*;gca
;;misc_f;4193298;4193707;18;*;
;;misc_f;4193726;4193858;352;*;
;;rRNA;4194211;4196212;72;*;2002
;;misc_f;4196285;4196423;100;*;
;;misc_f;4196524;4196885;57;*;
;;misc_f;4196943;4197075;351;*;
;;misc_f;4197427;4197972;7;*;
;;misc_f;4197980;4198700;48;*;
;;misc_f;4198749;4199044;211;*;
;;misc_f;4199256;4201580;139;*;
;;rRNA;4201720;4201836;127;*;117
fin;;CDS;4201964;4202473;;;
deb;;CDS;4202485;4203366;127;*;
;;misc_b;4203494;4203699;125;*;
fin;;CDS;4203825;4205096;;;
deb;;CDS;4205417;4205872;0;*;
;;tRNA;4205873;4205964;37;*;tcc
;;ncRNA;4206002;4206266;76;*;
fin;;CDS;4206343;4207980;;;
deb;comp;CDS;4209435;4210639;498;*;
;;rRNA;4211138;4212640;587;*;1503
fin;comp;CDS;4213228;4213837;;;
deb;comp;CDS;4213961;4214620;81;*;
;;rRNA;4214702;4216184;371;*;1483
;;misc_f;4216556;4217003;238;*;
;comp;misc_f;4217242;4217961;7;*;
;comp;misc_f;4217969;4218514;265;*;
;comp;tRNA;4218780;4218855;68;*;gca
;comp;misc_f;4218924;4219056;18;*;
;comp;misc_f;4219075;4219471;605;*;
;comp;rRNA;4220077;4221579;181;*;1503
deb;comp;CDS;4221761;4222206;388;*;
;;rRNA;4222595;4224097;325;*;1503
;;rRNA;4224423;4227320;182;*;2898
;;rRNA;4227503;4227619;6;*;117
;;tRNA;4227626;4227700;6;*;aac
;;tRNA;4227707;4227792;15;*;tta
;;tRNA;4227808;4227883;7;*;atgf
;;tRNA;4227891;4227965;9;*;gaa
;;tRNA;4227975;4228048;5;*;gga
;;tRNA;4228054;4228129;5;*;gta
;;tRNA;4228135;4228211;9;*;gac
;;tRNA;4228221;4228295;14;*;aca
;;tRNA;4228310;4228394;10;*;tac
;;tRNA;4228405;4228488;28;*;cta
;;tRNA;4228517;4228593;7;*;aga
;;tRNA;4228601;4228676;89;*;caa
;;tRNA;4228766;4228854;3;*;tca
;;tRNA;4228858;4228933;6;*;ttc
;;tRNA;4228940;4229013;14;*;atgj
;;tRNA;4229028;4229104;29;*;atgi
;;tRNA;4229134;4229210;7;*;cca
;;tRNA;4229218;4229294;8;*;cac
;;tRNA;4229303;4229378;353;*;aaa
;comp;rRNA;4229732;4229848;139;*;117
;comp;misc_f;4229988;4230853;1;*;
;comp;misc_f;4230855;4231585;11;*;
;comp;misc_f;4231597;4232010;584;*;
;;rRNA;4232595;4234095;221;*;1501
;;rRNA;4234317;4237214;127;*;2898
;;rRNA;4237342;4237458;216;*;117
fin;comp;CDS;4237675;4238859;;0;
deb;;CDS;4241605;4242144;780;*;
;;rRNA;4242925;4244456;265;*;1532
;;rRNA;4244722;4247618;202;*;2897
;;rRNA;4247821;4247937;5;*;117
;;tRNA;4247943;4248031;11;*;tta
;;tRNA;4248043;4248119;110;*;atgi
;;rRNA;4248230;4249732;202;*;1503
;;misc_f;4249935;4250480;184;*;
fin;;CDS;4250665;4250923;;;
deb;;CDS;4250940;4251038;87;*;
;comp;rRNA;4251126;4253130;390;*;2005
;comp;tRNA;4253521;4253596;68;*;gca
;comp;misc_f;4253665;4253797;18;*;
;comp;misc_f;4253816;4254229;294;*;
fin;;CDS;4254524;4254712;;;
deb;;CDS;4303117;4303305;167;*;
;;misc_f;4303473;4304013;15;*;
;;misc_f;4304029;4304286;145;*;
;;rRNA;4304432;4304548;6;*;117
;;tRNA;4304555;4304629;4;*;aac
;;tRNA;4304634;4304708;5;*;gaa
;;tRNA;4304714;4304789;5;*;gta
;;tRNA;4304795;4304871;11;*;gac
;;tRNA;4304883;4304957;14;*;aca
;;tRNA;4304972;4305056;9;*;tac
;;tRNA;4305066;4305139;10;*;gga
;;tRNA;4305150;4305226;9;*;aga
;;tRNA;4305236;4305311;11;*;caa
;;tRNA;4305323;4305398;2;*;aaa
;;tRNA;4305401;4305489;18;*;tca
;;tRNA;4305508;4305598;8;*;agc
;;tRNA;4305607;4305683;85;*;cca
;;tRNA;4305769;4305844;60;*;tgg
;;tRNA;4305905;4305981;5;*;cca
;;tRNA;4305987;4306063;3;*;atc
;;tRNA;4306067;4306142;7;*;ttc
;;tRNA;4306150;4306226;116;*;atgj
;;rRNA;4306343;4307677;2;*;1335
deb;;CDS;4307680;4308225;0;*;

cbc[modifier | modifier le wikicode]

cbc opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  5;;52;doubles;intercalaires
Clostridium botulinum CDC_297;;;NCBI;gtRNAdb;;
comp;1309334..1309408;;Glu;gag;;
;;;;;;
comp;1385938..1386012;;Asn;aac;;8
comp;1386021..1386134;;5s;;;108
comp;1386243..1389140;;23s;;;228
comp;1389369..1390866;;16s;;@1;
;;;;;;
comp;1392997..1393072;;Phe;ttc;;7
comp;1393080..1393193;;5s;;;108
comp;1393302..1396199;;23s;;;228
comp;1396428..1397925;;16s;;;
;;;;;;
comp;1408673..1408762;;Ser;tcc;;
;;;;;;
comp;1412183..1412259;;Arg;agg;;
;;;;;;
comp;1415464..1415540;;Arg;cgt;;84
comp;1415625..1415715;;Ser;agc;+;20
comp;1415736..1415826;;Ser;tca;2 agc;306
comp;1416133..1416223;;Ser;agc;2 tca;20
comp;1416244..1416334;;Ser;tca;@4;
;;;;;;
comp;1425969..1426044;;Ala;gca;;3
comp;1426048..1426124;;Met;atgi;;8
comp;1426133..1426246;;5s;;;79
comp;1426326..1427823;;16s;;@2;117
comp;1427941..1428051;;MNEGCDRILIVVARWQVSKNKKMLTKIKKRATIIKH;CDS 108pb;;
;;;;;;
;1694943..1695017;;Gln;cag;;
;;;;;;
comp;1722580..1722664;;Tyr;tac;;5
comp;1722670..1722745;;Thr;aca;;
;;;;;;
comp;1841437..1841510;;Cys;tgc;;
;;;;;;
comp;1842698..1842811;;5s;;;108
comp;1842920..1845817;;23s;;;228
comp;1846046..1847543;;16s;;;
;;;;;;
;1890534..1890608;;Glu;gaa;+;17
;1890626..1890701;;Val;gta;3 gaa;9
;1890711..1890787;;Asp;gac;3 gta;4
;1890792..1890867;;Thr;aca;3 gac;5
;1890873..1890947;;Glu;gaa;2 aca;18
;1890966..1891041;;Val;gta;;7
;1891049..1891125;;Asp;gac;;57
;1891183..1891257;;Glu;gaa;;17
;1891275..1891350;;Val;gta;;9
;1891360..1891436;;Asp;gac;;4
;1891441..1891516;;Thr;aca;;
;;;;;;
comp;1948153..1948228;;Pro;cca;;
;;;;;;
;1969157..1969245;;Leu;tta;;4
;1969250..1969325;;Met;atgf;+;53
;1969379..1969454;;Met;atgf;2 atgf;10
;1969465..1969541;;Met;atg;;
;;;;;;
;1987541..1989040;;16s;;@3;226
;1989267..1992166;;23s;;;93
;1992260..1992375;;5s;;;7
;1992383..1992457;;Asn;aac;+;27
;1992485..1992559;;Asn;aac;;
;;;;;;
;2013239..2013313;;Gly;ggg;;18
;2013332..2013407;;Thr;acc;;
;;;;;;
;2222515..2222590;;Trp;tgg;;
;;;;;;
;2294767..2294842;;Pro;cca;+;7
;2294850..2294923;;Gly;gga;2 cca;6
;2294930..2295006;;Arg;aga;2 gga;5
;2295012..2295087;;Lys;aag;;26
;2295114..2295189;;Pro;cca;;29
;2295219..2295292;;Gly;gga;;24
;2295317..2295393;;Arg;cga;;
;;;;;;
;2402556..2402631;;Val;gta;;5
;2402637..2402713;;Asp;gac;;3
;2402717..2402792;;Phe;ttc;;4
;2402797..2402871;;Gly;ggc;;9
;2402881..2402954;;Cys;tgc;;
;;;;;;
;2517305..2517391;;Leu;ttg;;
;;;;;;
;2548708..2548792;;Leu;ctc;;
;;;;;;
;2583298..2583388;;SeC;tga;;

cbc cumuls[modifier | modifier le wikicode]

cbc* cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;5;1;0;0
;16 23 5s 0;1;20;22;1
;16 atc gca;0;40;3;1
;16 23 5s a;3;60;2;0
;max a;2;80;0;0
;a doubles;1;100;1;0
;spéciaux;1;120;0;0
;total aas;6;140;0;0
sans ;opérons;17;160;0;0
;1 aa;10;180;0;0
;max a;11;200;0;0
;a doubles;4;;0;0
;total aas;46;;28;2
total aas;;52;;;
remarques;;4;;;
avec jaune;;;moyenne;17;15
;;;variance;19;
sans jaune;;;moyenne;15;
;;;variance;14;

cbc blocs[modifier | modifier le wikicode]

cbc* blocs;;;;
aac;8;7;-;
5s;108;108;108;226
23s;228;228;228;93
16s;;;-;7
;;;;
gca;3;;;
atgi;8;;;
5s;79;;;
16s;;;;

cbc distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;2;1-3 aas
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;gca
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;atgi
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;aac
ttc;;tcc;1;tac;;tgc;1;;ttc;1;tcc;;tac;1;tgc;1;;ttc;;tcc;;tac;;tgc;;ttc
atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;2;;atc;;acc;;aac;;agc;;aac2
ctc;1;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;;cgt;;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;4;ggc;1;;gtc;;gcc;;gac;;ggc;;>1aa
tta;;tca;;taa;;tga;1;;tta;1;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;atgf2
ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;;aga;1;;ata;;aca;;aaa;;aga;;
cta;;cca;1;caa;;cga;;;cta;;cca;2;caa;;cga;1;;cta;;cca;;caa;;cga;;
gta;;gca;;gaa;;gga;;;gta;4;gca;;gaa;3;gga;2;;gta;;gca;;gaa;;gga;;
ttg;1;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;
atgj;;acg;;aag;;agg;1;;atgj;1;acg;;aag;1;agg;;;atgj;;acg;;aag;;agg;;
ctg;;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;
gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;
cbc*;;10;;;;;10;;cbc*;36;;;;;;34;;cbc*;2;;;;;;2;

cbc données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cbc données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
tRNA-CDS;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA contig;;intercalaire;;frequence;effectif;;long;long;long
frequence;effectif;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;aa;c;aa;cbc;fx;fc;fx;fc;fc
fxt;fct;cbc;fx;fc;cbc;fx40;fc40;cbc;x-;c-;c;x;c;x;c;aa;c;;tRNA tRNA;hors bloc;400;547;2246;704;706;907
;0;0;1;24;0;1;24;-1;;72;1018;103;CDS 16s;;16s 23s;;tRNA contig;gca;84;cgt;410;10;20;707;711;913
;0;10;5;198;1;1;55;-2;;0;419;184;909;;3* 228;;3;atgi;20;agc;420;5;15;707;714;918
;0;20;2;293;2;2;38;-3;;0;732;35;387;;226;;**;aac;306;tca;430;8;17;713;719;925
1;0;30;11;166;3;0;14;-4;3;58;389;227;117;;23s 5s;;27;aac;20;agc;440;7;10;735;720;943
1;0;40;15;108;4;1;18;-5;;0;156;30;416;;3* 108;;**;;**;tca;450;10;17;735;720;948
;0;50;9;61;5;0;15;-6;1;0;164;90;570;;93;;;;5;tac;460;6;10;738;723;948
;2;60;11;83;6;0;11;-7;;4;276;431;5s CDS;;16s 5s;;;;**;aca;470;6;16;748;725;949
;2;70;13;65;7;0;3;-8;;40;162;584;363;;79;;;;17;gaa;480;5;10;756;726;950
;2;80;12;73;8;1;18;-9;;0;53;;;;5s tRNA;;;;9;gta;490;9;6;761;727;957
1;1;90;12;68;9;0;10;-10;;8;170;;;;8;aac;;;4;gac;500;4;11;785;728;960
;2;100;16;58;10;0;16;-11;;25;318;;;;7;ttc;;;5;aca;510;6;14;792;729;963
1;0;110;18;52;11;0;28;-12;;0;80;;;;8;atgi;;;18;gaa;520;8;12;805;734;1003
;0;120;19;66;12;0;44;-13;;3;172;;;;7;aac;;;7;gta;530;0;8;808;735;1009
;0;130;19;59;13;0;28;-14;;13;92;;;;;;;;57;gac;540;4;4;819;741;1013
;0;140;16;61;14;0;32;-15;;0;77;;;;;;;;17;gaa;550;5;5;826;745;1020
;2;150;15;64;15;0;36;-16;;1;142;;;;;CDS-CDS;inf 50;;9;gta;560;5;7;831;756;1025
;1;160;19;48;16;0;21;-17;;11;328;;;;;intercalaire;;;4;gac;570;3;6;832;772;1040
;3;170;15;48;17;0;26;-18;;0;187;;;;;c-;x-;;**;aca;580;1;8;837;781;1099
;1;180;17;46;18;1;30;-19;1;4;64;;;;;-62;-54;;4;tta;590;3;8;844;787;1105
1;1;190;19;32;19;0;24;-20;;11;82;;;;;-56;;;53;atgf;600;3;8;856;788;1107
;0;200;20;39;20;1;24;-21;;0;51;;;;;-56;;;10;atgf;610;4;10;876;801;1117
;0;210;17;44;21;2;17;-22;;2;239;;;;;-55;;;**;atgj;620;0;3;897;802;1181
;0;220;16;31;22;1;21;-23;;8;145;;;;;total;intercalaires;;18;ggg;630;3;4;897;807;1391
1;0;230;15;40;23;1;14;-24;;0;387;;;;;;696,513;;**;acc;640;4;5;905;811;1506
;1;240;7;36;24;0;20;-25;;1;64;;;;;ADN long;3,892,029;;7;cca;650;3;3;915;813;1800
;0;250;15;18;25;0;22;-26;;6;313;;;;;%;17.9;;6;gga;660;1;4;916;815;2050
;0;260;12;22;26;1;13;-27;;0;97;;;;;;;;5;aga;670;2;5;919;818;2620
;0;270;14;35;27;3;17;-28;;2;556;;;;;non RNA;0;;26;aag;680;2;4;934;826;
;1;280;15;31;28;0;18;-29;;2;754;;;;;;;;29;cca;690;2;6;976;831;
;0;290;12;29;29;2;12;-30;;0;745;;;;;;;;24;gga;700;3;4;1004;831;
;0;300;18;27;30;1;12;-31;;2;;;;;;;;;**;cga;;40;66;1033;849;
;0;310;11;29;31;2;9;-32;;3;;;;;;;;;5;gta;;;;1085;858;
;2;320;16;21;32;0;9;-33;;0;;;;;;;;;3;gac;;;;1107;860;
;1;330;23;18;33;1;12;-34;;1;;;;;;;;;4;ttc;;;;1126;862;
;0;340;12;14;34;3;13;-35;;1;;;;;;;;;9;ggc;;;;1161;864;
;0;350;9;25;35;1;13;-36;;0;;;;;;;;;**;tgc;;;;1177;890;
;0;360;10;27;36;4;12;-37;;0;;;;;;;;;;;;;;1482;892;
;0;370;13;24;37;1;11;-38;;3;;;;;;;;;;;;;;1485;;
;0;380;12;22;38;1;6;-39;;0;;;;;;;;;;;;;;1525;;
;2;390;8;19;39;2;12;-40;;0;;;;;;;;;;;;;;;;
;0;400;8;22;40;0;11;-41;;0;;;;;;;;;;;;;;;;
2;6;reste;172;326;reste;685;1783;-42;;0;;;;;;;;;;;;;;;;
8;30;total;719;2572;total;719;2572;-43;;0;;;;;;;;;;;;;;;;
;;diagr;;;diagr;;;-44;1;1;;;;;;;;;;;;;;;;
;; t30;;;;;;-45;;0;;;;;;;;;;;;;;;;
;;;;;;;;-46;;0;;;;;;;;;;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;;1;;;;;;;;;;;;;;;;
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;;;;;;;;
;x;718;7;1;720;;;-49;;0;;;;;;;;;;;;;;;;
;c;2548;288;24;2860;;;-50;;1;;;;;;;;;;;;;;;;
;;;;;3580;88;;reste;1;4;;;;;;;;;;;;;;;;
;;;;;;3668;;total;7;288;;;;;;;;;;;;;;;;

cbc autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cbc autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cbc;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;comp;CDS;1307968;1308315;1018;*;
;comp;tRNA;1309334;1309408;419;*;gag
fin;comp;CDS;1309828;1312056;;;
deb;;CDS;1384971;1385834;103;*;
;comp;tRNA;1385938;1386012;8;*;aac
;comp;rRNA;1386021;1386134;108;*;114
;comp;rRNA;1386243;1389140;228;*;2898
;comp;rRNA;1389369;1390866;909;*;1498
deb;comp;CDS;1391776;1392264;732;*;
;comp;tRNA;1392997;1393072;7;*;ttc
;comp;rRNA;1393080;1393193;108;*;114
;comp;rRNA;1393302;1396199;228;*;2898
;comp;rRNA;1396428;1397925;387;*;1498
fin;comp;CDS;1398313;1399257;;;
deb;comp;CDS;1406658;1408283;389;*;
;comp;tRNA;1408673;1408762;156;*;tcc
fin;comp;CDS;1408919;1409365;;;
deb;comp;CDS;1411833;1412018;164;*;
;comp;tRNA;1412183;1412259;184;*;agg
fin;;CDS;1412444;1412764;;;
deb;;CDS;1414541;1415428;35;*;
;comp;tRNA;1415464;1415540;84;*;cgt
;comp;tRNA;1415625;1415715;20;*;agc
;comp;tRNA;1415736;1415826;306;*;tca
;comp;tRNA;1416133;1416223;20;*;agc
;comp;tRNA;1416244;1416334;276;*;tca
fin;comp;CDS;1416611;1417891;;;
deb;comp;CDS;1425354;1425806;162;*;
;comp;tRNA;1425969;1426044;3;*;gca
;comp;tRNA;1426048;1426124;8;*;atgi
;comp;rRNA;1426133;1426246;79;*;114
;comp;rRNA;1426326;1427823;117;*;1498
fin;comp;CDS;1427941;1428051;;;
deb;;CDS;1694365;1694889;53;*;
;;tRNA;1694943;1695017;170;*;cag
fin;;CDS;1695188;1695592;;;
deb;comp;CDS;1721086;1722261;318;*;
;comp;tRNA;1722580;1722664;5;*;tac
;comp;tRNA;1722670;1722745;227;*;aca
fin;;CDS;1722973;1723695;;;
deb;;CDS;1840498;1841406;30;*;
;comp;tRNA;1841437;1841510;80;*;tgc
deb;comp;CDS;1841591;1842334;363;*;
;comp;rRNA;1842698;1842811;108;*;114
;comp;rRNA;1842920;1845817;228;*;2898
;comp;rRNA;1846046;1847543;416;*;1498
fin;comp;CDS;1847960;1850440;;;
deb;;CDS;1889552;1890361;172;*;
;;tRNA;1890534;1890608;17;*;gaa
;;tRNA;1890626;1890701;9;*;gta
;;tRNA;1890711;1890787;4;*;gac
;;tRNA;1890792;1890867;5;*;aca
;;tRNA;1890873;1890947;18;*;gaa
;;tRNA;1890966;1891041;7;*;gta
;;tRNA;1891049;1891125;57;*;gac
;;tRNA;1891183;1891257;17;*;gaa
;;tRNA;1891275;1891350;9;*;gta
;;tRNA;1891360;1891436;4;*;gac
;;tRNA;1891441;1891516;90;*;aca
fin;comp;CDS;1891607;1892584;;;
deb;comp;CDS;1946711;1948060;92;*;
;comp;tRNA;1948153;1948228;77;*;cca
fin;comp;CDS;1948306;1948614;;;
deb;;CDS;1968610;1969014;142;*;
;;tRNA;1969157;1969245;4;*;tta
;;tRNA;1969250;1969325;53;*;atgf
;;tRNA;1969379;1969454;10;*;atgf
;;tRNA;1969465;1969541;328;*;atgj
fin;;CDS;1969870;1972257;;;
deb;;CDS;1985594;1986970;570;*;
;;rRNA;1987541;1989040;226;*;1500
;;rRNA;1989267;1992166;93;*;2900
;;rRNA;1992260;1992375;7;*;116
;;tRNA;1992383;1992457;27;*;aac
;;tRNA;1992485;1992559;187;*;aac
fin;;CDS;1992747;1994819;;;
deb;;CDS;2012533;2013174;64;*;
;;tRNA;2013239;2013313;18;*;ggg
;;tRNA;2013332;2013407;82;*;acc
fin;;CDS;2013490;2014683;;;
deb;;CDS;2222077;2222463;51;*;
;;tRNA;2222515;2222590;239;*;tgg
fin;;CDS;2222830;2224086;;0;
deb;;CDS;2294151;2294621;145;*;
;;tRNA;2294767;2294842;7;*;cca
;;tRNA;2294850;2294923;6;*;gga
;;tRNA;2294930;2295006;5;*;aga
;;tRNA;2295012;2295087;26;*;aag
;;tRNA;2295114;2295189;29;*;cca
;;tRNA;2295219;2295292;24;*;gga
;;tRNA;2295317;2295393;387;*;cga
fin;;CDS;2295781;2297040;;;
deb;;CDS;2401601;2402491;64;*;
;;tRNA;2402556;2402631;5;*;gta
;;tRNA;2402637;2402713;3;*;gac
;;tRNA;2402717;2402792;4;*;ttc
;;tRNA;2402797;2402871;9;*;ggc
;;tRNA;2402881;2402954;313;*;tgc
fin;;CDS;2403268;2403963;;;
deb;comp;CDS;2515386;2516873;431;*;
;;tRNA;2517305;2517391;584;*;ttg
fin;comp;CDS;2517976;2518125;;;
deb;;CDS;2548065;2548610;97;*;
;;tRNA;2548708;2548792;556;*;ctc
fin;;CDS;2549349;2549786;;0;
deb;;CDS;2580636;2582543;754;*;
;;tRNA;2583298;2583388;745;*;tga
fin;;CDS;2584134;2585648;;;

cbn[modifier | modifier le wikicode]

cbn opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  10;86;doubles;intercal;aa;avec aa
;Clostridium botulinum BKT015925;;;;;;
;20666..20741;;acg;;;;
;;;;;;;
;36413..36487;;gaa;+;12;12;
;36500..36575;;gta;2 gaa;13;13;
;36589..36665;;gac;2 gta;5;5;
;36671..36746;;aca;2 gac;18;18;
;36765..36839;;gaa;2 aca;12;12;
;36852..36927;;gta;;13;13;
;36941..37017;;gac;;5;5;
;37023..37098;;aca;;;;
;;;;;;;
;137366..137441;;cca;;;;
;;;;;;;
;161964..162052;;tta;+;5;5;
;162058..162133;;atgf;3 tta;5;5;
;162139..162215;;atgj;3 atgf;46;46;
;162262..162350;;tta;2 atgj;5;5;
;162356..162431;;atgf;;30;30;
;162462..162538;;atgj;;46;46;
;162585..162673;;tta;;5;5;
;162679..162754;;atgf;;;;
;;;;;;;
;76258..176332;;aac;;;;
;;;;;;;
;180177..181695;;16s;@5;233;;
;181929..184836;;23s;;45;;
;184882..184956;;aac;+;14;;
;184971..185087;;5s;;7;;
;185095..185169;;aac;2 aac;;;
;;;;;;;
;222409..222484;;acc;;;;
;;;;;;;
comp;578417..578492;;cag;;;;
;;;;;;;
comp;944747..944833;;ttg;;;;
;;;;;;;
;955546..955630;;ctt;;;;
;;;;;;;
;1026946..1027021;;gta;;17;17;17
;1027039..1027115;;gac;;14;14;14
;1027130..1027205;;ttc;;4;4;4
;1027210..1027284;;ggc;;8;8;8
;1027293..1027367;;tgc;+;57;57;57
;1027425..1027499;;tgc;2 tgc;;;
;;;;;;;
comp;2030816..2030890;;aac;;45;;
comp;2030936..2033842;;23s;;96;;
comp;2033939..2034015;;atc;;7;;7
comp;2034023..2034098;;gca;;121;;
comp;2034220..2035734;;16s;;;;
;;;;;;;
comp;2283768..2283884;;5s;;95;;
comp;2283980..2286886;;23s;;233;;
comp;2287120..2288638;;16s;@3;464;;
comp;2289103..2289176;;gga;;15;;15
comp;2289192..2289268;;atc;;7;;7
comp;2289276..2289351;;gca;;;;
;;;;;;;
comp;2350598..2350674;;cga;+;21;21;
comp;2350696..2350769;;gga;4 gga;28;28;
comp;2350798..2350873;;aaa;2 aaa;4;4;
comp;2350878..2350952;;caa;2 caa;4;4;
comp;2350957..2351032;;cac;2 cac;5;5;
comp;2351038..2351112;;aag;3 aag;3;3;
comp;2351116..2351192;;aga;3 aga;6;6;
comp;2351199..2351272;;gga;2 cca;4;4;
comp;2351277..2351352;;cca;2 ggc;21;21;
comp;2351374..2351449;;aag;;5;5;
comp;2351455..2351531;;aga;;5;5;
comp;2351537..2351610;;gga;;5;5;
comp;2351616..2351690;;ggc;;3;3;
comp;2351694..2351777;;cta;;22;22;
comp;2351800..2351875;;aaa;;4;4;
comp;2351880..2351954;;caa;;4;4;
comp;2351959..2352034;;cac;;5;5;
comp;2352040..2352115;;aag;;5;5;
comp;2352121..2352197;;aga;;5;5;
comp;2352203..2352276;;gga;;5;5;
comp;2352282..2352356;;ggc;;6;6;
comp;2352363..2352438;;cca;;;;
;;;;;;;
comp;2432784..2432859;;tgg;;;;
;;;;;;;
comp;2454880..2454964;;tac;+;39;39;
comp;2455004..2455079;;gta;2 tac;8;8;
comp;2455088..2455172;;tac;;4;4;
comp;2455177..2455252;;aca;;;;
;;;;;;;
comp;2697795..2697911;;5s;@1;31;;
comp;2697943..2700847;;23s;;233;;
comp;2701081..2702599;;16s;;;;
;;;;;;;
comp;2703946..2704021;;aaa;;311;;311
comp;2704333..2704408;;ttc;;5;;
comp;2704414..2704530;;5s;;336;;
comp;2704867..2704942;;ttc;;5;;
comp;2704948..2705064;;5s;;97;;
comp;2705162..2708066;;23s;;233;;
comp;2708300..2709814;;16s;;;;
;;;;;;;
comp;2721253..2721328;;aaa;@2;5;;
comp;2721334..2721450;;5s;;95;;
comp;2721546..2724452;;23s;;233;;
comp;2724686..2726203;;16s;;;;
;;;;;;;
comp;2731902..2731976;;gag;;61;;61
comp;2732038..2732112;;caa;;6;;6
comp;2732119..2732195;;aga;;4;;4
comp;2732200..2732273;;gga;;19;;19
comp;2732293..2732376;;cta;;16;;16
comp;2732393..2732467;;gaa;;4;;
comp;2732472..2732588;;5s;;97;;
comp;2732686..2735592;;23s;@4;94;;
comp;2735687..2735763;;atc;;3;;
comp;2735767..2735842;;gca;;74;;
comp;2735917..2737435;;16s;;;;
;;;;;;;
comp;2742262..2742351;;tcc;;;;
;;;;;;;
comp;2743220..2743312;;tcg;;;;
;;;;;;;
comp;2743891..2743967;;agg;;;;
;;;;;;;
comp;2748534..2748610;;cgt;;144;144;
comp;2748755..2748845;;agc;;23;23;
comp;2748869..2748959;;tca;+;69;69;
comp;2749029..2749119;;tca;2 tca;;;
;;;;;;;
comp;2758688..2758763;;gca;;4;;4
comp;2758768..2758844;;atgi;;3;;
comp;2758848..2758964;;5s;;73;;
comp;2759038..2761942;;23s;;233;;
comp;2762176..2763694;;16s;;;;
;;;;;;;
comp;2150504..2150620;;5s;;31;;
comp;2150652..2153560;;23s;;233;;
comp;2153794..2155308;;16s;;;;
;;;;;;;
comp;2169525..2169641;;5s;;32;;
comp;2169674..2172579;;23s;;233;;
comp;2172813..2174331;;16s;;;;
;;;;;;;
sur plasmide;;;tgg;;;;

cbn cumuls[modifier | modifier le wikicode]

cbn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;10;1;0;0
;16 23 5s 0;3;20;34;9
;16 gca atc;2;40;7;0
;16 23 5s a;4;60;3;0
;max a;8;80;1;1
;a doubles;1;100;0;0
;spéciaux;1;120;0;0
;total aas;22;140;0;0
sans ;opérons;18;160;1;0
;1 aa;12;180;0;0
;max a;22;200;0;0
;a doubles;6;;0;0
;total aas;64;;46;10
total aas;;86;;;
remarques;;5;;;
avec jaune;;;moyenne;17;
;;;variance;25;
sans jaune;;;moyenne;14;14
;;;variance;15;17

cbn blocs[modifier | modifier le wikicode]

cbn blocs;;;;;;
5s;31;31;32;;;
23s;233;233;233;;;
16s;;;;;;
;;;;;ttc;5
;;;;;5s;336
aaa;5;3;;;ttc;5
5s;95;73;5s;95;5s;97
23s;233;233;23s;233;23s;233
16s;aaa;atgi;16s;464;16s;
;;;gga;15;;
16s;233;;;;;
23s;45;;;;;
aac;14;;;;;
5s;7;;;;;
aac;;;;;;
gaa;4;;;;;
5s;97;aac;45;;;
23s;94;23s;96;;;
atc;3;atc;7;;;
gca;74;gca;121;;;
16s;;16s;;;;

cbn distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;;avant 5s;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;2 aac;att;;act;;aat;;agt;
ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;1;tcc;;tac;2;tgc;;;ttc;;tcc;;tac;;tgc;2;4-8 aas;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;;gag;atc;;acc;;aac;;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;1;;ctc;;ccc;;cac;;cgt;;caa;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;3;ggc;3;;gtc;;gcc;;gac;;ggc;;aga;gtc;;gcc;;gac;;ggc;
tta;;tca;;taa;;tga;;;tta;3;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;;gga;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;2;aga;3;;ata;;aca;;aaa;;aga;;cta;ata;;aca;;aaa;;aga;1
cta;;cca;1;caa;;cga;;;cta;1;cca;2;caa;2;cga;1;;cta;;cca;;caa;;cga;;gaa;cta;1;cca;;caa;1;cga;
gta;;gca;;gaa;;gga;;;gta;4;gca;;gaa;2;gga;4;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;>1aa;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;;atgj;2;acg;;aag;3;agg;;;atgj;;acg;;aag;;agg;;tgc2;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;tca2;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;1;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cbn;;12;;;;;12;;cbn;48;;;;;;48;;cbn;4;;;;;;4;;cbn;;;;6;;;6

cbn données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cbn données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA tRNA;;reste;Sup 400;Sup 500
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;cbn;long;long;long
fxt;fct;cbn;fx;fc;cbn;fx40;fc40;cbn;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;fx;fc;fc
;0;0;1;10;0;1;10;-1;0;34;214;206;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;hors bloc;404;407;502
;0;10;10;172;1;1;37;-2;0;0;168;307;453;111;8* 237;;311;aaa;12;gaa;405;409;507
;0;20;3;211;2;1;31;-3;0;0;131;106;423;111;23s 5s;;**;ttc;13;gta;407;412;508
;0;30;19;147;3;2;13;-4;0;28;158;480;424;;2* 34;;61;gag;5;gac;415;419;526
;0;40;24;90;4;2;12;-5;0;0;115;435;423;;35;;6;caa;18;aca;419;420;532
;0;50;33;61;5;0;17;-6;1;0;275;60;346;;2* 98;;4;aga;12;gaa;420;421;533
1;2;60;28;67;6;0;13;-7;0;5;140;348;393;;2* 100;;19;gga;13;gta;424;426;533
;5;70;26;71;7;1;11;-8;1;30;106;104;402;;76;;16;cta;5;gac;447;431;536
;2;80;17;53;8;0;9;-9;1;0;67;117;369;;16s tRNA;;**;gaa;**;aca;452;438;537
;1;90;13;59;9;1;10;-10;0;6;261;255;5s CDS;;124;gca;4;gca;5;tta;454;443;537
;1;100;18;68;10;2;19;-11;2;13;59;130;128;590;77;gca;**;atgi;5;atgf;457;447;538
2;1;110;12;42;11;0;22;-12;1;0;82;;138;144;tRNA 23s;;;;46;atgj;465;449;543
1;2;120;16;50;12;0;32;-13;0;2;379;;;;97;atc;;;5;tta;471;449;546
1;1;130;24;50;13;0;22;-14;0;7;265;;;;95;atc;;;30;atgf;473;450;558
;2;140;4;50;14;0;22;-15;0;0;233;;;;5s tRNA;;;;46;atgj;486;450;569
;0;150;11;50;15;0;23;-16;0;3;199;;;;7;aac;;;5;tta;490;450;570
;1;160;7;45;16;1;20;-17;1;10;73;;;;13;ttc;;;**;atgf;493;453;572
;1;170;16;48;17;1;16;-18;0;0;295;;;;15;ttc;;;17;gta;493;454;574
;0;180;16;36;18;0;20;-19;0;2;58;;;;5;aaa;;;14;gac;493;456;574
;1;190;12;42;19;1;14;-20;0;7;324;;;;4;gaa;;;4;ttc;500;461;582
;1;200;15;31;20;0;20;-21;1;0;183;;;;3;atgi;;;8;ggc;502;462;655
1;0;210;11;27;21;0;20;-22;0;1;80;;;;23s tRNA;;;;57;tgc;504;464;680
;1;220;12;29;22;1;17;-23;0;2;245;;;;2* 48;aac;;;**;tgc;510;468;703
;0;230;11;30;23;3;12;-24;0;0;408;;;;tRNA 5s;;;;15;gga;513;479;710
;1;240;15;19;24;1;13;-25;0;1;111;;;;336;ttc;;;7;atc;532;479;745
;1;250;14;14;25;1;19;-26;0;2;64;;;;14;aac;;;**;gca;534;479;747
1;0;260;14;16;26;2;10;-27;1;0;69;;;;tRNA tRNA;intra;;;21;cga;539;481;753
;2;270;11;10;27;3;17;-28;0;1;65;;;;7;gca atc;;;28;gga;540;484;759
;1;280;6;8;28;3;13;-29;0;5;95;;;;3;gca atc;;;4;aaa;556;487;777
;0;290;9;10;29;2;12;-30;0;0;61;;;;;;;;4;caa;563;488;
;1;300;11;21;30;3;14;-31;0;1;125;;;;;;;;5;cac;567;491;
1;0;310;4;7;31;2;11;-32;0;1;;;;;;;CDS-CDS;inf 50;3;aag;573;498;
;0;320;5;7;32;2;5;-33;0;0;;;;;;;intercalaire;;6;aga;576;500;
;1;330;5;11;33;4;11;-34;0;0;;;;;;;c-;x-;4;gga;581;;
;0;340;11;5;34;0;8;-35;0;2;;;;;;;néant;néant;21;cca;600;;
1;0;350;4;9;35;1;6;-36;0;0;;;;;;;total;intercalaires;5;aag;619;;
;0;360;2;12;36;3;8;-37;0;0;;;;;;;;330,729;5;aga;625;;
;0;370;6;8;37;2;11;-38;0;0;;;;;;;ADN long;2,773,157;5;gga;626;;
;1;380;6;7;38;1;8;-39;0;0;;;;;;;%;11.9;3;ggc;652;;
;0;390;1;6;39;7;10;-40;0;0;;;;;;;;;22;cta;696;;
;0;400;5;4;40;2;12;-41;0;1;;;;;;;non RNA;4;4;aaa;723;;
2;1;reste;52;62;reste;483;1145;-42;0;0;;;;;;;;;4;caa;730;;
11;31;total;540;1775;total;540;1775;-43;0;0;;;;;;;;;5;cac;748;;
9;30;diagr;487;1703;diagr;56;620;-44;0;1;;;;;;;;;5;aag;751;;
0;0; t30;32;530;;;;-45;0;0;;;;;;;;;5;aga;826;;
;;;;;;;;-46;0;1;;;;;;;;;5;gga;836;;
;;Récapitulatif des effectifs;;;;;;-47;0;1;;;;;;;;;6;ggc;856;;
;;>0;<0;zéro;total;*;;-48;0;0;;;;;;;;;**;cca;952;;
;x;539;9;1;549;;;-49;0;0;;;;;;;;;39;tac;1025;;
;c;1765;167;10;1942;;;-50;0;0;;;;;;;;;8;gta;1149;;
;;;;;2491;147;;reste;0;0;;;;;;;;;4;tac;1270;;
;;;;;;2638;;total;9;167;;;;;;;;;**;aca;1443;;
;;;;;;;;;;;;;;;;;;;144;cgt;;;
;;;;;;;;;;;;;;;;;;;23;agc;;;
;;;;;;;;;;;;;;;;;;;69;tca;;;
;;;;;;;;;;;;;;;;;;;**;tca;;;

cbn autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cbn autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cbn;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;comp;CDS;20118;20459;206;*;
;;tRNA;20666;20741;214;*;acg
fin;;CDS;20956;21813;;;
deb;comp;CDS;34861;36105;307;*;
;;tRNA;36413;36487;12;*;gaa
;;tRNA;36500;36575;13;*;gta
;;tRNA;36589;36665;5;*;gac
;;tRNA;36671;36746;18;*;aca
;;tRNA;36765;36839;12;*;gaa
;;tRNA;36852;36927;13;*;gta
;;tRNA;36941;37017;5;*;gac
;;tRNA;37023;37098;106;*;aca
fin;comp;CDS;37205;38164;;;
deb;comp;CDS;135851;137197;168;*;
;comp;tRNA;137366;137441;131;*;cca
fin;comp;CDS;137573;137743;;0;
deb;;CDS;161395;161805;158;*;
;;tRNA;161964;162052;5;*;tta
;;tRNA;162058;162133;5;*;atgf
;;tRNA;162139;162215;46;*;atgj
;;tRNA;162262;162350;5;*;tta
;;tRNA;162356;162431;30;*;atgf
;;tRNA;162462;162538;46;*;atgj
;;tRNA;162585;162673;5;*;tta
;;tRNA;162679;162754;480;*;atgf
fin;comp;CDS;163235;163759;;0;
deb;;CDS;174610;176142;115;*;
;;tRNA;176258;176332;275;*;aac
fin;;CDS;176608;177999;;;
deb;;CDS;178351;179727;453;*;
;;rRNA;180181;181692;237;*;16s
;;rRNA;181930;184833;48;*;23s
;;tRNA;184882;184956;14;*;aac
;;rRNA;184971;185087;7;*;5s
;;tRNA;185095;185169;435;*;aac
fin;comp;CDS;185605;186639;;0;
deb;;CDS;221558;222268;140;*;
;;tRNA;222409;222484;106;*;aac
fin;;CDS;222591;223772;;;
deb;;CDS;577193;578356;60;*;
;comp;tRNA;578417;578492;67;*;cag
fin;comp;CDS;578560;579072;;;
deb;comp;CDS;943937;944485;261;*;
;comp;tRNA;944747;944833;348;*;ttg
fin;;CDS;945182;945985;;;
deb;;CDS;954881;955486;59;*;
;;tRNA;955546;955630;82;*;ctt
fin;;CDS;955713;956147;;;
deb;;CDS;1025682;1026566;379;*;
;;tRNA;1026946;1027021;17;*;gta
;;tRNA;1027039;1027115;14;*;gac
;;tRNA;1027130;1027205;4;*;ttc
;;tRNA;1027210;1027284;8;*;ggc
;;tRNA;1027293;1027367;57;*;tgc
;;tRNA;1027425;1027499;265;*;tgc
fin;;CDS;1027765;1027989;;;
deb;;CDS;1679540;1680001;6;*;
;comp;gene;1680008;1681575;128;*;
fin;comp;CDS;1681704;1683125;;;
deb;;CDS;1865810;1866349;45;*;
;;gene;1866395;1867531;88;*;
fin;comp;CDS;1867620;1868972;;;
deb;;CDS;2029941;2030711;104;*;
;comp;tRNA;2030816;2030890;48;*;aac
;comp;rRNA;2030939;2033841;97;*;23s
;comp;tRNA;2033939;2034015;7;*;atc
;comp;tRNA;2034023;2034098;124;*;gca
;comp;rRNA;2034223;2035730;423;*;16s
fin;comp;CDS;2036154;2036600;;;
deb;comp;CDS;2149914;2150375;128;*;
;comp;rRNA;2150504;2150620;34;*;5s
;comp;rRNA;2150655;2153559;237;*;23s
;comp;rRNA;2153797;2155304;424;*;16s
fin;comp;CDS;2155729;2156664;;0;
deb;;CDS;2168490;2168942;590;*;
;comp;rRNA;2169533;2169641;35;*;5s
;comp;rRNA;2169677;2172578;237;*;23s
;comp;rRNA;2172816;2174327;111;*;16s
fin;;CDS;2174439;2174690;;;
deb;;CDS;2281037;2283634;144;*;
;comp;rRNA;2283779;2283884;98;*;5s
;comp;rRNA;2283983;2286885;237;*;23s
;comp;rRNA;2287123;2288634;111;*;16s
deb;;CDS;2288746;2288985;117;*;
;comp;tRNA;2289103;2289176;15;*;gga
;comp;tRNA;2289192;2289268;7;*;atc
;comp;tRNA;2289276;2289351;233;*;gca
fin;comp;CDS;2289585;2290127;;0;
deb;comp;CDS;2349136;2350398;199;*;
;comp;tRNA;2350598;2350674;21;*;cga
;comp;tRNA;2350696;2350769;28;*;gga
;comp;tRNA;2350798;2350873;4;*;aaa
;comp;tRNA;2350878;2350952;4;*;caa
;comp;tRNA;2350957;2351032;5;*;cac
;comp;tRNA;2351038;2351112;3;*;aag
;comp;tRNA;2351116;2351192;6;*;aga
;comp;tRNA;2351199;2351272;4;*;gga
;comp;tRNA;2351277;2351352;21;*;cca
;comp;tRNA;2351374;2351449;5;*;aag
;comp;tRNA;2351455;2351531;5;*;aga
;comp;tRNA;2351537;2351610;5;*;gga
;comp;tRNA;2351616;2351690;3;*;ggc
;comp;tRNA;2351694;2351777;22;*;cta
;comp;tRNA;2351800;2351875;4;*;aaa
;comp;tRNA;2351880;2351954;4;*;caa
;comp;tRNA;2351959;2352034;5;*;cac
;comp;tRNA;2352040;2352115;5;*;aag
;comp;tRNA;2352121;2352197;5;*;aga
;comp;tRNA;2352203;2352276;5;*;gga
;comp;tRNA;2352282;2352356;6;*;ggc
;comp;tRNA;2352363;2352438;73;*;cca
fin;comp;CDS;2352512;2352910;;;
deb;comp;CDS;2430767;2432488;295;*;
;comp;tRNA;2432784;2432859;58;*;tgg
fin;comp;CDS;2432918;2433805;;0;
deb;comp;CDS;2453380;2454555;324;*;
;comp;tRNA;2454880;2454964;39;*;tac
;comp;tRNA;2455004;2455079;8;*;gta
;comp;tRNA;2455088;2455172;4;*;tac
;comp;tRNA;2455177;2455252;255;*;aca
fin;;CDS;2455508;2456227;;;
deb;comp;CDS;2696774;2697664;138;*;
;comp;rRNA;2697803;2697911;34;*;5s
;comp;rRNA;2697946;2700846;237;*;23s
;comp;rRNA;2701084;2702595;423;*;16s
deb;comp;CDS;2703019;2703762;183;*;
;comp;tRNA;2703946;2704021;311;*;aaa
;comp;tRNA;2704333;2704408;13;*;ttc
;comp;rRNA;2704422;2704530;336;*;5s
;comp;tRNA;2704867;2704942;15;*;ttc
;comp;rRNA;2704958;2705064;100;*;5s
;comp;rRNA;2705165;2708065;237;*;23s
;comp;rRNA;2708303;2709810;346;*;16s
fin;comp;CDS;2710157;2711029;;;
deb;comp;CDS;2720030;2721172;80;*;
;comp;tRNA;2721253;2721328;5;*;aaa
;comp;rRNA;2721334;2721450;98;*;5s
;comp;rRNA;2721549;2724451;237;*;23s
;comp;rRNA;2724689;2726199;393;*;16s
fin;comp;CDS;2726593;2727531;;;
deb;comp;CDS;2730964;2731656;245;*;
;comp;tRNA;2731902;2731976;61;*;gag
;comp;tRNA;2732038;2732112;6;*;caa
;comp;tRNA;2732119;2732195;4;*;aga
;comp;tRNA;2732200;2732273;19;*;gga
;comp;tRNA;2732293;2732376;16;*;cta
;comp;tRNA;2732393;2732467;4;*;gaa
;comp;rRNA;2732472;2732588;100;*;5s
;comp;rRNA;2732689;2735591;95;*;23s
;comp;tRNA;2735687;2735763;3;*;atc
;comp;tRNA;2735767;2735842;77;*;gca
;comp;rRNA;2735920;2737431;402;*;16s
fin;comp;CDS;2737834;2738727;;;
deb;comp;CDS;2740228;2741853;408;*;
;comp;tRNA;2742262;2742351;111;*;tcc
deb;comp;CDS;2742463;2743155;64;*;
;comp;tRNA;2743220;2743312;69;*;tcg
deb;comp;CDS;2743382;2743825;65;*;
;comp;tRNA;2743891;2743967;130;*;agg
fin;;CDS;2744098;2744829;;;
deb;comp;CDS;2746633;2748438;95;*;
;comp;tRNA;2748534;2748610;144;*;cgt
;comp;tRNA;2748755;2748845;23;*;agc
;comp;tRNA;2748869;2748959;69;*;tca
;comp;tRNA;2749029;2749119;61;*;tca
fin;comp;CDS;2749181;2750461;;;
deb;comp;CDS;2758098;2758562;125;*;
;comp;tRNA;2758688;2758763;4;*;gca
;comp;tRNA;2758768;2758844;3;*;atgi
;comp;rRNA;2758848;2758964;76;*;5s
;comp;rRNA;2759041;2761941;237;*;23s
;comp;rRNA;2762179;2763690;369;*;16s
fin;comp;CDS;2764060;2766609;;;

cbn intercalaires entre cds[modifier | modifier le wikicode]

cbn intercalaires positifs S+[modifier | modifier le wikicode]

cbn Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
scc;min10;416;961;1377;748;440;530;90;-88;49;367;;;
cbn;min20;489;1701;2190;731;543;505;-38;-222;-114;271;;;
eco;min20;1003;2130;3133;735;296;440;144;-178;-64;287;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
118;353;0.33;485;1320;4;5;58;242;60;389;-177;;;
65;312;0.21;553;1940;2;5;17;86;56;620;-382;;;
63;348;0.18;1169;2855;11;6;80;226;126;821;-119;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
cbn;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;&-7;-5;-3;1;R2;flex c+;comment.
1 à 400;15;-107;126;33;450;238;max50;&-50;394;-1048;106;855;263;min50
31 à 400;;;;;;;;&8.8;-32;-123;49;932;121;2 parties
droite;-a;cste;-;R2;note;R2’;;&-a;cste;-;R2;note;R2’;
1 à 400;86;43;-;424;dte;26;tf;&184;63;-;652;poly;203;SF
31 à 400;;;-;;;;;&120;45;-;891;dte;41;tf
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30, t30.
  • Corrélations et fréquences faibles
;400;200;250;;;;;;;;;;;
;coefficient de corrélation fx fc;;;;;;;corrélation;;;;;;
41-n;0.731;0.543;0.505;;;;;-0.382;;;;;;
1-n;0.271;-0.222;-0.114;;;;;;;;;14.8.21 paris;;
cbn;fx;fc;;cbn;fx%;fc%;;fx40;fc40;;x;cbn;Sx-;Sc-
0;1;10;;0;2;6;0;1;10;>0;543;-1;0;34
10;10;172;;10;20;101;1;1;37;<0;9;-2;0;0
20;3;211;;20;6;124;2;1;31;zéro;1;-3;0;0
30;19;147;;30;39;86;3;2;13;total;553;-4;0;28
40;24;90;;40;49;53;4;2;12;;c;-5;0;0
50;34;60;;50;70;35;5;0;17;>0;1763;-6;1;0
60;28;67;;60;57;39;6;0;13;<0;167;-7;0;5
70;26;71;;70;53;42;7;1;11;zéro;10;-8;1;30
80;17;53;;80;35;31;8;0;9;total;1940;-9;1;0
90;13;59;;90;27;35;9;1;10;;;-10;0;6
100;18;68;;100;37;40;10;2;19;total;2493;-11;2;13
110;12;42;;110;25;25;11;0;22;;;-12;1;0
120;16;50;;120;33;29;12;0;32;;;-13;0;2
130;24;50;;130;49;29;13;0;22;;;-14;0;7
140;4;50;;140;8;29;14;0;22;;;-15;0;0
150;12;49;;150;25;29;15;0;23;;;-16;0;3
160;7;45;;160;14;26;16;1;20;;;-17;1;10
170;16;48;;170;33;28;17;1;16;;;-18;0;0
180;16;36;;180;33;21;18;0;20;;;-19;0;2
190;12;42;;190;25;25;19;1;14;;;-20;0;7
200;15;31;;200;31;18;20;0;20;;;-21;1;0
210;11;27;;210;22;16;21;0;20;;;-22;0;1
220;12;29;;220;25;17;22;1;17;;;-23;0;2
230;11;30;;230;22;18;23;3;12;;;-24;0;0
240;15;19;;240;31;11;24;1;13;;;-25;0;1
250;14;14;;250;29;8;25;1;19;;;-26;0;2
260;14;16;;260;29;9;26;2;10;;;-27;1;0
270;11;10;;270;22;6;27;3;17;;;-28;0;1
280;6;8;;280;12;5;28;3;13;;;-29;0;5
290;9;10;;290;18;6;29;2;12;;;-30;0;0
300;11;21;;300;22;12;30;3;14;;;-31;0;1
310;4;7;;310;8;4;31;2;11;;;-32;0;1
320;5;7;;320;10;4;32;2;5;;;-33;0;0
330;5;11;;330;10;6;33;4;11;;;-34;0;0
340;11;5;;340;22;3;34;0;8;;;-35;0;2
350;4;9;;350;8;5;35;1;6;;;-36;0;0
360;2;12;;360;4;7;36;3;8;;;-37;0;0
370;6;8;;370;12;5;37;2;11;;;-38;0;0
380;6;7;;380;12;4;38;1;8;;;-39;0;0
390;1;6;;390;2;4;39;7;10;;;-40;0;0
400;5;4;;400;10;2;40;2;12;;;-41;0;1
reste;54;62;;;;;reste;487;1143;;;-42;0;0
total;544;1773;;t30;65;312;total;544;1773;;;-43;0;0
diagr;489;1701;;;;;diagr;56;620;;;-44;0;1
 - t30;457;1171;;;;;;;;;;-45;0;0
;;;;;;;;;;;;-46;0;1
;;;;;;;;;;;;-47;0;1
;;;;;;;;;;;;-48;0;0
;;;;;;;;;;;;-49;0;0
;;;;;;;;;;;;-50;0;0
;;;;;;;;;;;;reste;0;0
;;;;;;;;;;;;total;9;167

cbn intercalaires négatifs S-[modifier | modifier le wikicode]

cbn;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;;
comp’;;;;;;1;;;1;;2;1;;;;;1;;;;1;;;;;;1;;;;;;;;;;;;;;;;;;;;;;;0;0;8
continu;34;0;0;28;0;0;5;31;0;6;13;0;2;7;0;3;10;0;2;7;0;1;2;0;1;2;0;1;5;0;1;1;0;0;2;0;0;0;0;0;1;0;0;1;0;1;1;0;0;0;0;168
  • 14.8.21
14.8.21 paris;cbn;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;0;0;0;0;1;0;1;1;0;2;1;0;0;0;0;1;0;0;0;1;0;0;0;0;0;1;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;9
;Sc-;34;0;0;28;0;0;5;30;0;6;13;0;2;7;0;3;10;0;2;7;0;1;2;0;1;2;0;1;5;0;1;1;0;0;2;0;0;0;0;0;1;0;0;1;0;1;1;0;0;0;0;167

cbn autres intercalaires[modifier | modifier le wikicode]

deb;°CDS;20118;206;comp;;deb;°CDS;1865810;45;;;deb;°CDS;2453380;324;comp
;&tRNA;20666;214;;;;gene;1866395;88;;;;&tRNA;2454880;39;comp
fin;°CDS;20956;;;;fin;°CDS;1867620;;comp;;;&tRNA;2455004;8;comp
deb;°CDS;34861;307;comp;;deb;°CDS;2029941;104;;;;&tRNA;2455088;4;comp
;&tRNA;36413;12;;;;&tRNA;2030816;48;comp;;;&tRNA;2455177;255;comp
;&tRNA;36500;13;;;;$rRNA;2030939;97;comp;;fin;°CDS;2455508;;
;&tRNA;36589;5;;;;&tRNA;2033939;7;comp;;deb;°CDS;2696774;138;comp
;&tRNA;36671;18;;;;&tRNA;2034023;124;comp;;;$rRNA;2697803;34;comp
;&tRNA;36765;12;;;;$rRNA;2034223;423;comp;;;$rRNA;2697946;237;comp
;&tRNA;36852;13;;;fin;°CDS;2036154;;comp;;;$rRNA;2701084;423;comp
;&tRNA;36941;5;;;deb;°CDS;2149914;128;comp;;deb;°CDS;2703019;183;comp
;&tRNA;37023;106;;;;$rRNA;2150504;34;comp;;;&tRNA;2703946;311;comp
fin;°CDS;37205;;comp;;;$rRNA;2150655;237;comp;;;&tRNA;2704333;13;comp
deb;°CDS;135851;168;comp;;;$rRNA;2153797;424;comp;;;$rRNA;2704422;336;comp
;&tRNA;137366;131;comp;;fin;°CDS;2155729;;comp;;;&tRNA;2704867;15;comp
fin;°CDS;137573;;comp;;deb;°CDS;2168490;590;;;;$rRNA;2704958;100;comp
deb;°CDS;161395;158;;;;$rRNA;2169533;35;comp;;;$rRNA;2705165;237;comp
;&tRNA;161964;5;;;;$rRNA;2169677;237;comp;;;$rRNA;2708303;346;comp
;&tRNA;162058;5;;;;$rRNA;2172816;111;comp;;fin;°CDS;2710157;;comp
;&tRNA;162139;46;;;fin;°CDS;2174439;;;;deb;°CDS;2720030;80;comp
;&tRNA;162262;5;;;deb;°CDS;2281037;144;;;;&tRNA;2721253;5;comp
;&tRNA;162356;30;;;;$rRNA;2283779;98;comp;;;$rRNA;2721334;98;comp
;&tRNA;162462;46;;;;$rRNA;2283983;237;comp;;;$rRNA;2721549;237;comp
;&tRNA;162585;5;;;;$rRNA;2287123;111;comp;;;$rRNA;2724689;393;comp
;&tRNA;162679;480;;;deb;°CDS;2288746;117;comp;;fin;°CDS;2726593;;comp
fin;°CDS;163235;;comp;;;&tRNA;2289103;15;comp;;deb;°CDS;2730964;245;comp
deb;°CDS;174610;115;;;;&tRNA;2289192;7;comp;;;&tRNA;2731902;61;comp
;&tRNA;176258;275;;;;&tRNA;2289276;233;comp;;;&tRNA;2732038;6;comp
fin;°CDS;176608;;;;fin;°CDS;2289585;;comp;;;&tRNA;2732119;4;comp
deb;°CDS;178351;453;;;deb;°CDS;2349136;199;comp;;;&tRNA;2732200;19;comp
;$rRNA;180181;237;;;;&tRNA;2350598;21;comp;;;&tRNA;2732293;16;comp
;$rRNA;181930;48;;;;&tRNA;2350696;28;comp;;;&tRNA;2732393;4;comp
;&tRNA;184882;14;;;;&tRNA;2350798;4;comp;;;$rRNA;2732472;100;comp
;$rRNA;184971;7;;;;&tRNA;2350878;4;comp;;;$rRNA;2732689;95;comp
;&tRNA;185095;435;;;;&tRNA;2350957;5;comp;;;&tRNA;2735687;3;comp
fin;°CDS;185605;;comp;;;&tRNA;2351038;3;comp;;;&tRNA;2735767;77;comp
deb;°CDS;221558;140;;;;&tRNA;2351116;6;comp;;;$rRNA;2735920;402;comp
;&tRNA;222409;106;;;;&tRNA;2351199;4;comp;;fin;°CDS;2737834;;comp
fin;°CDS;222591;;;;;&tRNA;2351277;21;comp;;deb;°CDS;2740228;408;comp
deb;°CDS;577193;60;;;;&tRNA;2351374;5;comp;;;&tRNA;2742262;111;comp
;&tRNA;578417;67;comp;;;&tRNA;2351455;5;comp;;deb;°CDS;2742463;64;comp
fin;°CDS;578560;;comp;;;&tRNA;2351537;5;comp;;;&tRNA;2743220;69;comp
deb;°CDS;943937;261;comp;;;&tRNA;2351616;3;comp;;deb;°CDS;2743382;65;comp
;&tRNA;944747;348;comp;;;&tRNA;2351694;22;comp;;;&tRNA;2743891;130;comp
fin;°CDS;945182;;;;;&tRNA;2351800;4;comp;;fin;°CDS;2744098;;
deb;°CDS;954881;59;;;;&tRNA;2351880;4;comp;;deb;°CDS;2746633;95;comp
;&tRNA;955546;82;;;;&tRNA;2351959;5;comp;;;&tRNA;2748534;144;comp
fin;°CDS;955713;;;;;&tRNA;2352040;5;comp;;;&tRNA;2748755;23;comp
deb;°CDS;1025682;379;;;;&tRNA;2352121;5;comp;;;&tRNA;2748869;69;comp
;&tRNA;1026946;17;;;;&tRNA;2352203;5;comp;;;&tRNA;2749029;61;comp
;&tRNA;1027039;14;;;;&tRNA;2352282;6;comp;;fin;°CDS;2749181;;comp
;&tRNA;1027130;4;;;;&tRNA;2352363;73;comp;;deb;°CDS;2758098;125;comp
;&tRNA;1027210;8;;;fin;°CDS;2352512;;comp;;;&tRNA;2758688;4;comp
;&tRNA;1027293;57;;;deb;°CDS;2430767;295;comp;;;&tRNA;2758768;3;comp
;&tRNA;1027425;265;;;;&tRNA;2432784;58;comp;;;$rRNA;2758848;76;comp
fin;°CDS;1027765;;;;fin;°CDS;2432918;;comp;;;$rRNA;2759041;237;comp
deb;°CDS;1679540;6;;;;;;;;;;$rRNA;2762179;369;comp
;gene;1680008;128;comp;;;;;;;;fin;°CDS;2764060;;comp
fin;°CDS;1681704;;comp;;;;;;;;;;;;

cbn intercalaires tRNA-cds[modifier | modifier le wikicode]

cbn;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
comp’;206;;214;;59;58;;
comp’;307;comp’;106;;64;61;'''deb;
;168;;131;;65;67;<201;12
;158;comp’;480;;80;69;total;18
;115;;275;;98;73;taux;67%
;;comp’;435;;115;82;;
;140;;106;;125;106;'''fin;
comp’;60;;67;;140;111;<201;9
;261;comp’;348;;158;131;total;12
;59;;82;;168;214;taux;75%
;379;;265;;183;265;;
comp’;104;;;;199;275;'''total;
;199;;73;;245;;<201;21
;295;;58;;261;;total;30
;324;comp’;255;;295;;taux;70%
;183;;;;324;;;
;80;;;;379;;;
;245;;;;408;;'''comp’;'''cumuls
;408;;111;;60;106;'''deb;2
;64;;69;;104;130;;4
;65;comp’;130;;206;255;'''fin;2
;98;;61;;307;348;;6
;125;;;;'''-;435;'''total;
;;;;;'''-;480;<201;4
;;;;;;;total;10
;;;;;;;taux;40%
;;;;;;;;
;;;;;;;;
;;;;;;;;
;;deb;fin;total;;;;
;<201;14;11;25;;;;
;total;22;18;40;;;;
;taux;64%;61%;63%;;;;

cle[modifier | modifier le wikicode]

cle opérons[modifier | modifier le wikicode]

34.3%GC;30.6.19 Paris;16s  11;104;doubles;intercalaires;;
;Clostridium lentocellum DSM 5427;;;;;;
;10157..10246;;agc;@1;202;;
;10449..11981;;16s;;72;;
;12054..12171;;5s;;4;;
;12176..12248;;gca;;262;;
;12511..15414;;23s;;55;;
;15470..15543;;gac;;61;;61
;15605..15677;;gta;;7;;7
;15685..15757;;aca;;34;;34
;15792..15872;;tac;;12;;12
;15885..15961;;atgj;;3;;3
;15965..16040;;ttc;;3;;3
;16044..16116;;aaa;;;;
;;;;;30118;;
;46235..47767;;16s;@3;21284;;
;;;;;;;
;69052..71964;;23s;;;;
;;;;;4873;;
;76838..78371;;16s;;72;;
;78444..78561;;5s;;5;;
;78567..78639;;gca;;282;;
;78922..81829;;23s;;;;
;;;;;904;;
;82734..82851;;5s;;4;;
;82856..82928;;ggc;;;;
;;;;;1463;;
;84392..85929;;16s;;72;;
;86002..86119;;5s;;4;;
;86124..86196;;gca;;280;;
;86477..89386;;23s;;;;
;;;;;7380;;
;96767..96884;;5s;;89;;
;96974..97047;;ggc;;;;
;;;;;5082;;
;102130..102204;;cag;;;;
;;;;;;;
;104716..104799;;tta;;13;13;
;104813..104898;;tca;;;;
;;;;;;;
;141499..143034;;16s;;138;;
;143173..143290;;5s;;7;;
;143298..143374;;atc; ;258;;
;143633..146538;;23s;;;;
;;;;;;;
;150968..151085;;5s;@4;4;;
;151090..151161;;gaa;;457;;
;151619..153160;;16s;;605;;
;153766..156671;;23s;;475;;
;157147..157219;;aaa;;9;;9
;157229..157299;;gga;;6;;6
;157306..157379;;aga;;;;
;;;;;4223;;
;161603..161720;;5s;;4;;
;161725..161797;;ggc;;;;
;;;;;11104;;
;172902..172973;;gaa;;23;23;
;172997..173071;;cca;;45;45;
;173117..173189;;aaa;;11;11;
;173201..173274;;gac;;56;56;
;173331..173403;;gta;;7;7;
;173411..173494;;tta;;187;187;
;173682..173754;;aca;;26;26;
;173781..173861;;tac;;10;10;
;173872..173948;;atgj;;31;31;
;173980..174052;;ttc;;;;
;;;;;248498;;
;422551..424086;;16s;;;;
;;;;;113898;;
;537985..540890;;23s;;;;
;;;;;25153;;
;566044..566117;;cac;;23;23;
;566141..566212;;caa;;32;32;
;566245..566330;;tca;;;;
;;;;;;;
;571984..573519;;16s;;72;;
;573592..573709;;5s;;4;;
;573714..573786;;gca;;282;;
;574069..576975;;23s;;;;
;;;;;25302;;
;602278..603812;;16s;;137;;
;603950..604067;;5s;;;;
;;;;;11014;;
;615082..617987;;23s;;;;
;;;;;21159;;
;639147..639362;;16s°;@5;;;
;;;;;98139;;
;737502..737619;;5s;;4;;
;737624..737696;;ggc;;;;
;;;;;3291;;
;740988..741058;;gga;;;;
;;;;;;;
;759839..759920;;cta;;;;
;;;;;;;
;911999..912083;;ctt;+;148;148;
;912232..912316;;ctt;2 ctt;;;
;;;;;;;
;1035192..1035265;;cga;;;;
;;;;;;;
;1061152..1061225;;agg;;;;
;;;;;;;
comp;1136376..1136448;;ccc;;;;
;;;;;;;
;1229184..1230718;;16s;@2;72;;
;1230791..1230908;;5s;;7;;
;1230916..1230989;;atc;;53;;53
;1231043..1231115;;gca;;261;;
;1231377..1234282;;23s;;110;;
;1234393..1234464;;aac;+;9;;9
;1234474..1234545;;gaa;2 tgc ;6;;6
;1234552..1234622;;tgc;2 aac;23;;23
;1234646..1234717;;aac;;58;;58
;1234776..1234846;;tgc;;;;
;;;;;;;
;1280211..1280283;;atgf;;;;
;;;;;;;
;1283250..1283320;;gga;+;5;5;
;1283326..1283399;;aga;2 gga;5;5;
;1283405..1283478;;cac;2 aga;31;31;
;1283510..1283581;;caa;2 caa;23;23;
;1283605..1283677;;aaa;;30;30;
;1283708..1283792;;cta;;23;23;
;1283816..1283886;;gga;;5;5;
;1283892..1283965;;aga;;6;6;
;1283972..1284043;;caa;;;;
;;;;;;;
;1299560..1299632;;ggc;;4;4;
;1299637..1299711;;cca;;;;
;;;;;;;
;1346208..1346290;;ctg;;;;
;;;;;;;
;1363346..1363428;;ctg;;;;
;;;;;;;
;1515234..1515305;;gaa;;62;62;
;1515368..1515442;;cca;;22;22;
;1515465..1515537;;aaa;;;;
;;;;;;;
;1597292..1597364;;acg;;;;
;;;;;;;
;1611976..1612042;;acg;;;;
;;;;;;;
;2065352..2065425;;ata;;;;
;;;;;;;
comp;2090478..2090550;;acc;;;;
;;;;;;;
;2394421..2394501;;tac;;3;3;
;2394505..2394577;;ttc;;;;
;;;;;;;
;2592342..2592422;;ttg;;;;
;;;;;;;
;2606024..2606104;;ttg;;;;
;;;;;;;
comp;2737232..2737304;;gcc;;;;
;;;;;;;
comp;2798802..2798874;;aag;;;;
;;;;;;;
comp;2881571..2881642;;gag;;;;
;;;;;;;
comp;3215471..3215545;;cca;;;;
;;;;;;;
comp;3252582..3252655;;atgj;;7;7;
comp;3252663..3252735;;gta;;4;4;
comp;3252740..3252813;;gac;;10;10;
comp;3252824..3252896;;tgg;;20;20;
comp;3252917..3252988;;aac;;;;
;;;;;683;;
comp;3253672..3253748;;atgj;;7;;7
comp;3253756..3253828;;gta;;9;;9
comp;3253838..3253910;;tgg;;18;;18
comp;3253929..3254000;;aac;;60;;
comp;3254061..3256967;;23s;;;;
;;;;;362637;;
comp;3619605..3619677;;aca;+;4;;4
comp;3619682..3619755;;cgt;2 cgt;50;;50
comp;3619806..3619879;;cgt;2 aca;27;;27
comp;3619907..3619990;;tta;;3;;3
comp;3619994..3620069;;gta;;47;;47
comp;3620117..3620190;;gac;;22;;22
comp;3620213..3620289;;atgi;;23;;23
comp;3620313..3620385;;aca;;14;;14
comp;3620400..3620471;;gaa;;9;;9
comp;3620481..3620552;;aac;;110;;
comp;3620663..3623568;;23s;;261;;
comp;3623830..3623902;;gca;;53;;53
comp;3623956..3624029;;atc;;7;;
comp;3624037..3624154;;5s;;72;;
comp;3624227..3625761;;16s;;149;;
comp;3625911..3625999;;tcc;;33;;33
comp;3626033..3626118;;tca;;;;
;;;;;;;
comp;3714637..3714709;;gta;;1;1;
comp;3714711..3714787;;atgj;;;;

cle cumuls[modifier | modifier le wikicode]

cle cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;19;1;1;0
;16 5 aa 23;5;20;14;15
;16 5 atc gca;2;40;10;6
;solo;11;60;2;5
;max a;14;80;1;1
;a doubles;2;100;0;0
;indéterminé;1;120;0;0
;total aas;46;140;0;0
sans ;opérons;29;160;1;0
;1 aa;19;180;0;0
;max a;10;200;1;0
;a doubles;2;;0;0
;total aas;59;;30;27
total aas;;105;;;
remarques;;5;;;
avec jaune;;;moyenne;29;
;;;variance;41;
sans jaune;;;moyenne;19;22
;;;variance;16;19

cle blocs[modifier | modifier le wikicode]

cle blocs;;;
Solitaires;;;
16s;*2;16s°;@5
;;;
23s;*3;;
;;;
5s;3*4;89;
ggc;;;
;;;
aac;60;;
23s;;;
;;;
16s;137;;
5s;;;
;;;
16s;72;72;72
5s;5;4;4
gca;282;280;282
23s;;;
;;;
;;agc;202
16s;138;16s;72
5s;7;5s;4
atc;258;gca;262
23s;;23s;55
;;gac;61
;;;
;;;
;;aac;110
16s;72;23s;261
5s;7;gca;53
atc;53;atc;7
gca;261;5s;72
23s;110;16s;149
aac;9;tcc;33
;;;
;;;
5s;4;;@4
gaa;457;;
16s;605;;
23s;475;;
aaa;9;;

cle distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;
att;;act;;aat;;agt;;après 16s;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;1-3;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;(atcgca)2;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;;aaa;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gca4;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;aga;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;atc1;ttc;2;tcc;;tac;2;tgc;;;ttc;;tcc;;tac;;tgc;;gga;ttc;1;tcc;;tac;1;tgc;2
atc;;acc;1;aac;;agc;;;atc;;acc;;aac;1;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;4;agc;
ctc;;ccc;1;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;;;ctc;;ccc;;cac;;cgt;;après 5s;ctc;;ccc;;cac;;cgt;2
gtc;;gcc;1;gac;;ggc;;16s5saa23s;gtc;;gcc;;gac;2;ggc;1;;gtc;;gcc;;gac;;ggc;;4 ggc;gtc;;gcc;;gac;2;ggc;
tta;;tca;;taa;;tga;;;tta;2;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;gaa;tta;1;tca;;taa;;tga;
ata;1;aca;;aaa;;aga;;;ata;;aca;1;aaa;3;aga;2;;ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;1;aga;
cta;1;cca;1;caa;;cga;1;;cta;1;cca;3;caa;3;cga;;;cta;;cca;;caa;;cga;;cgt2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;1;;gta;3;gca;;gaa;2;gga;2;;gta;;gca;;gaa;;gga;;ctt2;gta;3;gca;;gaa;2;gga;
ttg;2;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;2;aag;1;agg;1;;atgj;3;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;16s5saa23s;atgj;2;acg;;aag;;agg;
ctg;2;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cle;;19;;;;;19;;cle;38;;;;;;38;;cle;2;;;;;;2;;cle;;;;26;3;9;26
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8  1-3aas;;;

cle données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cle données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;tRNA tRNA;;tRNA contig;;tRNA tRNA;;CDS-CDS;400-700;;Sup 500;Sup 700
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;frequence;effectif;;long;long
fxt;fct;cle;fx;fc;cle;fx40;fc40;cle;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;cle;fx;fc;fx;fc
;0;0;0;35;0;0;35;-1;0;78;421;212;CDS 16s;;16s 5s;;tRNA contig;;tRNA tRNA;hors bloc;400;696;2715;516;706
;0;10;9;278;1;0;56;-2;0;0;121;409;437;347;6* 79;;61;gac;13;tta;410;6;14;521;712
;0;20;6;387;2;0;50;-3;0;0;275;214;643;;146;;7;gta;**;tca;420;7;8;532;718
;1;30;5;213;3;0;36;-4;8;107;757;50;302;;144;;34;aca;23;gaa;430;6;8;532;719
;0;40;12;144;4;2;24;-5;0;1;262;622;325;;16s 23s;;12;tac;45;cca;440;4;7;538;719
1;1;50;21;85;5;2;20;-6;1;0;487;66;602;;613;;3;atgj;11;aaa;450;3;7;544;723
;1;60;27;93;6;1;8;-7;0;10;207;224;331;;5s tRNA;;3;ttc;56;gac;460;2;4;546;723
1;1;70;20;88;7;1;7;-8;1;72;92;142;323;;3* 4;gca;**;aaa;7;gta;470;3;4;547;725
;1;80;37;104;8;2;12;-9;0;0;289;264;5s CDS;;5;gca;9;aaa;187;tta;480;4;4;549;727
1;0;90;35;84;9;1;30;-10;0;5;489;142;301;;89;ggc;6;gga;26;aca;490;2;4;559;729
;4;100;29;82;10;0;35;-11;1;41;125;405;16s CDS;;3* 7;atc;**;aga;10;tac;500;3;7;561;733
;1;110;24;80;11;2;55;-12;0;0;322;227;695;228;4;gaa;9;aac;31;atgj;510;0;2;563;754
;3;120;17;65;12;0;64;-13;1;7;121;454;CDS 23s;;3* 4;ggc;6;gaa;**;ttc;520;1;7;566;760
1;5;130;26;79;13;2;39;-14;1;28;342;139;531;;tRNA 23s;;23;tgc;23;cac;530;1;3;567;778
1;1;140;21;63;14;0;32;-15;1;0;44;445;563;;263;gca;58;aac;32;caa;540;3;4;584;779
3;2;150;21;79;15;1;42;-16;1;2;61;195;407;;2* 283;gca;**;tgc;**;tca;550;4;3;588;779
1;1;160;31;72;16;0;37;-17;0;12;231;154;23s CDS;;284;gca;7;atgj;148;ctt;560;1;6;599;781
;0;170;26;55;17;0;36;-18;0;0;132;201;313;188;262;atc;9;gta;**;ctt;570;4;4;611;784
;2;180;21;50;18;1;28;-19;0;2;75;527;237;260;2* 262;gca;18;tgg;5;gga;580;0;5;614;796
;0;190;39;58;19;0;34;-20;1;14;125;409;299;;tRNA 16s;;**;aac;5;aga;590;2;1;615;801
1;1;200;22;50;20;0;20;-21;0;0;112;149;357;;204;agc;4;aca;31;cac;600;1;3;644;821
1;2;210;24;48;21;0;25;-22;1;2;91;87;188;;459;gaa;50;cgt;23;caa;610;0;3;653;832
2;1;220;20;42;22;0;21;-23;0;8;53;125;336;;151;tcc;27;cgt;30;aaa;620;3;4;656;845
2;1;230;25;28;23;0;24;-24;0;0;124;;CDS 5s;;23s tRNA;;6;tta;26;cta;630;0;1;659;852
;2;240;13;30;24;0;24;-25;0;5;473;;335;228;56;gac;47;gta;5;gga;640;0;2;662;854
;1;250;17;32;25;2;18;-26;1;9;141;;;343;476;aaa;25;gac;6;aga;650;1;3;683;862
;0;260;15;41;26;0;18;-27;0;0;174;;;184;2* 111;aac;23;atgi;**;caa;660;3;2;710;869
1;2;270;17;35;27;1;31;-28;0;1;198;;;301;61;aac;14;aca;4;ggc;670;1;3;721;891
;1;280;14;26;28;0;18;-29;0;8;101;;;;tRNA tRNA;intra;9;gaa;**;cca;680;0;2;725;894
;1;290;14;22;29;0;16;-30;0;0;238;;;;2* 53;atc;**;aac;62;gaa;690;1;3;732;916
;0;300;14;29;30;2;18;-31;0;1;29;;;;**;gca;33;tcc;22;cca;700;0;2;754;926
;1;310;10;21;31;3;21;-32;2;8;93;;;;;;**;tca;**;aaa;;17;55;766;941
;0;320;8;20;32;2;26;-33;0;0;223;;;;;;;;3;tac;;;;774;964
;2;330;5;7;33;0;10;-34;0;1;112;;;CDS-CDS;inf 50;;;;**;ttc;;;;787;975
;0;340;11;14;34;2;7;-35;0;2;95;;;intercalaire;;;;;7;atgj;;;;799;1006
;1;350;4;12;35;2;9;-36;0;0;155;;;c-;x-;;;;4;gta;;;;806;1014
;0;360;10;22;36;1;13;-37;0;0;523;;;-98;néant;;;;10;gac;;;;811;1022
;0;370;6;14;37;1;19;-38;0;2;178;;;-95;;;;;20;tgg;;;;828;1031
;0;380;10;9;38;1;15;-39;0;0;141;;;-95;;;;;**;aac;;;;918;1042
;0;390;4;13;39;0;13;-40;0;0;116;;;-95;;;;;4;gta;;;;934;1050
;0;400;6;6;40;0;11;-41;0;2;212;;;-77;;;;;**;atgj;;;;998;1057
7;6;reste;83;185;reste;747;1843;-42;0;0;209;;;-71;;;;;;;;;;1019;1116
23;46;total;779;2900;total;779;2900;-43;0;0;329;;;-71;;;;;;;;;;1126;1125
16;40;diagr;696;2680;diagr;32;1022;-44;1;0;267;;;-58;;;;;;;;;;;1129
0;1; t30;20;878;;;;-45;0;0;249;;;-56;;;;;;;;;;;1215
;;;;;;;;-46;0;1;310;;;-52;;;;;;;;;;;1240
;;Récapitulatif des effectifs;;;;;;-47;0;1;;;;total;intercalaires;;;;;;;;;;1267
;;>0;<0;zéro;total;*;;-48;0;0;;;;;615,068;;;;;;;;;;1336
;x;779;21;0;800;;;-49;0;0;;;;ADN long;4,714,237;;;;;;;;;;1350
;c;2865;441;35;3341;;;-50;0;1;;;;%;13.0;;;;;;;;;;1416
;;;;;4141;273;;reste;0;10;;;;;;;;;;;;;;;1421
;;;;;;4414;;total;21;441;;;;non RNA;84;;;;;;;;;;1437
;;;;;;;;;;;;;;;;;;;;;;;;;1783
;;;;;;;;;;;;;;;;;;;;;;;;;2271
;;;;;;;;;;;;;;;;;;;;;;;;;3106

cle autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cle autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cle;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;8716;9735;421;*;
;;tRNA;10157;10246;204;*;agc
;;rRNA;10451;11974;79;*;1524
;;rRNA;12054;12171;4;*;118
;;tRNA;12176;12248;263;*;gca
;;rRNA;12512;15413;56;*;2902
;;tRNA;15470;15543;61;*;gac
;;tRNA;15605;15677;7;*;gta
;;tRNA;15685;15757;34;*;aca
;;tRNA;15792;15872;12;*;tac
;;tRNA;15885;15961;3;*;atgj
;;tRNA;15965;16040;3;*;ttc
;;tRNA;16044;16116;121;*;aaa
fin;;CDS;16238;16705;;;
deb;;CDS;44432;45799;437;*;
;;rRNA;46237;47760;695;*;1524
fin;;CDS;48456;50240;;0;
deb;;CDS;66902;68521;531;*;
;;rRNA;69053;71963;313;*;2911
fin;;CDS;72277;72981;;;
deb;;CDS;72981;76196;643;*;
;;rRNA;76840;78364;79;*;1525
;;rRNA;78444;78561;5;*;118
;;tRNA;78567;78639;283;*;gca
;;rRNA;78923;81828;188;*;2906
deb;comp;CDS;82017;82505;228;*;
;;rRNA;82734;82851;4;*;118
;;tRNA;82856;82928;275;*;ggc
deb;;CDS;83204;84091;302;*;
;;rRNA;84394;85922;79;*;1529
;;rRNA;86002;86119;4;*;118
;;tRNA;86124;86196;284;*;gca
;;rRNA;86481;89385;237;*;2905
fin;;CDS;89623;90231;;;
deb;comp;CDS;94411;96423;343;*;
;;rRNA;96767;96884;89;*;118
;;tRNA;96974;97044;757;*;ggc
fin;;CDS;97802;98497;;;
deb;comp;CDS;101240;101917;212;*;
;;tRNA;102130;102201;409;*;cag
fin;comp;CDS;102611;103510;;;
deb;comp;CDS;103635;104501;214;*;
;;tRNA;104716;104799;13;*;tta
;;tRNA;104813;104898;262;*;tca
fin;;CDS;105161;106408;;;
deb;comp;CDS;135278;135838;80;*;
;comp;regulatory;135919;136018;495;*;
fin;;CDS;136514;138715;;;
deb;;CDS;140906;141175;325;*;
;;rRNA;141501;143026;146;*;1526
;;rRNA;143173;143290;7;*;118
;;tRNA;143298;143371;262;*;atc
;;rRNA;143634;146537;299;*;2904
fin;;CDS;146837;147139;;0;
deb;;CDS;149226;150632;335;*;
;;rRNA;150968;151085;4;*;118
;;tRNA;151090;151161;459;*;gaa
;;rRNA;151621;153153;613;*;1533
;;rRNA;153767;156670;476;*;2904
;;tRNA;157147;157219;9;*;aaa
;;tRNA;157229;157299;6;*;gga
;;tRNA;157306;157379;487;*;aga
fin;;CDS;157867;158490;;;
deb;comp;CDS;160912;161418;184;*;
;;rRNA;161603;161720;4;*;118
;;tRNA;161725;161797;50;*;ggc
fin;comp;CDS;161848;162624;;;
deb;comp;CDS;162740;165070;522;*;
;;misc_b;165593;165910;56;*;
fin;;CDS;165967;167493;;;
deb;comp;CDS;171336;172279;622;*;
;;tRNA;172902;172973;23;*;gaa
;;tRNA;172997;173071;45;*;cca
;;tRNA;173117;173189;11;*;aaa
;;tRNA;173201;173274;56;*;gac
;;tRNA;173331;173403;7;*;gta
;;tRNA;173411;173494;187;*;tta
;;tRNA;173682;173754;26;*;aca
;;tRNA;173781;173861;10;*;tac
;;tRNA;173872;173948;31;*;atgj
;;tRNA;173980;174052;207;*;ttc
fin;;CDS;174260;174673;;;
deb;comp;CDS;190039;190368;288;*;
;;misc_b;190657;190881;79;*;
fin;;CDS;190961;192721;;;
deb;comp;CDS;421861;422205;347;*;
;;rRNA;422553;424078;228;*;1526
fin;comp;CDS;424307;425017;;0;
deb;;CDS;459976;460971;367;*;
;;regulatory;461339;461464;137;*;
fin;;CDS;461602;462906;;0;
deb;comp;CDS;473892;474338;416;*;
;;regulatory;474755;474880;137;*;
fin;;CDS;475018;476358;;;
deb;;CDS;536211;537422;563;*;
;;rRNA;537986;540889;357;*;2904
fin;;CDS;541247;541735;;0;
deb;;CDS;564995;565951;92;*;
;;tRNA;566044;566117;23;*;cac
;;tRNA;566141;566212;32;*;caa
;;tRNA;566245;566330;289;*;tca
fin;;CDS;566620;567750;;;
deb;;CDS;570670;571383;602;*;
;;rRNA;571986;573512;79;*;1527
;;rRNA;573592;573709;4;*;118
;;tRNA;573714;573786;283;*;gca
;;rRNA;574070;576974;187;*;2905
fin;;CDS;577162;578526;;;
deb;;CDS;601262;601948;331;*;
;;rRNA;602280;603805;144;*;1526
;;rRNA;603950;604067;301;*;118
fin;;CDS;604369;605106;;;
deb;;CDS;614484;614675;407;*;
;;rRNA;615083;617986;260;*;2904
fin;comp;CDS;618247;619251;;0;
deb;;CDS;685823;686155;210;*;
;;misc_b;686366;686632;51;*;
fin;;CDS;686684;686965;;;
deb;comp;CDS;736286;737200;301;*;
;;rRNA;737502;737619;4;*;118
;;tRNA;737624;737696;489;*;ggc
fin;;CDS;738186;738905;;;
deb;;CDS;740293;740862;125;*;
;;tRNA;740988;741058;322;*;gga
fin;;CDS;741381;742271;;;
deb;;CDS;757105;759717;121;*;
;;tRNA;759839;759920;66;*;cta
fin;comp;CDS;759987;760835;;0;
deb;;CDS;786859;787458;71;*;
;;misc_b;787530;787823;195;*;
fin;;CDS;788019;789995;;;
deb;;CDS;825593;830971;885;*;
;;regulatory;831857;832030;230;*;
fin;;CDS;832261;833262;;;
deb;comp;CDS;910521;911774;224;*;
;;tRNA;911999;912083;148;*;ctt
;;tRNA;912232;912316;342;*;ctt
fin;;CDS;912659;914539;;0;
deb;;CDS;1015700;1016551;80;*;
;;misc_b;1016632;1016837;131;*;
fin;;CDS;1016969;1018252;;0;
deb;;CDS;1034743;1035147;44;*;
;;tRNA;1035192;1035265;142;*;cga
fin;comp;CDS;1035408;1036631;;;
deb;;CDS;1060209;1061090;61;*;
;;tRNA;1061152;1061225;231;*;agg
fin;;CDS;1061457;1061942;;0;
deb;;CDS;1135668;1136111;264;*;
;comp;tRNA;1136376;1136448;142;*;ccc
fin;;CDS;1136591;1137205;;;
deb;;CDS;1181242;1181676;81;*;
;;ncRNA;1181758;1182021;95;*;
fin;comp;CDS;1182117;1183028;;;
deb;;CDS;1228173;1228862;323;*;
;;rRNA;1229186;1230711;79;*;1526
;;rRNA;1230791;1230908;7;*;118
;;tRNA;1230916;1230989;53;*;atc
;;tRNA;1231043;1231115;262;*;gca
;;rRNA;1231378;1234281;111;*;2904
;;tRNA;1234393;1234464;9;*;aac
;;tRNA;1234474;1234545;6;*;gaa
;;tRNA;1234552;1234622;23;*;tgc
;;tRNA;1234646;1234717;58;*;aac
;;tRNA;1234776;1234846;132;*;tgc
fin;;CDS;1234979;1235152;;;
deb;;CDS;1279854;1280135;75;*;
;;tRNA;1280211;1280283;125;*;atgf
fin;;CDS;1280409;1281519;;;
deb;;CDS;1282595;1283137;112;*;
;;tRNA;1283250;1283320;5;*;gga
;;tRNA;1283326;1283399;5;*;aga
;;tRNA;1283405;1283478;31;*;cac
;;tRNA;1283510;1283581;23;*;caa
;;tRNA;1283605;1283677;30;*;aaa
;;tRNA;1283708;1283789;26;*;cta
;;tRNA;1283816;1283886;5;*;gga
;;tRNA;1283892;1283965;6;*;aga
;;tRNA;1283972;1284043;405;*;caa
fin;comp;CDS;1284449;1284907;;0;
deb;;CDS;1298530;1299468;91;*;
;;tRNA;1299560;1299632;4;*;ggc
;;tRNA;1299637;1299711;227;*;cca
fin;comp;CDS;1299939;1300463;;;
deb;;CDS;1317893;1318795;58;*;
;;misc_b;1318854;1319058;143;*;
fin;;CDS;1319202;1320467;;;
deb;;CDS;1330208;1331050;68;*;
;;regulatory;1331119;1331225;168;*;
fin;;CDS;1331394;1332701;;;
deb;;CDS;1344739;1346154;53;*;
;;tRNA;1346208;1346290;124;*;ctg
fin;;CDS;1346415;1347350;;;
deb;;CDS;1361763;1362872;473;*;
;;tRNA;1363346;1363428;454;*;ctg
fin;comp;CDS;1363883;1365469;;;
deb;;CDS;1501342;1502331;88;*;
;;misc_b;1502420;1502635;130;*;
fin;;CDS;1502766;1505162;;0;
deb;;CDS;1514802;1515092;141;*;
;;tRNA;1515234;1515305;62;*;gaa
;;tRNA;1515368;1515442;22;*;cca
;;tRNA;1515465;1515537;174;*;aaa
fin;;CDS;1515712;1516611;;;
deb;comp;CDS;1536473;1538146;169;*;
;;misc_b;1538316;1538527;148;*;
fin;;CDS;1538676;1539512;;;
deb;;CDS;1558609;1559226;150;*;
;;ncRNA;1559377;1559568;105;*;
fin;;CDS;1559674;1560162;;;
deb;comp;CDS;1596655;1597152;139;*;
;;tRNA;1597292;1597364;198;*;acg
fin;;CDS;1597563;1600298;;0;
deb;;CDS;1776389;1777042;54;*;
;;regulatory;1777097;1777202;89;*;
fin;;CDS;1777292;1778305;;;
deb;;CDS;1809551;1811686;53;*;
;;regulatory;1811740;1811862;110;*;
fin;;CDS;1811973;1812599;;0;
deb;;CDS;1897547;1898221;77;*;
;;misc_b;1898299;1898549;46;*;
fin;;CDS;1898596;1899603;;;
deb;;CDS;2051328;2051531;445;*;
;comp;tRNA;2051977;2052063;101;*;acc
fin;comp;CDS;2052165;2053262;;;
deb;;CDS;2064667;2065113;238;*;
;;tRNA;2065352;2065425;29;*;ata
fin;;CDS;2065455;2066012;;;
deb;;CDS;2089815;2090282;195;*;
;comp;tRNA;2090478;2090550;93;*;acc
fin;comp;CDS;2090644;2091279;;0;
deb;;CDS;2125666;2126805;19;*;
;;misc_b;2126825;2127056;63;*;
fin;;CDS;2127120;2127326;;;
deb;comp;CDS;2290223;2291446;61;*;
;comp;misc_b;2291508;2291704;185;*;
fin;;CDS;2291890;2293848;;0;
deb;;CDS;2378236;2379462;104;*;
;;misc_b;2379567;2379785;50;*;
fin;;CDS;2379836;2380420;;;
deb;comp;CDS;2393679;2394266;154;*;
;;tRNA;2394421;2394501;3;*;tac
;;tRNA;2394505;2394577;223;*;ttc
fin;;CDS;2394801;2396147;;;
deb;comp;CDS;2447012;2447701;85;*;
;comp;regulatory;2447787;2447882;852;*;
fin;comp;CDS;2448735;2450363;;;
deb;comp;CDS;2573684;2574703;297;*;
;;ncRNA;2575001;2575351;65;*;
fin;comp;CDS;2575417;2577075;;;
deb;comp;CDS;2589039;2590424;65;*;
;comp;misc_b;2590490;2590663;90;*;
fin;comp;CDS;2590754;2591524;;;
deb;comp;CDS;2591541;2592140;201;*;
;;tRNA;2592342;2592422;112;*;ttg
fin;;CDS;2592535;2593464;;0;
deb;comp;CDS;2603463;2605496;527;*;
;;tRNA;2606024;2606100;409;*;ttg
fin;comp;CDS;2606510;2606668;;;
deb;comp;CDS;2735781;2737136;95;*;
;comp;tRNA;2737232;2737304;155;*;gcc
fin;comp;CDS;2737460;2738386;;0;
deb;comp;CDS;2797787;2798278;523;*;
;comp;tRNA;2798802;2798874;178;*;aag
fin;comp;CDS;2799053;2800327;;;
deb;comp;CDS;2820846;2822237;109;*;
;comp;misc_b;2822347;2822575;116;*;
fin;comp;CDS;2822692;2823483;;;
deb;comp;CDS;2848560;2849579;82;*;
;comp;misc_b;2849662;2849892;105;*;
fin;comp;CDS;2849998;2851539;;;
deb;comp;CDS;2880836;2881429;141;*;
;comp;tRNA;2881571;2881642;116;*;gag
fin;comp;CDS;2881759;2882100;;;
deb;comp;CDS;2978303;2979394;255;*;
;comp;regulatory;2979650;2979765;74;*;
fin;comp;CDS;2979840;2980706;;;
deb;comp;CDS;3048813;3049790;231;*;
;comp;tmRNA;3050022;3050370;186;*;
fin;comp;CDS;3050557;3051027;;0;
deb;comp;CDS;3096224;3097831;76;*;
;comp;misc_b;3097908;3098167;611;*;
fin;comp;CDS;3098779;3100596;;0;
deb;comp;CDS;3190635;3191126;123;*;
;comp;misc_f;3191250;3191389;88;*;
deb;comp;CDS;3191478;3193451;103;*;
;comp;misc_b;3193555;3193827;401;*;
fin;comp;CDS;3194229;3194576;;;
deb;comp;CDS;3214425;3215258;212;*;
;comp;tRNA;3215471;3215545;209;*;cca
fin;comp;CDS;3215755;3217302;;;
deb;comp;CDS;3252067;3252252;329;*;
;comp;tRNA;3252582;3252655;7;*;atgj
;comp;tRNA;3252663;3252735;4;*;gta
;comp;tRNA;3252740;3252813;10;*;gac
;comp;tRNA;3252824;3252896;20;*;tgg
;comp;tRNA;3252917;3252988;149;*;aac
deb;;CDS;3253138;3253587;87;*;
;comp;tRNA;3253675;3253748;7;*;atgj
;comp;tRNA;3253756;3253828;9;*;gta
;comp;tRNA;3253838;3253910;18;*;tgg
;comp;tRNA;3253929;3254000;61;*;aac
;comp;rRNA;3254062;3256966;336;*;2905
fin;comp;CDS;3257303;3257995;;0;
deb;comp;CDS;3407358;3408182;69;*;
;comp;regulatory;3408252;3408361;113;*;
fin;comp;CDS;3408475;3410325;;;
deb;comp;CDS;3489519;3490856;58;*;
;comp;regulatory;3490915;3491016;261;*;
fin;;CDS;3491278;3492633;;0;
deb;;CDS;3618295;3619479;125;*;
;comp;tRNA;3619605;3619677;4;*;aca
;comp;tRNA;3619682;3619755;50;*;cgt
;comp;tRNA;3619806;3619879;27;*;cgt
;comp;tRNA;3619907;3619990;6;*;tta
;comp;tRNA;3619997;3620069;47;*;gta
;comp;tRNA;3620117;3620190;25;*;gac
;comp;tRNA;3620216;3620289;23;*;atgi
;comp;tRNA;3620313;3620385;14;*;aca
;comp;tRNA;3620400;3620471;9;*;gaa
;comp;tRNA;3620481;3620552;111;*;aac
;comp;rRNA;3620664;3623567;262;*;2904
;comp;tRNA;3623830;3623902;53;*;gca
;comp;tRNA;3623956;3624029;7;*;atc
;comp;rRNA;3624037;3624154;79;*;118
;comp;rRNA;3624234;3625759;151;*;1526
;comp;tRNA;3625911;3625999;33;*;tcc
;comp;tRNA;3626033;3626118;267;*;tca
fin;comp;CDS;3626386;3627084;;0;
deb;comp;CDS;3713386;3714387;249;*;
;comp;tRNA;3714637;3714709;4;*;gta
;comp;tRNA;3714714;3714787;310;*;atgj
fin;comp;CDS;3715098;3715457;;;
deb;comp;CDS;3740094;3741623;336;*;
;comp;regulatory;3741960;3742137;71;*;
fin;comp;CDS;3742209;3742868;;;
deb;comp;CDS;3876932;3877417;18;*;
;comp;misc_f;3877436;3877575;59;*;
fin;comp;CDS;3877635;3878774;;;
deb;comp;CDS;3921947;3923137;87;*;
;comp;regulatory;3923225;3923325;65;*;
fin;comp;CDS;3923391;3923816;;;
deb;comp;CDS;3971663;3972166;188;*;
;;misc_b;3972355;3972601;74;*;
fin;;CDS;3972676;3975807;;0;
deb;comp;CDS;4298681;4299859;146;*;
;comp;misc_b;4300006;4300267;210;*;
fin;;CDS;4300478;4301533;;0;
deb;comp;CDS;4552288;4553814;82;*;
;comp;misc_b;4553897;4554160;196;*;
fin;;CDS;4554357;4554878;;0;
deb;comp;CDS;4592703;4593860;153;*;
;comp;regulatory;4594014;4594127;357;*;
fin;;CDS;4594485;4595609;;;
deb;comp;CDS;4661871;4663577;550;*;
;;regulatory;4664128;4664228;86;*;
fin;;CDS;4664315;4664980;;0;
deb;comp;CDS;4694284;4695744;237;*;
;comp;regulatory;4695982;4696073;275;*;
fin;comp;CDS;4696349;4697491;;0;

hmo[modifier | modifier le wikicode]

hmo opérons[modifier | modifier le wikicode]

57%GC;24.7.19 Paris;16s ;109;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Heliobacterium modesticaldum Ice1 ATCC 51547 ;;;;;;;;;;
;103699..104088;;CDS;;380;;;;130;
;;;;;;;;;;
;104469..105695;;CDS;;186;186;;;409;186
comp;105882..105956;;ggc;;1;;1;;;
comp;105958..106044;;ctg;;321;321;;;;
comp;106366..106929;;CDS;@1;241;241;;;188;241
comp;107171..107246;;aca;;202;202;;;;202
comp;107449..108183;;CDS;;111772;;;;245;
;;;;;;;;;;
comp;219956..220483;;CDS;;260;260;;;176;260
comp;220744..220820;;gac;;5;;;5;;
comp;220826..220901;;gta;;10;;;10;;
comp;220912..220987;;gaa;;4;;;4;;
comp;220992..221067;;aaa;;18;;;18;;
comp;221086..221160;;caa;;103;;;;;
comp;221264..224182;;23s;;237;;;;;
comp;224420..224495;;gcc;;64;;;;;
comp;224560..224676;;5s;@2;328;;;;;
comp;225005..226536;;16s;;651;651;;;;
comp;227188..228162;;CDS;;98792;;;;325;
;;;;;;;;;;
comp;326955..328340;;CDS;;178;178;;;462;178
comp;328519..328601;;cta;;65;;65;;;
comp;328667..328743;;aga;;60;;60;;;
comp;328804..328880;;cca;;568;568;;;;
comp;329449..330090;;CDS;;57730;;;;214;
;;;;;;;;;;
comp;387821..388105;;CDS;;135;135;;;95;
;388241..388317;;ccc;;7;;7;;;
;388325..388410;;tac;;47;47;;;;47
comp;388458..388742;;CDS;;588493;;;;95;
;;;;;;;;;;
comp;977236..978504;;CDS;;439;439;;;423;
comp;978944..981860;;23s;;237;;;;;
comp;982098..982173;;gcc;;64;;;;;
comp;982238..982354;;5s;;328;;;;;
comp;982683..984208;;16s;;460;;;;;
comp;984669..984744;;tgg;@3;5;;;5;;
comp;984750..984824;;cgg;;207;207;;;;207
comp;985032..987656;;CDS;;26258;;;;875;
;;;;;;;;;;
comp;1013915..1014760;;CDS;;105;105;;;282;105
comp;1014866..1014942;;gac;;75;;75;;;
comp;1015018..1015093;;gaa;;265;265;;;;
comp;1015359..1016642;;CDS;;40115;;;;428;
;;;;;;;;;;
;1056758..1058014;;CDS;;121;121;;;419;121
comp;1058136..1058233;;tga;;173;173;;;;
;1058407..1058733;;CDS;;62951;;;;109;
;;;;;;;;;;
;1121685..1122878;;CDS;;588;588;;;398;
;1123467..1124998;;16s;;328;;;;;
;1125327..1125443;;5s;;64;;;;;
;1125508..1125583;;gcc;;233;;;;;
;1125817..1128734;;23s;;337;337;;;;337
>;1129072..1129785;;CDS;;24938;;;;238;
;;;;;;;;;;
;1154724..1155224;;CDS;;99;99;;;167;
;1155324..1155413;;tca;;56;56;;;;56
comp;1155470..1156627;;CDS;;13350;;;;386;
;;;;;;;;;;
;1169978..1171828;;CDS;;129;129;;;617;129
;1171958..1172034;;cgt;;85;;85;;;
;1172120..1172196;;agg;;181;181;;;;
;1172378..1172812;;CDS;;62;62;;;145;62
;1172875..1172966;;tcg;;548;548;;;;
;1173515..1174330;;CDS;;6655;;;;272;
;;;;;;;;;;
comp;1180986..1182974;;CDS;;444;444;;;663;
;1183419..1183512;;tcc;;39;39;;;;39
;1183552..1183817;;ncRNA;;11908;;;;89;
;;;;;;;;;;
;1195726..1195998;;CDS;;181;181;;;91;
;1196180..1196255;;gcg;;151;151;;;;151
;1196407..1197051;;CDS;;86894;;;;215;
;;;;;;;;;;
comp;1283946..1285331;;CDS;;177;177;;;462;177
;1285509..1285584;;atgf;;5;;5;;;
;1285590..1285667;;atgj;;7;;7;;;
;1285675..1285750;;gaa;;542;542;;;;
;1286293..1287630;;CDS;;63447;;;;446;
;;;;;;;;;;
;1351078..1352549;;CDS;;704;704;;;491;
;1353254..1354786;;16s;;252;;;;;
;1355039..1355155;;5s;;64;;;;;
;1355220..1355296;;atc;;194;;;;;
;1355491..1358408;;23s;;112;;;;;
;1358521..1358595;;aac;;109;109;;;;109
comp;1358705..1358926;;CDS;;139555;;;;74;
;;;;;;;;;;
;1498482..1498898;;CDS;;535;535;;;139;
comp;1499434..1499509;;acg;;238;238;;;;238
;1499748..1500836;;CDS;;262182;;;;363;
;;;;;;;;;;
;1763019..1763858;;CDS;;68;68;;;280;68
;1763927..1764003;;gac;;4;;4;;;
;1764008..1764083;;ttc;;3;;3;;;
;1764087..1764161;;ggc;;92;92;;;;
comp;1764254..1764493;;CDS;;72;72;;;80;72
;1764566..1764641;;tgc;;18;;18;;;
;1764660..1764746;;tta;;253;253;;;;
comp;1765000..1765467;;CDS;;52131;;;;156;
;;;;;;;;;;
;1817599..1818318;;CDS;;487;487;;;240;
;1818806..1820337;;16s;;252;;;;;
;1820590..1820706;;5s;;64;;;;;
;1820771..1820847;;atc;;6;;;6;;
;1820854..1820929;;gca;;229;;;;;
;1821159..1824076;;23s;;112;;;;;
;1824189..1824263;;aac;;6;;;6;;
;1824270..1824345;;atgf;;243;243;;;;243
;1824589..1825014;;CDS;;168198;;;;142;
;;;;;;;;;;
;1993213..1994328;;CDS;;99;99;;;372;
;1994428..1994502;;atgi;;41;41;;;;41
;1994544..1995368;;CDS;;284281;;;;275;
;;;;;;;;;;
;2279650..2279997;;CDS ;;541;541;;;116;
;2280539..2282070;;16s;;253;;;;;
;2282324..2282440;;5s;;64;;;;;
;2282505..2282580;;gcc;;234;;;;;
;2282815..2285735;;23s;;119;;;;;
;2285855..2285948;;tcc;;6;;;6;;
;2285955..2286031;;ccg;;10;;;10;;
;2286042..2286115;;gga;;14;;;14;;
;2286130..2286205;;cac;;1;;;1;;
;2286207..2286281;;tgc;;9;;;9;;
;2286291..2286367;;gtc;;3;;;3;;
;2286371..2286446;;ttc;;6;;;6;;
;2286453..2286537;;tac;;4;;;4;;
;2286542..2286616;;caa;;17;;;17;;
;2286634..2286709;;aaa;;4;;;4;;
;2286714..2286789;;gaa;;5;;;5;;
;2286795..2286870;;gta;;5;;;5;;
;2286876..2286952;;gac;;7;;;7;;
;2286960..2287050;;agc;;43;;;43;;
;2287094..2287170;;ccc;;30;;;30;;
;2287201..2287287;;ctg;;3;;;3;;
;2287291..2287365;;ggc;;4;;;4;;
;2287370..2287446;;cgt;;4;;;4;;
;2287451..2287526;;acc;;352;352;;;;352
;2287879..2288343;;CDS ;;33184;;;;155;
;;;;;;;;;;
comp;2321528..2322544;;CDS ;;268;268;;;339;
comp;2322813..2322889;;gtc;;9;;9;;;
comp;2322899..2322973;;cgg;;81;81;;;;81
comp;2323055..2323243;;CDS ;;3375;;;;63;
;;;;;;;;;;
;2326619..2327947;;CDS ;;464;464;;;443;464
;2328412..2329943;;16s;;327;;;;;
;2330271..2330387;;5s;;226;;;;;
;2330614..2333532;;23s;;98;;;;;
;2333631..2333706;;aaa;;4;;;4;;
;2333711..2333786;;acc;;8;;;8;;
;2333795..2333877;;ctc;;89;89;;;;89
comp;2333967..2334704;;CDS;;7389;;;;246;
;;;;;;;;;;
;2342094..2342804;;CDS;;155;155;;;237;155
comp;2342960..2343030;;ttc;;213;213;;;;
;2343244..2343936;;CDS;;563;563;;;231;
;2344500..2346025;;16s;;252;;;;;
;2346278..2346394;;5s;;64;;;;;
;2346459..2346535;;atc;;141;;;;;
;2346677..2349594;;23s;;100;;;;;
;2349695..2349769;;aac;;6;;;6;;
;2349776..2349851;;atgf;;102;102;;;;102
;2349954..2350976;;CDS;;113601;;;;341;
;;;;;;;;;;
;2464578..2465114;;CDS;;271;271;;;179;271
comp;2465386..2465461;;aca;;432;432;;;;
;2465894..2466226;;CDS;;4722;;;;111;
;;;;;;;;;;
;2470949..2471977;;CDS;;69;69;;;343;69
;2472047..2472133;;ctg;;678;678;;;;
;2472812..2473192;;CDS;;22232;;;;127;
;;;;;;;;;;
;2495425..2496048;;CDS;;402;402;;;208;
comp;2496451..2496527;;gtc;;4;;4;;;
comp;2496532..2496609;;atgj;;175;175;;;;175
;2496785..2497120;;CDS;;217;217;;;112;
comp;2497338..2497420;;ctc;;7;;7;;;
comp;2497428..2497503;;acc;;18;;18;;;
comp;2497522..2497596;;tgg;;14;;14;;;
comp;2497611..2497684;;ggg;;19;;19;;;
comp;2497704..2497778;;ggc;;7;;7;;;
comp;2497786..2497873;;ttg;;8;;8;;;
comp;2497882..2497958;;gtg;;-10;-10;;;;-10
comp;2497949..2498185;;CDS;;66;66;;;79;66
;2498252..2498328;;ccg;;314;314;;;;
comp;2498643..2499506;;CDS;;55292;;;;288;
;;;;;;;;;;
;2554799..2554984;;CDS;;109;109;;;62;109
;2555094..2555169;;gaa;;2;;2;;;
;2555172..2555247;;ttc;;6;;6;;;
;2555254..2555338;;tac;;4;;4;;;
;2555343..2555417;;caa;;18;;18;;;
;2555436..2555511;;aaa;;4;;4;;;
;2555516..2555590;;ggc;;9;;9;;;
;2555600..2555675;;cac;;117;117;;;;
comp;2555793..2557049;;CDS;;235940;;;;419;
;;;;;;;;;;
comp;2792990..2793442;;CDS;;219;219;;;151;219
comp;2793662..2796583;;23s;;236;;;;;
comp;2796820..2796895;;gca;;6;;;6;;
comp;2796902..2796978;;atc;;64;;;;;
comp;2797043..2797159;;5s;;328;;;;;
comp;2797488..2799019;;16s;;505;;;;;
comp;2799525..2799599;;ggc;+;1;;;1;;
comp;2799601..2799687;;ctg;2 ggc;32;;;32;;
comp;2799720..2799796;;ccc;;42;;;42;;
comp;2799839..2799915;;cgt;;4;;;4;;
comp;2799920..2799994;;ggc;;120;;;120;;
comp;2800115..2800192;;atgj;;42;;;42;;
comp;2800235..2800325;;agc;;16;;;16;;
comp;2800342..2800417;;atgf;;6;;;6;;
comp;2800424..2800498;;aac;;7;;;7;;
comp;2800506..2800581;;gaa;;4;;;4;;
comp;2800586..2800661;;aaa;;18;;;18;;
comp;2800680..2800754;;caa;;4;;;4;;
comp;2800759..2800843;;tac;;91;;;91;;
comp;2800935..2801011;;gtc;;7;;;7;;
comp;2801019..2801093;;tgc;;325;325;;;;
;2801419..2801724;;CDS;;230813;;;;102;
;;;;;;;;;;
;3032538..3032729;;CDS;;109;109;;;64;109
comp;3032839..3035757;;23s;;233;;;;;
comp;3035991..3036066;;gcc;;64;;;;;
comp;3036131..3036247;;5s;;253;;;;;
comp;3036501..3038026;;16s;;779;779;;;;
comp;3038806..3040017;;CDS;;232;;;;404;
;;;;;;;;;;
comp;3040250..3042013;;CDS;;;;;;588;

hmo cumuls[modifier | modifier le wikicode]

hmo cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;1;2;1;1;40;1;100;10
;16 5s gcc 23;5;20;20;34;50;3;80;8;200;16
;16 5s atc 23;2;40;0;2;100;11;120;7;300;14
;16 5 23s a;1;60;1;3;150;9;160;4;400;8
;max a;20;80;2;0;200;9;200;4;500;11
;a doubles;1;100;1;1;250;8;240;4;600;0
;16 5s atc gca;2;120;0;1;300;5;280;4;700;2
;total aas;60;140;0;0;350;4;320;0;800;0
sans ;opérons;24;160;0;0;400;1;360;2;900;1
;1 aa;12;180;0;0;450;4;400;0;1000;0
;max a;7;200;0;0;500;2;440;0;1100;0
;a doubles;0;;0;0;;11;;1;;0
;total aas;49;;25;43;;68;;35;;62
total aas;;109;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;8;8;;196;;137;;230
;;;variance;6;7;;120;;71;;128

hmo blocs[modifier | modifier le wikicode]

hmo blocs;;;;;tgg
CDS ;541;651;588;779;460
16s;253;328;328;253;328
5s;64;64;64;64;64
gcc;234;237;233;233;237
23s;119;103;337;109;439
tcc;tcc;caa;cds;cds;cds
;;;;;
CDS;704;563;;CDS ;464
16s;252;252;;16s;327
5s;64;64;;5s;226
atc;194;141;;23s;98
23s;112;100;;aaa;
aac;aac;aac;;;
;;;;;
;;ggc;;;
CDS;487;505;;;
16s;252;328;;;
5s;64;64;;;
atc;6;6;;;
gca;229;236;;;
23s;112;219;;;
aac;aac;cds;;;

hmo distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;;;;;;;;;1-3 aas;atgi;;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;ctc;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;acc;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;3 aac;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;;;ttc;2;tcc;;tac;2;tgc;1;;;;;;;;;;aaa;ttc;1;tcc;1;tac;2;tgc;2
atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;;;;;;;;;;;2 atgf;atc;;acc;1;aac;1;agc;2
ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;1;cac;1;cgt;1;;;;;;;;;;tgg;ctc;;ccc;2;cac;1;cgt;2
gtc;;gcc;;gac;;ggc;;;gtc;2;gcc;;gac;2;ggc;4;;;;;;;;;;cgg;gtc;2;gcc;;gac;2;ggc;3
tta;;tca;1;taa;;tga;1;;tta;1;tca;;taa;;tga;;;;;;;;;;;;tta;;tca;;taa;;tga;
ata;;aca;2;aaa;;aga;;;ata;;aca;;aaa;1;aga;1;;;;;;;;;;;ata;;aca;;aaa;3;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;1;cga;;;;;;;;;;;;cta;;cca;;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;3;gga;;;;;;;;;;;;gta;2;gca;;gaa;3;gga;1
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;;;;;;;;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;;;atgj;2;acg;;aag;;agg;1;;;;;;;;;;;atgj;1;acg;;aag;;agg;
ctg;1;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;;;;;;;;;;ctg;2;ccg;1;cag;;cgg;
gtg;;gcg;1;gag;;ggg;;;gtg;1;gcg;;gag;;ggg;1;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
hmo;;12;;;;;12;;hmo;37;;;;;;37;;;;;;;;;;;hmo;;;;39;;11;39
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;10 1-3 aas;;;

hmo données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: hmo données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA contig;;tRNA tRNA;;;Sup 400;Sup 400;Sup 500
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;hmo;long;long;long
fxt;fct;hmo;fx;fc;hmo;fx40;fc40;hmo;x-;c-;c;x;c;x;c;aa;c;aa;c;x;aa;fx;fc;fc
;0;0;0;17;0;0;17;-1;0;36;321;186;CDS 16s;;16s 5s;;tRNA contig;;tRNA tRNA;;hors bloc;401;401;501
;0;10;9;183;1;1;21;-2;1;0;268;135;652;;4* 337;;5;gac;1;;ggc;405;402;502
;0;20;10;167;2;3;38;-3;0;0;202;121;20;;3* 261;;10;gta;**;;ctg;406;403;504
;0;30;4;109;3;0;37;-4;3;149;260;173;559;;2* 262;;4;gaa;65;;cta;408;404;505
;0;40;6;77;4;0;21;-5;0;0;268;56;705;;336;;18;aaa;60;;aga;412;404;506
;0;50;9;70;5;0;18;-6;0;0;176;444;488;;5s 23s;;**;caa;**;;cca;415;408;508
1;0;60;9;64;6;2;9;-7;0;11;1012;159;542;;230;;6;aac;7;;ccc;426;408;512
;3;70;8;66;7;0;8;-8;0;23;159;535;459;;5s tRNA;;**;atgf;**;;tac;427;408;513
1;0;80;12;71;8;0;7;-9;0;1;207;238;558;;5* 64;gcc;6;tcc;5;;tgg;430;412;515
1;1;90;27;71;9;3;11;-10;0;7;165;92;506;;4* 64;atc;10;ccg;**;;cgg;431;413;517
1;2;100;7;68;10;0;13;-11;0;17;265;72;774;;tRNA 23s;;14;gga;75;;gac;436;414;519
;1;110;18;66;11;1;15;-12;0;0;99;253;23s CDS;;2* 241;gcc;1;cac;**;;gaa;442;415;520
1;1;120;18;53;12;1;16;-13;1;8;129;89;463;109;2* 237;gcc;9;tgc;85;;cgt;446;416;526
1;2;130;16;56;13;1;24;-14;0;15;157;158;322;;198;atc;3;gtc;**;;agg;455;417;529
1;0;140;16;47;14;0;23;-15;1;0;62;222;223;;233;gca;6;ttc;5;;atgf;470;419;544
;1;150;16;57;15;0;15;-16;0;0;551;271;;;238;gcc;4;tac;7;;atgj;473;421;544
2;2;160;12;43;16;0;13;-17;0;12;181;432;;;145;atc;17;caa;**;;gaa;485;422;545
;1;170;10;46;17;1;16;-18;0;0;205;402;;;240;gca;4;aaa;4;;gac;492;424;549
2;1;180;16;36;18;1;18;-19;0;3;542;175;;;23s tRNA;;5;gaa;3;;ttc;496;427;551
1;1;190;10;32;19;3;11;-20;0;8;431;217;;;103;caa;5;gta;**;;ggc;502;428;563
;0;200;7;31;20;2;16;-21;0;0;68;314;;;2* 112;aac;7;gac;18;;tgc;507;429;573
;3;210;14;24;21;2;16;-22;0;2;243;117;;;119;tcc;43;agc;**;;tta;518;433;575
1;0;220;8;32;22;0;6;-23;0;5;99;325;;;98;aaa;30;ccc;9;;gtc;519;433;575
1;0;230;15;20;23;0;9;-24;0;0;116;;;;100;aac;3;ctg;**;;cgg;523;435;580
1;0;240;16;27;24;0;12;-25;0;4;352;;;;tRNA tRNA;intra;4;ggc;4;;gtc;528;435;594
;1;250;15;30;25;0;4;-26;0;2;268;;;;2* 6;atc;4;cgt;**;;atgj;535;439;595
1;1;260;10;23;26;0;12;-27;0;0;81;;;;**;gca;**;acc;7;;ctc;535;440;602
;4;270;7;17;27;0;19;-28;0;2;126;;;;;;4;aaa;18;;acc;537;440;603
1;0;280;7;21;28;1;13;-29;0;1;69;;CDS-CDS;inf 50;;;8;acc;14;;tgg;546;441;625
;0;290;7;20;29;0;8;-30;0;0;148;;intercalaire;;;;**;ctc;19;;ggg;547;441;629
;0;300;6;16;30;1;10;-31;0;1;109;;c-;x-;;;6;aac;7;;ggc;552;443;641
;0;310;5;13;31;1;11;-32;1;3;;;-119;-115;;;**;atgf;8;;ttg;562;445;656
1;0;320;7;10;32;1;8;-33;0;0;;;-119;-51;;;1;ggc;;293;gtg;566;449;656
1;1;330;12;12;33;0;14;-34;1;1;;;-110;;;;32;ctg;**;;ccg;567;452;667
;0;340;1;11;34;0;6;-35;0;1;;;-95;;;;42;ccc;2;;gaa;571;453;669
;0;350;6;6;35;1;6;-36;0;0;;;-88;;;;4;cgt;6;;ttc;578;455;685
;1;360;3;10;36;1;11;-37;0;2;;;-83;;;;120;ggc;4;;tac;585;455;687
;0;370;12;13;37;0;7;-38;0;2;;;-80;;;;42;atgj;18;;caa;598;455;692
;0;380;3;11;38;1;4;-39;0;0;;;-68;;;;16;agc;4;;aaa;609;457;696
;0;390;6;7;39;0;4;-40;1;0;;;-62;;;;6;atgf;9;;ggc;625;458;699
;0;400;2;6;40;1;6;-41;0;0;;;-59;;;;7;aac;**;;cac;641;458;714
4;4;reste;58;108;reste;431;1314;-42;0;0;;;-56;;;;4;gaa;;;;659;458;731
23;31;total;460;1867;total;460;1867;-43;0;0;;;-55;;;;18;aaa;;;;661;459;738
19;27;diagr;402;1742;diagr;29;536;-44;0;0;;;-53;;;;4;caa;;;;661;459;771
0;0; t30;23;459;;;;-45;0;0;;;-53;;;;91;tac;;;;690;468;795
;;;;;;;;-46;0;0;;;-52;;;;7;gtc;;;;711;468;871
;;Récapitulatif des effectifs;;;;;;-47;0;1;;;total;intercalaires;;;**;tgc;;;;715;468;916
;;>0;<0;zéro;total;*;;-48;0;0;;;;396,94;;;;;;;;738;469;971
;x;460;11;0;471;;;-49;0;0;;;ADN long;3,075,407;;;;;;;;756;477;1032
;c;1850;332;17;2199;;;-50;0;0;;;%;12.9;;;;;;;;770;480;1121
;;;;;2670;223;;reste;2;0;15;;;;;;;;;;;796;481;1316
;;;;;;2893;;total;11;332;;;non RNA;51;;;;;;;;797;482;1644
;;;;;;;;;;;;;;;;;;;;;;828;483;
;;;;;;;;;;;;;;;;;;;;;;873;489;
;;;;;;;;;;;;;;;;;;;;;;879;497;
;;;;;;;;;;;;;;;;;;;;;;930;500;
;;;;;;;;;;;;;;;;;;;;;;1242;;
;;;;;;;;;;;;;;;;;;;;;;1458;;

hmo autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: hmo autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;hmo;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;comp;CDS;83932;85227;106;*;
;comp;regulatory;85334;85456;283;*;
fin;;CDS;85740;86651;;;
deb;;CDS;104469;105695;186;*;
;comp;tRNA;105882;105956;1;*;ggc
;comp;tRNA;105958;106044;321;*;ctg
deb;comp;CDS;106366;106902;268;*;
;comp;tRNA;107171;107246;202;*;aca
fin;comp;CDS;107449;108138;;;
deb;comp;CDS;119439;119855;458;*;
;comp;regulatory;120314;120402;165;*;
fin;comp;CDS;120568;129390;;;
deb;comp;CDS;219956;220483;260;*;
;comp;tRNA;220744;220820;5;*;gac
;comp;tRNA;220826;220901;10;*;gta
;comp;tRNA;220912;220987;4;*;gaa
;comp;tRNA;220992;221067;18;*;aaa
;comp;tRNA;221086;221160;103;*;caa
;comp;rRNA;221264;224178;241;*;2915
;comp;tRNA;224420;224495;64;*;gcc
;comp;rRNA;224560;224676;337;*;117
;comp;rRNA;225014;226535;652;*;1522
fin;comp;CDS;227188;228162;;;
deb;;CDS;268169;269791;139;*;
;;repeat_region;269931;271232;197;*;
fin;comp;CDS;271430;272362;;;
deb;comp;CDS;326955;328250;268;*;
;comp;tRNA;328519;328601;65;*;cta
;comp;tRNA;328667;328743;60;*;aga
;comp;tRNA;328804;328880;176;*;cca
fin;comp;CDS;329057;329254;;;
deb;;CDS;377234;378433;102;*;
;;ncRNA;378536;378894;134;*;
fin;;CDS;379029;380159;;;
deb;;CDS;384528;384812;140;*;
;;misc_b;384953;385256;391;*;
fin;;CDS;385648;387258;;0;
deb;comp;CDS;387821;388105;135;*;
;;tRNA;388241;388317;7;*;ccc
;;tRNA;388325;388410;1012;*;tac
fin;;CDS;389423;390235;;0;
deb;comp;CDS;562422;562793;296;*;
;;regulatory;563090;563272;296;*;
fin;;CDS;563569;564243;;;
deb;comp;CDS;574512;575822;83;*;
;comp;regulatory;575906;576021;352;*;
fin;;CDS;576374;577480;;0;
deb;comp;CDS;600853;602214;294;*;
;;repeat_region;602509;603596;212;*;
fin;comp;CDS;603809;605377;;;
deb;;CDS;644127;645932;398;*;
;comp;tmRNA;646331;646683;325;*;
fin;;CDS;647009;648202;;0;
deb;comp;CDS;977236;978480;463;*;
;comp;rRNA;978944;981856;241;*;2913
;comp;tRNA;982098;982173;64;*;gcc
;comp;rRNA;982238;982354;337;*;117
;comp;rRNA;982692;984213;20;*;1522
deb;comp;CDS;984234;984509;159;*;
;comp;tRNA;984669;984744;5;*;tgg
;comp;tRNA;984750;984824;207;*;cgg
fin;comp;CDS;985032;987656;;;
deb;comp;CDS;1013915;1014700;165;*;
;comp;tRNA;1014866;1014942;75;*;gac
;comp;tRNA;1015018;1015093;265;*;gaa
fin;comp;CDS;1015359;1016642;;0;
deb;;CDS;1056587;1058014;121;*;
;comp;tRNA;1058136;1058233;173;*;tga
fin;;CDS;1058407;1058733;;;
deb;;CDS;1121685;1122878;589;*;
;;rRNA;1123468;1124989;337;*;1522
;;rRNA;1125327;1125443;64;*;117
;;tRNA;1125508;1125583;237;*;gcc
;;rRNA;1125821;1128734;322;*;2914
fin;;CDS;1129057;1129959;;;
deb;;CDS;1145930;1146832;103;*;
;;misc_b;1146936;1147145;99;*;
fin;;CDS;1147245;1148408;;;
deb;;CDS;1154724;1155224;99;*;
;;tRNA;1155324;1155413;56;*;tca
fin;comp;CDS;1155470;1156627;;;
deb;;CDS;1169978;1171828;129;*;
;;tRNA;1171958;1172034;85;*;cgt
;;tRNA;1172120;1172196;157;*;agg
deb;;CDS;1172354;1172812;62;*;
;;tRNA;1172875;1172966;551;*;tcg
fin;;CDS;1173518;1174330;;;
deb;comp;CDS;1180986;1182974;444;*;
;;tRNA;1183419;1183512;39;*;tcc
;;ncRNA;1183552;1183817;122;*;
fin;;CDS;1183940;1185760;;0;
deb;;CDS;1195726;1195998;181;*;
;;tRNA;1196180;1196255;205;*;gcg
fin;;CDS;1196461;1197051;;;
deb;comp;CDS;1202248;1202961;83;*;
;comp;regulatory;1203045;1203106;414;*;
fin;;CDS;1203521;1205617;;;
deb;comp;CDS;1283946;1285349;159;*;
;;tRNA;1285509;1285584;5;*;atgf
;;tRNA;1285590;1285667;7;*;atgj
;;tRNA;1285675;1285750;542;*;gaa
fin;;CDS;1286293;1287630;;0;
deb;;CDS;1351078;1352549;705;*;
;;rRNA;1353255;1354777;261;*;1523
;;rRNA;1355039;1355155;64;*;117
;;tRNA;1355220;1355296;198;*;atc
;;rRNA;1355495;1358408;112;*;2914
;;tRNA;1358521;1358595;431;*;aac
fin;;CDS;1359027;1360454;;0;
deb;;CDS;1387701;1388411;58;*;
;;misc_f;1388470;1388647;25;*;
fin;;CDS;1388673;1389203;;;
deb;;CDS;1498482;1498898;535;*;
;comp;tRNA;1499434;1499509;238;*;acg
fin;;CDS;1499748;1500836;;0;
deb;comp;CDS;1553617;1554957;296;*;
;;regulatory;1555254;1555354;211;*;
fin;;CDS;1555566;1556966;;0;
deb;;CDS;1733682;1734398;211;*;
;;regulatory;1734610;1734715;150;*;
fin;;CDS;1734866;1736005;;;
deb;;CDS;1763019;1763858;68;*;
;;tRNA;1763927;1764003;4;*;gac
;;tRNA;1764008;1764083;3;*;ttc
;;tRNA;1764087;1764161;92;*;ggc
deb;comp;CDS;1764254;1764493;72;*;
;;tRNA;1764566;1764641;18;*;tgc
;;tRNA;1764660;1764746;253;*;tta
fin;comp;CDS;1765000;1765479;;0;
deb;;CDS;1817623;1818318;488;*;
;;rRNA;1818807;1820328;261;*;1522
;;rRNA;1820590;1820706;64;*;117
;;tRNA;1820771;1820847;6;*;atc
;;tRNA;1820854;1820929;233;*;gca
;;rRNA;1821163;1824076;112;*;2914
;;tRNA;1824189;1824263;6;*;aac
;;tRNA;1824270;1824345;243;*;atgf
fin;;CDS;1824589;1825014;;;
deb;;CDS;1854540;1855880;78;*;
;;regulatory;1855959;1856148;170;*;
;;regulatory;1856319;1856511;32;*;
fin;;CDS;1856544;1857368;;;
deb;;CDS;1882378;1883172;126;*;
;;regulatory;1883299;1883521;158;*;
fin;;CDS;1883680;1884993;;;
deb;;CDS;1993213;1994328;99;*;
;;tRNA;1994428;1994502;116;*;atgi
fin;;CDS;1994619;1995368;;;
deb;comp;CDS;2030610;2030810;83;*;
;comp;regulatory;2030894;2030999;259;*;
fin;comp;CDS;2031259;2032233;;0;
deb;;CDS;2073488;2074249;237;*;
;;regulatory;2074487;2074659;123;*;
fin;;CDS;2074783;2076180;;;
deb;;CDS;2145684;2146346;57;*;
;;regulatory;2146404;2146520;136;*;
fin;;CDS;2146657;2147781;;;
deb;;CDS;2279650;2279997;542;*;
;;rRNA;2280540;2282061;262;*;1522
;;rRNA;2282324;2282440;64;*;117
;;tRNA;2282505;2282580;238;*;gcc
;;rRNA;2282819;2285735;119;*;2917
;;tRNA;2285855;2285948;6;*;tcc
;;tRNA;2285955;2286031;10;*;ccg
;;tRNA;2286042;2286115;14;*;gga
;;tRNA;2286130;2286205;1;*;cac
;;tRNA;2286207;2286281;9;*;tgc
;;tRNA;2286291;2286367;3;*;gtc
;;tRNA;2286371;2286446;6;*;ttc
;;tRNA;2286453;2286537;4;*;tac
;;tRNA;2286542;2286616;17;*;caa
;;tRNA;2286634;2286709;4;*;aaa
;;tRNA;2286714;2286789;5;*;gaa
;;tRNA;2286795;2286870;5;*;gta
;;tRNA;2286876;2286952;7;*;gac
;;tRNA;2286960;2287050;43;*;agc
;;tRNA;2287094;2287170;30;*;ccc
;;tRNA;2287201;2287287;3;*;ctg
;;tRNA;2287291;2287365;4;*;ggc
;;tRNA;2287370;2287446;4;*;cgt
;;tRNA;2287451;2287526;352;*;acc
fin;;CDS;2287879;2288343;;;
deb;;CDS;2303367;2303639;73;*;
;;regulatory;2303713;2303896;104;*;
fin;;CDS;2304001;2304804;;;
deb;comp;CDS;2321528;2322544;268;*;
;comp;tRNA;2322813;2322889;9;*;gtc
;comp;tRNA;2322899;2322973;81;*;cgg
fin;comp;CDS;2323055;2323441;;0;
deb;;CDS;2326619;2327947;459;*;
;;rRNA;2328407;2329934;336;*;1528
;;rRNA;2330271;2330387;230;*;117
;;rRNA;2330618;2333532;98;*;2915
;;tRNA;2333631;2333706;4;*;aaa
;;tRNA;2333711;2333786;8;*;acc
;;tRNA;2333795;2333877;89;*;ctc
fin;comp;CDS;2333967;2334704;;;
deb;;CDS;2342094;2342804;158;*;
;comp;tRNA;2342963;2343030;222;*;ttc
deb;;CDS;2343253;2343936;558;*;
;;rRNA;2344495;2346016;261;*;1522
;;rRNA;2346278;2346394;64;*;117
;;tRNA;2346459;2346535;145;*;atc
;;rRNA;2346681;2349594;100;*;2914
;;tRNA;2349695;2349769;6;*;aac
;;tRNA;2349776;2349851;126;*;atgf
fin;;CDS;2349978;2350976;;;
deb;;CDS;2375597;2375872;14;*;
;;regulatory;2375887;2376057;106;*;
fin;;CDS;2376164;2377375;;;
deb;;CDS;2464578;2465114;271;*;
;comp;tRNA;2465386;2465461;432;*;aca
fin;;CDS;2465894;2466226;;0;
deb;;CDS;2471030;2471977;69;*;
;;tRNA;2472047;2472133;148;*;ctg
fin;;CDS;2472282;2472431;;;
deb;;CDS;2478637;2479455;61;*;
;;misc_b;2479517;2479758;48;*;
fin;;CDS;2479807;2480301;;;
deb;comp;CDS;2488189;2488956;8;*;
;comp;regulatory;2488965;2489129;204;*;
fin;;CDS;2489334;2491055;;;
deb;;CDS;2495461;2496048;402;*;
;comp;tRNA;2496451;2496527;4;*;gtc
;comp;tRNA;2496532;2496609;175;*;atgj
deb;;CDS;2496785;2497120;217;*;
;comp;tRNA;2497338;2497420;7;*;ctc
;comp;tRNA;2497428;2497503;18;*;acc
;comp;tRNA;2497522;2497596;14;*;tgg
;comp;tRNA;2497611;2497684;19;*;ggg
;comp;tRNA;2497704;2497778;7;*;ggc
;comp;tRNA;2497786;2497873;8;*;ttg
;comp;tRNA;2497882;2497958;293;*;gtg
;;tRNA;2498252;2498328;314;*;ccg
fin;comp;CDS;2498643;2499167;;0;
deb;;CDS;2525576;2528362;87;*;
;;ncRNA;2528450;2528627;152;*;
fin;;CDS;2528780;2529436;;;
deb;;CDS;2554799;2554984;109;*;
;;tRNA;2555094;2555169;2;*;gaa
;;tRNA;2555172;2555247;6;*;ttc
;;tRNA;2555254;2555338;4;*;tac
;;tRNA;2555343;2555417;18;*;caa
;;tRNA;2555436;2555511;4;*;aaa
;;tRNA;2555516;2555590;9;*;ggc
;;tRNA;2555600;2555675;117;*;cac
fin;comp;CDS;2555793;2557220;;;
deb;comp;CDS;2792990;2793442;223;*;
;comp;rRNA;2793666;2796579;240;*;2914
;comp;tRNA;2796820;2796895;6;*;gca
;comp;tRNA;2796902;2796978;64;*;atc
;comp;rRNA;2797043;2797159;337;*;117
;comp;rRNA;2797497;2799018;506;*;1522
;comp;tRNA;2799525;2799599;1;*;ggc
;comp;tRNA;2799601;2799687;32;*;ctg
;comp;tRNA;2799720;2799796;42;*;ccc
;comp;tRNA;2799839;2799915;4;*;cgt
;comp;tRNA;2799920;2799994;120;*;ggc
;comp;tRNA;2800115;2800192;42;*;atgj
;comp;tRNA;2800235;2800325;16;*;agc
;comp;tRNA;2800342;2800417;6;*;atgf
;comp;tRNA;2800424;2800498;7;*;aac
;comp;tRNA;2800506;2800581;4;*;gaa
;comp;tRNA;2800586;2800661;18;*;aaa
;comp;tRNA;2800680;2800754;4;*;caa
;comp;tRNA;2800759;2800843;91;*;tac
;comp;tRNA;2800935;2801011;7;*;gtc
;comp;tRNA;2801019;2801093;325;*;tgc
fin;;CDS;2801419;2801724;;;
deb;;CDS;3032538;3032729;109;*;
;comp;rRNA;3032839;3035753;237;*;2915
;comp;tRNA;3035991;3036066;64;*;gcc
;comp;rRNA;3036131;3036247;262;*;117
;comp;rRNA;3036510;3038031;774;*;1522
fin;comp;CDS;3038806;3040017;;;

cbei[modifier | modifier le wikicode]

cbei opérons[modifier | modifier le wikicode]

29.65%GC;29.7.19 Paris;16s 16 ;;;;;;;;
Clostridium beijerinckii strain NCIMB 14988;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
;6477551..6480031;;CDS;;496;496;;;827;
;6480528..6482044;;16s;;213;;;;;
;6482258..6485171;;23s;;108;;;;;
;6485280..6485394;;5s;;14;;;;;
;15..91;;atgi;;1;;;1;;
;93..168;;gca;;85;85;;;;85
;254..769;;CDS;;1940;;;;172;
;;;;;;;;;;
;2710..2937;;CDS;;119;119;;;76;119
;3057..3147;;tca;+;30;;30;;;
;3178..3268;;agc;2 tca;241;;*241;;;
;3510..3600;;tca;2 agc;18;;18;;;
;3619..3709;;agc;;125;125;;;;
;3835..4350;;CDS;;9470;;;;172;
;;;;;;;;;;
;13821..14726;;CDS;;187;187;;;302;
;14914..14988;;cgt;;34;34;;;;34
comp;15023..15913;;CDS;;109014;;;;297;
;;;;;;;;;;
;124928..125338;;CDS;;275;275;;;137;275
;125614..125702;;tta;+;20;;20;;;
;125723..125798;;atgf;4 tta;7;;7;;;
;125806..125882;;atgj;4 atgf;6;;6;;;
;125889..125977;;tta;2 atgj;22;;22;;;
;126000..126075;;atgf;;7;;7;;;
;126083..126159;;atgj;;6;;6;;;
;126166..126254;;tta;;21;;21;;;
;126276..126351;;atgf;;70;;70;;;
;126422..126510;;tta;;21;;21;;;
;126532..126607;;atgf;;664;664;;;;
;127272..129683;;CDS;;8954;;;;804;
;;;;;;;;;;
;138638..140143;;CDS;;307;307;;;502;
;140451..140525;;aac;+;234;;*234;;;
;140760..140834;;aac;3 aac;439;;*439;;;
;141274..141348;;aac;@6;299;299;;;;299
;141648..143039;;CDS;;1587;;;;464;
;;;;;;;;;;
comp;144627..145649;;CDS;;543;543;;;341;
;146193..147709;;16s;;140;;;;;
;147850..147925;;gca;;3;;;3;;
;147929..148005;;atc;;111;;;;;
;148117..151030;;23s;;70;;;;;
;151101..151217;;5s;;5;;;5;;
;151223..151298;;ttc;;4;;;;;
;151303..151377;;tgc;;167;167;;;;167
;151545..151841;;CDS;;25608;;;;99;
;;;;;;;;;;
;177450..178097;;CDS;;76;76;;;216;
;178174..178249;;acc;;65;65;;;;65
;178315..179508;;CDS;;134221;;;;398;
;;;;;;;;;;
;313730..316207;;CDS;;90;90;;;826;90
;316298..316382;;cta;;4;;4;;;
;316387..316461;;ggg;;120;120;;;;
comp;316582..316986;;CDS;;85487;;;;135;
;;;;;;;;;;
;402474..402953;;CDS;;125;125;;;160;125
;403079..403154;;cca;+;17;;17;;;
;403172..403245;;gga;2x;149;;*149;;;
;403395..403471;;aga;cca gga aga;6;;6;;;
;403478..403553;;cca;;16;;16;;;
;403570..403643;;gga;;35;;35;;;
;403679..403755;;aga;;5;;5;;;
;403761..403836;;cac;;3;;3;;;
;403840..403914;;caa;2x;7;;7;;;
;403922..403997;;aaa;caa aaa cta ;18;;18;;;
;404016..404100;;cta;ggc gga ;5;;5;;;
;404106..404180;;ggc;;25;;25;;;
;404206..404279;;gga;;5;;5;;;
;404285..404360;;aag;;57;;57;;;
;404418..404492;;caa;;7;;7;;;
;404500..404575;;aaa;;18;;18;;;
;404594..404678;;cta;;5;;5;;;
;404684..404758;;ggc;;25;;25;;;
;404784..404857;;gga;;46;;46;;;
;404904..404980;;cga;;325;325;;;;
<;405306..405467;;CDS;;8393;;;;54;
;;;;;;;;;;
;413861..415921;;CDS;;385;385;;;687;
;416307..417823;;16s;@5;132;;;;;
;417956..418032;;atc;;84;;;;;
;418117..421031;;23s;;71;;;;;
;421103..421177;;aac;;345;345;;;;345
;421523..422449;;CDS;;63814;;;;309;
;;;;;;;;;;
;486264..486668;;CDS;;159;159;;;135;159
;486828..486912;;tac;+;9;;9;;;
;486922..486997;;gta;3 tac;27;;27;;;
;487025..487099;;aca;2 gta;12;;12;;;
;487112..487196;;tac;2 aca;9;;9;;;
;487206..487281;;gta;;30;;30;;;
;487312..487386;;aca;;12;;12;;;
;487399..487483;;tac;;451;451;;;;
;487935..489110;;CDS;;50956;;;;392;
;;;;;;;;;;
;540067..540969;;CDS;;187;187;;;301;187
;541157..541231;;tgg;;208;208;;;;
;541440..541820;;CDS;;97;;;;127;
;;;;;;;;;;
comp;541918..542985;;CDS;;252;252;;;356;252
;543238..543312;;tgg;;354;354;;;;
;543667..544683;;CDS;;347735;;;;339;
;;;;;;;;;;
;892419..893339;;CDS;;560;560;;;307;
;893900..895416;;16s;;137;;;;;
;895554..895629;;gca;;118;;;;;
;895748..898661;;23s;;204;;;;;
;898866..898982;;5s;;552;552;;;;*552
;899535..900446;;CDS;;351;;;;304;
;;;;;;;;;;
;900798..902048;;CDS;;704;704;;;417;
;902753..904269;;16s;;339;;;;;
;904609..907522;;23s;;273;;;;;
;907796..907912;;5s;;69;69;;;;69
comp;907982..908449;;CDS;;43545;;;;156;
;;;;;;;;;;
;951995..952630;;CDS;;97;97;;;212;97
;952728..952813;;ctc;;396;396;;;;
;953210..954919;;CDS;;784414;;;;570;
;;;;;;;;;;
;1739334..1739933;;CDS;;380;380;;;200;380
;1740314..1740389;;cac;;3;;3;;;
;1740393..1740467;;cag;;5;;5;;;
;1740473..1740548;;aaa;;443;443;;;;
comp;1740992..1742350;;CDS;;151829;;;;453;
;;;;;;;;;;
;1894180..1895406;;CDS;;34;34;;;409;34
comp;1895441..1895527;;ttg;;574;574;;;;
;1896102..1896794;;CDS;;200701;;;;231;
;;;;;;;;;;
;2097496..2097915;;CDS;;722;722;;;140;
;2098638..2100154;;16s;;502;;;;;
;2100657..2103569;;23s;;205;;;;;
;2103775..2103891;;5s;;315;315;;;;315
;2104207..2104905;;CDS;;234313;;;;233;
;;;;;;;;;;
;2339219..2340322;;CDS;;662;662;;;368;
;2340985..2342501;;16s;;338;;;;;
;2342840..2345755;;23s;;140;;;;;
;2345896..2345970;;aac;;3;;;;;
;2345974..2346090;;5s;;429;429;;;;429
;2346520..2348088;;CDS;;3574;;;;523;
;;;;;;;;;;
;2351663..2352139;;CDS;;568;568;;;159;
;2352708..2354224;;16s;;338;;;;;
;2354563..2357477;;23s;;140;;;;;
;2357618..2357692;;aac;;3;;;;;
;2357696..2357812;;5s;;90;90;;;;90
;2357903..2358316;;CDS;;406783;;;;138;
;;;;;;;;;;
;2765100..2765525;;CDS;;625;625;;;142;
;2766151..2767667;;16s;;503;;;;;
;2768171..2771082;;23s;;202;;;;;
;2771285..2771401;;5s;;5;;;;;
;2771407..2771482;;ttc;;6;;;6;;
;2771489..2771565;;gac;;25;;;25;;
;2771591..2771665;;gaa;;448;448;;;;448
;2772114..2774864;;CDS;;781818;;;;917;
;;;;;;;;;;
;3556683..3557051;;CDS;;565;565;;;123;*565
;3557617..3557691;;gag;;925;925;;;;
comp;3558617..3559759;;CDS;;192275;;;;381;
;;;;;;;;;;
comp;3752035..3752652;;CDS;;245;245;;;206;245
comp;3752898..3752985;;agt;@1;711;711;;;;
comp;3753697..3755112;;CDS;;501326;;;;472;
;;;;;;;;;;
comp;4256439..4258403;;CDS;;267;267;;;655;267
comp;4258671..4258746;;aaa;;79;;79;;;
comp;4258826..4258901;;cac;;7;;7;;;
comp;4258909..4258985;;aga;;35;;35;;;
comp;4259021..4259094;;gga;;752;752;;;;
;4259847..4260392;;CDS;;619853;;;;182;
;;;;;;;;;;
comp;4880246..4880488;;CDS;;508;508;;;81;*508
comp;4880997..4881113;;5s;;274;;;;;
comp;4881388..4884300;;23s;;578;;;;;
comp;4884879..4886395;;16s;;703;703;;;;
comp;4887099..4888034;;CDS;;1272704;;;;312;
;;;;;;;;;;
comp;6160739..6161977;;CDS;;343;343;;;413;
;6162321..6162396;;cca;;242;242;;;;242
;6162639..6163283;;CDS;;2040;;;;215;
;;;;;;;;;;
;6165324..6165734;;CDS;;222;222;;;137;
comp;6165957..6166032;;ttc;;5;;;;;
comp;6166038..6166154;;5s;@2;188;188;;;;188
;6166343..6167074;;CDS;;8085;;;;244;
;;;;;;;;;;
comp;6175160..6175597;;CDS;;249;249;;;146;249
comp;6175847..6175922;;gca;;1;;;1;;
comp;6175924..6176000;;atgi;;44;;;;;
comp;6176045..6176161;;5s;;138;;;;;
comp;6176300..6179216;;23s;;339;;;;;
comp;6179556..6181072;;16s;;567;567;;;;
comp;6181640..6182446;;CDS;;223;;;;269;
;;;;;;;;;;
;6182670..6183419;;CDS;;190;190;;;250;190
comp;6183610..6183685;;aaa;+;5;;;;;
comp;6183691..6183807;;5s;2 aaa;159;159;;;;159
comp;6183967..6184914;;CDS;@3;294;294;;;316;294
comp;6185209..6185284;;aaa;;7;;;;;
comp;6185292..6185408;;5s;;138;;;;;
comp;6185547..6188463;;23s;;339;;;;;
comp;6188803..6190319;;16s;;771;771;;;;
comp;6191091..6192203;;CDS;;7306;;;;371;
;;;;;;;;;;
comp;6199510..6202059;;CDS;;661;661;;;850;
comp;6202721..6202837;;5s;@4;139;;;;;
comp;6202977..6205893;;23s;;339;;;;;
comp;6206233..6207749;;16s;;1102;;;;;
comp;6208852..6208968;;5s;;138;;;;;
comp;6209107..6212023;;23s;;339;;;;;
comp;6212363..6213879;;16s;;502;502;;;;*502
comp;6214382..6215329;;CDS;;90019;;;;316;
;;;;;;;;;;
comp;6305349..6306314;;CDS;;123;123;;;322;123
comp;6306438..6306527;;tcc;;281;281;;;;
comp;6306809..6307984;;CDS;;66527;;;;392;
;;;;;;;;;;
;6374512..6375684;;CDS;;125;125;;;391;125
comp;6375810..6375884;;agg;;303;303;;;;
comp;6376188..6378578;;CDS;;13398;;;;797;
;;;;;;;;;;
comp;6391977..6392753;;CDS;;114;114;;;259;114
comp;6392868..6392984;;5s;;134;;;;;
comp;6393119..6396033;;23s;;214;;;;;
comp;6396248..6397764;;16s;;1120;;;;;
comp;6398885..6399001;;5s;;139;;;;;
comp;6399141..6402055;;23s;;214;;;;;
comp;6402270..6403786;;16s;;748;748;;;;
comp;6404535..6405107;;CDS;;31702;;;;191;
;;;;;;;;;;
;6436810..6437790;;CDS;;192;192;;;327;
comp;6437983..6438059;;gac;+;6;;6;;;
comp;6438066..6438141;;gta;3x;14;;14;;;
comp;6438156..6438230;;gaa;gac gta ;29;;29;;;
comp;6438260..6438334;;aca;gaa aca – 1;10;;10;;;
comp;6438345..6438421;;gac;;6;;6;;;
comp;6438428..6438503;;gta;;16;;16;;;
comp;6438520..6438594;;gaa;;29;;29;;;
comp;6438624..6438698;;aca;;10;;10;;;
comp;6438709..6438785;;gac;;6;;6;;;
comp;6438792..6438867;;gta;;14;;14;;;
comp;6438882..6438956;;gaa;;162;162;;;;162
comp;6439119..6439685;;CDS;;37865;;;;189;

cbei cumuls[modifier | modifier le wikicode]

cbei cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;2;1;0;1;0;100;4
;16 23 5s 0;7;20;34;3;50;2;50;2;200;19
;16 atc gca;1;40;12;1;100;7;100;6;300;11
;16 23 5s a;4;60;2;0;150;7;150;5;400;20
;max a;4;80;2;0;200;9;200;7;500;6
;a doubles;1;100;0;0;250;5;250;3;600;3
;autres;6;120;0;0;300;6;300;5;700;2
;total aas;19;140;0;0;350;6;350;2;800;1
sans ;opérons;20;160;1;0;400;4;400;1;900;4
;1 aa;11;180;0;0;450;3;450;2;1000;1
;max a;19;200;0;0;500;2;500;0;1100;0
;a doubles;5;;3;0;;21;;4;;0
;total aas;74;;54;6;;72;;37;;71
total aas;;93;;;;;;;;;
remarques;;6;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;18;7;;350;;195;;328
;;;variance;17;9;;225;;111;;206

cbei blocs[modifier | modifier le wikicode]

cbei blocs;;;;
16s;213;503;339;
23s;108;202;138;
5s;14;5;44;
atgi;atgi;ttc;atgi;
;;;;
16s;339;502;578;
23s;273;205;274;
5s;;;;
;;;;
aaa;5;;;
5s;159;5s;139;134
cds;294;23s;339;214
aaa;7;16s;1102;1120
5s;138;5s;138;139
23s;339;23s;339;214
16s;;16s;;
;;;;
16s;338;338;16s;140
23s;140;140;gca;3
aac;3;3;atc;111
5s;aac;aac;23s;70
;;;5s;5
;;;ttc;
;;;;
16s;137;;16s;132
gca;118;;atc;84
23s;204;;23s;71
5s;;;aac;
;;;;
ttc;5;;;
5s;;;;

cbei distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;4
aac 3 -5 et 3 >1;att;;act;;aat;;agt;1;;att;;act;;aat;;agt;
aaa 2 +5 et 4 >1;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gca 2+16s, 2+5s;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
;ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;3;tgc;
les +5s sont;atc;;acc;1;aac;;agc;;;atc;;acc;;aac;3;agc;2
des 1-3aas;ctc;1;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;3;cgt;
;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;3;ggc;2
;tta;;tca;;taa;;tga;;;tta;4;tca;2;taa;;tga;
;ata;;aca;;aaa;;aga;;;ata;;aca;4;aaa;4;aga;3
;cta;;cca;1;caa;;cga;;;cta;3;cca;2;caa;2;cga;1
;gta;;gca;;gaa;;gga;;;gta;5;gca;;gaa;3;gga;5
;ttg;1;tcg;;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;
;atgj;;acg;;aag;;agg;1;;atgj;2;acg;;aag;1;agg;
;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;1;cgg;
;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;1
;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
;cbei;;11;;;;;11;;cbei;63;;;;;;63

cbei données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: cbei données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA contig;;tRNA tRNA;;tRNA tRNA;;CDS-CDS;;400-800;reste;Sup 800;Sup 800
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;frequence;effectif;;long;long;long
fxt;fct;cbei;fx;fc;cbei;fx40;fc40;cbei;x-;c-;c;x;c;x;c;aa;c;aa;c;aa;c;aa;cbei;fx;fc;fx;fc;fc
;0;0;0;19;0;0;19;-1;0;71;85;34;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;hors bloc;tRNA tRNA;suite;cbei;fx;fc;803;809;1002
;0;10;6;249;1;3;55;-2;0;0;119;120;390;548;5* 339;;1;atgi;30;tca;6;gac;400;950;3414;813;816;1006
;1;20;12;375;2;1;39;-3;0;0;125;252;565;;502;;**;gca;241;agc;14;gta;410;17;31;820;817;1014
;0;30;7;204;3;0;23;-4;2;83;187;443;709;;2* 338;;4;ttc;18;tca;29;gaa;420;12;32;823;818;1016
2;0;40;10;126;4;0;36;-5;1;0;275;34;727;;503;;**;tgc;**;agc;10;aca;430;6;26;829;820;1017
;0;50;10;119;5;0;17;-6;0;0;664;574;667;;578;;6;ttc;20;tta;6;gac;440;11;25;832;821;1017
;0;60;24;126;6;1;16;-7;0;8;307;505;573;;2* 214;;25;gac;7;atgf;16;gta;450;19;23;835;825;1021
;1;70;30;98;7;0;8;-8;1;72;299;752;282;;213;;**;gaa;6;atgj;29;gaa;460;13;26;837;827;1027
;1;80;25;95;8;0;15;-9;0;0;681;343;703;;23s 5s;;1;gca;22;tta;10;aca;470;11;17;846;835;1031
;2;90;19;100;9;0;23;-10;0;5;76;222;572;;70;;**;atgi;7;atgf;6;gac;480;6;21;847;837;1032
;1;100;33;101;10;1;17;-11;0;38;65;190;776;;204;;;;6;atgj;14;gta;490;9;15;873;842;1051
;0;110;34;103;11;3;48;-12;0;0;90;125;507;;273;;;;21;tta;**;gaa;500;10;18;873;851;1051
1;1;120;29;89;12;2;51;-13;0;4;125;192;753;;205;;;;70;atgf;;;510;6;16;891;855;1054
1;2;130;34;79;13;0;41;-14;0;21;325;;501;;202;;;;21;tta;;;520;2;17;895;864;1058
;1;140;38;85;14;0;47;-15;0;0;345;;5s CDS;;274;;;;**;atgf;;;530;5;18;905;869;1058
;0;150;32;102;15;1;43;-16;0;3;159;;552;69;138;;;;234;aac;;;540;7;20;911;872;1064
;1;160;47;86;16;2;29;-17;0;21;451;;315;188;138;;;;439;aac;;;550;5;13;952;873;1065
;1;170;33;85;17;0;25;-18;0;0;187;;429;114;139;;;;**;aac;;;560;12;15;963;877;1072
;0;180;30;78;18;0;38;-19;0;2;208;;90;;138;;;;4;cta;;;570;7;14;992;886;1078
1;2;190;33;68;19;2;23;-20;0;11;354;;508;;134;;;;**;ggg;;;580;4;16;1009;886;1107
1;0;200;24;79;20;2;30;-21;1;0;97;;159;;139;;;;17;cca;;;590;9;11;1040;891;1127
;1;210;38;63;21;2;32;-22;0;1;396;;661;;108;;;;149;gga;;;600;9;11;1102;896;1153
;0;220;24;75;22;0;25;-23;0;9;380;;5s 16s;;16s tRNA;;;;6;aga;;;610;2;12;1112;902;1176
1;0;230;28;60;23;0;18;-24;0;0;448;;1107;;140;gca;;;16;cca;;;620;4;15;1173;909;1178
;0;240;25;61;24;0;21;-25;1;1;565;;1125;;132;atc;;;35;gga;;;630;3;5;1221;909;1201
;3;250;35;47;25;0;23;-26;1;10;248;;;;137;gca;;;5;aga;;;640;4;10;1289;917;1205
1;0;260;23;60;26;1;22;-27;0;0;13;;;;tRNA 23s;;;;3;cac;;;650;2;8;1372;917;1207
;1;270;18;61;27;0;18;-28;0;4;267;;;;111;atc;;;7;caa;;;660;3;5;1429;920;1226
;1;280;21;62;28;1;11;-29;0;5;242;;;;84;atc;;;18;aaa;;;670;3;10;1431;924;1239
;1;290;18;48;29;2;16;-30;0;0;249;;;;118;gca;;;5;cta;;;680;4;3;1499;933;1302
;2;300;26;53;30;1;18;-31;0;0;294;;;;5s tRNA;;;;25;ggc;;;690;1;8;1555;936;1326
;2;310;21;38;31;0;18;-32;0;0;135;;;;3* 5;ttc;;;5;gga;;;700;6;8;;955;1348
;0;320;24;38;32;1;13;-33;0;0;281;;;;44;atgi;;;57;aag;;;710;3;4;;958;1391
;1;330;23;46;33;1;11;-34;0;0;303;;;;5;aaa;;;7;caa;;;720;2;6;;961;1469
;0;340;17;36;34;2;12;-35;0;4;162;;;;7;aaa;;;18;aaa;;;730;3;3;;964;1482
1;1;350;18;40;35;0;13;-36;0;0;;;;;14;atgi;;;5;cta;;;740;5;7;;979;1545
;1;360;15;28;36;1;9;-37;0;1;;;;;23s tRNA;;;;25;ggc;;;750;2;3;;986;1881
;0;370;15;35;37;0;8;-38;1;4;;CDS-CDS;inf 50;;2* 140;aac;;;46;gga;;;760;1;5;;988;2121
;1;380;18;35;38;2;11;-39;0;0;;intercalaire;;;71;aac;;;**;cga;;;770;1;6;;991;
;0;390;20;37;39;2;15;-40;0;1;;c-;x-;;tRNA 5s;;;;9;tac;;;780;1;3;;994;
;1;400;13;25;40;1;16;-41;0;1;;-110;-60;;2* 3;aac;;;27;gta;;;790;0;8;;995;
4;5;reste;262;596;reste;1177;3037;-42;0;0;;-64;;;tRNA tRNA;intra;;;12;aca;;;800;1;3;;;
13;35;total;1212;4010;total;1212;4010;-43;0;1;;-64;;;3;gca atc;;;9;tac;;;reste;31;79;;;
9;30;diagr;950;3395;diagr;35;954;-44;0;2;;-62;;;;;;;30;gta;;;;;;;;
0;1; t30;25;828;;;;-45;0;0;;;;;;;;;12;aca;;;;;;;;
;;;;;;;;-46;1;0;;total;intercalaires;;;;;;**;tac;;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;0;1;;;1,199,672;;;;;;3;cac;;;;;;;;
;;>0;<0;zéro;total;*;;-48;0;0;;ADN long;6,485,394;;;;;;5;cag;;;;;;;;
;x;1212;10;0;1222;;;-49;0;1;;%;18.5;;;;;;**;aaa;;;;;;;;
;c;3991;390;19;4400;;;-50;0;1;;;;;;;;;79;aaa;;;;;;;;
;;;;;5622;192;;reste;1;4;;non RNA;14;;;;;;7;cac;;;;;;;;
;;;;;;5814;;total;10;390;;;;;;;;;35;aga;;;;;;;;
;;;;;;;;;;;;;;;;;;;**;gga;;;;;;;;

cbei autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: cbei autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;cbei;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
;;tRNA;15;91;1;*;atgi
;;tRNA;93;168;85;*;gca
fin;;CDS;254;769;;;
deb;;CDS;2710;2937;119;*;
;;tRNA;3057;3147;30;*;tca
;;tRNA;3178;3268;241;*;agc
;;tRNA;3510;3600;18;*;tca
;;tRNA;3619;3709;125;*;agc
fin;;CDS;3835;4350;;;
deb;;CDS;13821;14726;187;*;
;;tRNA;14914;14988;34;*;cgt
fin;comp;CDS;15023;15913;;0;
deb;;CDS;124928;125338;275;*;
;;tRNA;125614;125702;20;*;tta
;;tRNA;125723;125798;7;*;atgf
;;tRNA;125806;125882;6;*;atgj
;;tRNA;125889;125977;22;*;tta
;;tRNA;126000;126075;7;*;atgf
;;tRNA;126083;126159;6;*;atgj
;;tRNA;126166;126254;21;*;tta
;;tRNA;126276;126351;70;*;atgf
;;tRNA;126422;126510;21;*;tta
;;tRNA;126532;126607;664;*;atgf
fin;;CDS;127272;129683;;;
deb;;CDS;138638;140143;307;*;
;;tRNA;140451;140525;234;*;aac
;;tRNA;140760;140834;439;*;aac
;;tRNA;141274;141348;299;*;aac
fin;;CDS;141648;143039;;;
deb;comp;CDS;144627;145649;548;*;
;;rRNA;146198;147709;140;*;16s
;;tRNA;147850;147925;3;*;gca
;;tRNA;147929;148005;111;*;atc
;;rRNA;148117;151030;70;*;23s
;;rRNA;151101;151217;5;*;5s
;;tRNA;151223;151298;4;*;ttc
;;tRNA;151303;151377;681;*;tgc
fin;;CDS;152059;153456;;0;
deb;;CDS;177450;178097;76;*;
;;tRNA;178174;178249;65;*;acc
fin;;CDS;178315;179508;;;
deb;;CDS;313730;316207;90;*;
;;tRNA;316298;316382;4;*;cta
;;tRNA;316387;316461;120;*;ggg
fin;comp;CDS;316582;316986;;0;
deb;;CDS;402474;402953;125;*;
;;tRNA;403079;403154;17;*;cca
;;tRNA;403172;403245;149;*;gga
;;tRNA;403395;403471;6;*;aga
;;tRNA;403478;403553;16;*;cca
;;tRNA;403570;403643;35;*;gga
;;tRNA;403679;403755;5;*;aga
;;tRNA;403761;403836;3;*;cac
;;tRNA;403840;403914;7;*;caa
;;tRNA;403922;403997;18;*;aaa
;;tRNA;404016;404100;5;*;cta
;;tRNA;404106;404180;25;*;ggc
;;tRNA;404206;404279;5;*;gga
;;tRNA;404285;404360;57;*;aag
;;tRNA;404418;404492;7;*;caa
;;tRNA;404500;404575;18;*;aaa
;;tRNA;404594;404678;5;*;cta
;;tRNA;404684;404758;25;*;ggc
;;tRNA;404784;404857;46;*;gga
;;tRNA;404904;404980;325;*;cga
fin;;CDS;405306;405467;;;
deb;;CDS;413861;415921;390;*;atc
;;rRNA;416312;417823;132;*;16s
;;tRNA;417956;418032;84;*;
;;rRNA;418117;421031;71;*;23s
;;tRNA;421103;421177;345;*;aac
fin;;CDS;421523;422449;;;
deb;;CDS;486264;486668;159;*;
;;tRNA;486828;486912;9;*;tac
;;tRNA;486922;486997;27;*;gta
;;tRNA;487025;487099;12;*;aca
;;tRNA;487112;487196;9;*;tac
;;tRNA;487206;487281;30;*;gta
;;tRNA;487312;487386;12;*;aca
;;tRNA;487399;487483;451;*;tac
fin;;CDS;487935;489110;;;
deb;;CDS;540067;540969;187;*;
;;tRNA;541157;541231;208;*;tgg
fin;;CDS;541440;541820;;0;
deb;comp;CDS;541918;542985;252;*;
;;tRNA;543238;543312;354;*;
fin;;CDS;543667;544683;;;
deb;;CDS;772270;774093;262;*;
;;tmRNA;774356;774713;871;*;
fin;;CDS;775585;776133;;;
deb;;CDS;892419;893339;565;*;
;;rRNA;893905;895416;137;*;16s
;;tRNA;895554;895629;118;*;gca
;;rRNA;895748;898661;204;*;23s
;;rRNA;898866;898982;552;*;5s
fin;;CDS;899535;900446;;;
deb;;CDS;900798;902048;709;*;
;;rRNA;902758;904269;339;*;16s
;;rRNA;904609;907522;273;*;23s
;;rRNA;907796;907912;69;*;5s
fin;comp;CDS;907982;908449;;0;
deb;;CDS;951995;952630;97;*;
;;tRNA;952728;952813;396;*;ctc
fin;;CDS;953210;954919;;;
deb;;CDS;1017389;1017694;70;*;
;;ncRNA;1017765;1018113;758;*;
fin;;CDS;1018872;1020263;;;
deb;;CDS;1646835;1647233;56;*;
;;ncRNA;1647290;1647483;182;*;
fin;comp;CDS;1647666;1647878;;0;
deb;;CDS;1739334;1739933;380;*;
;;tRNA;1740314;1740389;3;*;cac
;;tRNA;1740393;1740467;5;*;cag
;;tRNA;1740473;1740548;443;*;aaa
fin;comp;CDS;1740992;1742350;;0;
deb;;CDS;1846157;1848058;-183;*;
;;gene;1847876;1848058;588;*;
fin;;CDS;1848647;1849633;;;
deb;;CDS;1894180;1895406;34;*;
;comp;tRNA;1895441;1895527;574;*;ttg
fin;;CDS;1896102;1896794;;;
deb;;CDS;2097496;2097915;727;*;
;;rRNA;2098643;2100154;502;*;16s
;;rRNA;2100657;2103569;205;*;23s
;;rRNA;2103775;2103891;315;*;5s
fin;;CDS;2104207;2104905;;;
deb;;CDS;2296804;2297472;104;*;
;comp;ncRNA;2297577;2297769;380;*;
fin;;CDS;2298150;2299064;;;
deb;;CDS;2305297;2306502;275;*;
;comp;ncRNA;2306778;2307043;230;*;
fin;;CDS;2307274;2308908;;0;
deb;;CDS;2339219;2340322;667;*;
;;rRNA;2340990;2342501;338;*;16s
;;rRNA;2342840;2345755;140;*;23s
;;tRNA;2345896;2345970;3;*;aac
;;rRNA;2345974;2346090;429;*;5s
fin;;CDS;2346520;2348088;;;
deb;;CDS;2351663;2352139;573;*;
;;rRNA;2352713;2354224;338;*;16s
;;rRNA;2354563;2357477;140;*;23s
;;tRNA;2357618;2357692;3;*;aac
;;rRNA;2357696;2357812;90;*;5s
fin;;CDS;2357903;2358316;;0;
deb;;CDS;2765706;2765873;282;*;
;;rRNA;2766156;2767667;503;*;16s
;;rRNA;2768171;2771082;202;*;23s
;;rRNA;2771285;2771401;5;*;5s
;;tRNA;2771407;2771482;6;*;ttc
;;tRNA;2771489;2771565;25;*;gac
;;tRNA;2771591;2771665;448;*;gaa
fin;;CDS;2772114;2774864;;;
deb;;CDS;3556683;3557051;565;*;
;;tRNA;3557617;3557691;505;*;gag
fin;comp;CDS;3558197;3558508;;;
deb;comp;CDS;3752035;3752652;248;*;
;comp;tRNA;3752901;3752985;13;*;agt
fin;comp;CDS;3752999;3753169;;0;
deb;comp;CDS;4256439;4258403;267;*;
;comp;tRNA;4258671;4258746;79;*;aaa
;comp;tRNA;4258826;4258901;7;*;cac
;comp;tRNA;4258909;4258985;35;*;aga
;comp;tRNA;4259021;4259094;752;*;gga
fin;;CDS;4259847;4260392;;;
deb;comp;CDS;4880246;4880488;508;*;
;comp;rRNA;4880997;4881113;274;*;5s
;comp;rRNA;4881388;4884300;578;*;23s
;comp;rRNA;4884879;4886395;703;*;16s
fin;comp;CDS;4887099;4888034;;0;
deb;comp;CDS;6160739;6161977;343;*;
;;tRNA;6162321;6162396;242;*;cca
fin;;CDS;6162639;6163283;;0;
deb;;CDS;6165324;6165734;222;*;
;comp;tRNA;6165957;6166032;5;*;ttc
;comp;rRNA;6166038;6166154;188;*;5s
fin;;CDS;6166343;6167074;;0;
deb;comp;CDS;6175160;6175597;249;*;
;comp;tRNA;6175847;6175922;1;*;gca
;comp;tRNA;6175924;6176000;44;*;atgi
;comp;rRNA;6176045;6176161;138;*;5s
;comp;rRNA;6176300;6179216;339;*;23s
;comp;rRNA;6179556;6181067;572;*;16s
fin;comp;CDS;6181640;6182446;;0;
deb;;CDS;6182670;6183419;190;*;
;comp;tRNA;6183610;6183685;5;*;aaa
;comp;rRNA;6183691;6183807;159;*;5s
deb;comp;CDS;6183967;6184914;294;*;
;comp;tRNA;6185209;6185284;7;*;aaa
;comp;rRNA;6185292;6185408;138;*;5s
;comp;rRNA;6185547;6188463;339;*;23s
;comp;rRNA;6188803;6190314;776;*;16s
fin;comp;CDS;6191091;6192203;;;
deb;comp;CDS;6199510;6202059;661;*;
;comp;rRNA;6202721;6202837;139;*;5s
;comp;rRNA;6202977;6205893;339;*;23s
;comp;rRNA;6206233;6207744;1107;*;16s
;comp;rRNA;6208852;6208968;138;*;5s
;comp;rRNA;6209107;6212023;339;*;23s
;comp;rRNA;6212363;6213874;507;*;16s
fin;comp;CDS;6214382;6215329;;;
deb;;CDS;6256716;6257600;154;*;
;comp;ncRNA;6257755;6258021;316;*;
fin;comp;CDS;6258338;6258889;;;
deb;comp;CDS;6305349;6306302;135;*;
;comp;tRNA;6306438;6306527;281;*;tcc
fin;comp;CDS;6306809;6307984;;;
deb;;CDS;6374512;6375684;125;*;
;comp;tRNA;6375810;6375884;303;*;agg
fin;comp;CDS;6376188;6378578;;0;
deb;comp;CDS;6391977;6392753;114;*;
;comp;rRNA;6392868;6392984;134;*;5s
;comp;rRNA;6393119;6396033;214;*;23s
;comp;rRNA;6396248;6397759;1125;*;16s
;comp;rRNA;6398885;6399001;139;*;5s
;comp;rRNA;6399141;6402055;214;*;23s
;comp;rRNA;6402270;6403781;753;*;16s
fin;comp;CDS;6404535;6405107;;;
deb;;CDS;6436810;6437790;192;*;
;comp;tRNA;6437983;6438059;6;*;gac
;comp;tRNA;6438066;6438141;14;*;gta
;comp;tRNA;6438156;6438230;29;*;gaa
;comp;tRNA;6438260;6438334;10;*;aca
;comp;tRNA;6438345;6438421;6;*;gac
;comp;tRNA;6438428;6438503;16;*;gta
;comp;tRNA;6438520;6438594;29;*;gaa
;comp;tRNA;6438624;6438698;10;*;aca
;comp;tRNA;6438709;6438785;6;*;gac
;comp;tRNA;6438792;6438867;14;*;gta
;comp;tRNA;6438882;6438956;162;*;gaa
fin;comp;CDS;6439119;6439685;;0;
deb;;CDS;6477551;6480031;501;*;
;;rRNA;6480533;6482044;213;*;16s
;;rRNA;6482258;6485171;108;*;23s
;;rRNA;6485280;6485394;14;*;5s

cbei intercalaires entre cds[modifier | modifier le wikicode]

cbei intercalaires positifs S+[modifier | modifier le wikicode]

cbei Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;20.2.22;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
mba;min10;705;1651;2356;154;-330;-221;109;-512;-477;-223;;;
cbei;min10;950;3395;4345;402;-509;-375;134;-649;-648;-290;;;
pmq;min10;1613;4170;5783;455;-834;-652;182;-867;-826;-61;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
45;214;0.21;1255;2688;1;8;18;114;51;428;-74;;;
26;244;0.11;1212;4400;0;4;8;89;35;954;272;;;
32;217;0.15;1926;5302;3;5;22;142;68;1155;-203;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
cbei;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;&-7;-5;-3;1;R2;flex c+;comment.
1 à 400;32;-258;570;-3.2;723;269;max160;&-46;339;-824;83;780;246;min50
31 à 400;12.7;-134;357;3.5;790;352;*;&-1.4;16;-123;40;937;391;1 partie
droite;-a;cste;-;R2;note;R2’;;&-a;cste;-;R2;note;R2’;
1 à 400;5;26;-;4;poly;708;tF;&123;50;-;566;poly;214;SF
31 à 400;36;30;-;345;poly;445;tF *;&75;37;-;929;dte;8;Sf
* diagramme en effectifs de 1 à 600;;;;;;;;;;;;;;
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30, t30.
  • Corrélation et fréquences faibles
;400;200;250;;;;;;;;;;;;;;;
;coefficient de corrélation fx fc;;;;;;;corrélation;;;;;;;;;;
41-n;0.402;-0.509;-0.375;;;;;0.272;;;;;;;;complément à 800;;
1-n;-0.290;-0.649;-0.648;;;;;;;;;20.2.22;;;;effectifs;;
cbei;fx;fc;;cbei;fx%;fc%;;fx40;fc40;;x;cbei;Sx-;Sc-;;cbei;fx;fc
0;0;19;;0;0;6;0;0;19;>0;1212;-1;;71;;410;17;31
10;6;249;;10;6;73;1;3;55;<0;10;-2;;0;;420;12;32
20;12;375;;20;13;110;2;1;39;zéro;0;-3;;0;;430;6;26
30;7;204;;30;7;60;3;0;23;total;1222;-4;2;83;;440;11;25
40;10;126;;40;11;37;4;0;36;;c;-5;1;0;;450;19;23
50;10;119;;50;11;35;5;0;17;>0;3991;-6;;0;;460;13;26
60;24;126;;60;25;37;6;1;16;<0;390;-7;;8;;470;11;17
70;30;98;;70;32;29;7;0;8;zéro;19;-8;1;72;;480;6;21
80;25;95;;80;26;28;8;0;15;total;4400;-9;;0;;490;9;15
90;19;100;;90;20;29;9;0;23;;;-10;;5;;500;10;18
100;33;101;;100;35;30;10;1;17;total;5622;-11;;38;;510;6;16
110;34;103;;110;36;30;11;3;48;;;-12;;0;;520;2;17
120;29;89;;120;31;26;12;2;51;;;-13;;4;;530;5;18
130;34;79;;130;36;23;13;0;41;;5203;-14;;21;;540;7;20
140;38;85;;140;40;25;14;0;47;;;-15;;0;;550;5;13
150;32;102;;150;34;30;15;1;43;;;-16;;3;;560;12;15
160;47;86;;160;49;25;16;2;29;;;-17;;21;;570;7;14
170;33;85;;170;35;25;17;0;25;;;-18;;0;;580;4;16
180;30;78;;180;32;23;18;0;38;;;-19;;2;;590;9;11
190;33;68;;190;35;20;19;2;23;;;-20;;11;;600;9;11
200;24;79;;200;25;23;20;2;30;;;-21;1;0;;610;2;12
210;38;63;;210;40;19;21;2;32;;;-22;;1;;620;4;15
220;24;75;;220;25;22;22;0;25;;;-23;;9;;630;3;5
230;28;60;;230;29;18;23;0;18;;;-24;;0;;640;4;10
240;25;61;;240;26;18;24;0;21;;;-25;1;1;;650;2;8
250;35;47;;250;37;14;25;0;23;;;-26;1;10;;660;3;5
260;23;60;;260;24;18;26;1;22;;;-27;;0;;670;3;10
270;18;61;;270;19;18;27;0;18;;;-28;;4;;680;4;3
280;21;62;;280;22;18;28;1;11;;;-29;;5;;690;1;8
290;18;48;;290;19;14;29;2;16;;;-30;;0;;700;6;8
300;26;53;;300;27;16;30;1;18;;;-31;;0;;710;3;4
310;21;38;;310;22;11;31;0;18;;;-32;;0;;720;2;6
320;24;38;;320;25;11;32;1;13;;;-33;;0;;730;3;3
330;23;46;;330;24;14;33;1;11;;;-34;;0;;740;5;7
340;17;36;;340;18;11;34;2;12;;;-35;;4;;750;2;3
350;18;40;;350;19;12;35;0;13;;;-36;;0;;760;1;5
360;15;28;;360;16;8;36;1;9;;;-37;;1;;770;1;6
370;15;35;;370;16;10;37;0;8;;;-38;1;4;;780;1;3
380;18;35;;380;19;10;38;2;11;;;-39;;0;;790;0;8
390;20;37;;390;21;11;39;2;15;;;-40;;1;;800;1;3
400;13;25;;400;14;7;40;1;16;;;-41;;1;;reste;31;79
reste;262;596;;;;;reste;1177;3037;;;-42;;0;;total;231;517
total;1212;4010;;t30;26;244;total;1212;4010;;;-43;;1;;;;
diagr;950;3395;;;;;diagr;35;954;;;-44;;2;;;;
 - t30;925;2567;;;;;;;;;;-45;;0;;;;
;;;;;;;;;;;;-46;1;0;;;;
;;;;;;;;;;;;-47;;1;;;;
;;;;;;;;;;;;-48;;0;;;;
;;;;;;;;;;;;-49;;1;;;;
;;;;;;;;;;;;-50;;1;;;;
;;;;;;;;;;;;reste;1;4;;;;
;;;;;;;;;;;;total;10;390;;;;

cbei intercalaires négatifs S-[modifier | modifier le wikicode]

cbei;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;;
comp’;;;;3;1;;;1;;;;;;;;;;;;;1;;;;1;1;;;;;;;;;;;;1;;;;;;;;1;;;;;1;11
continu;71;0;0;82;0;0;8;72;0;5;38;0;4;21;0;3;21;0;2;11;0;1;9;0;1;10;0;4;5;0;0;0;0;0;4;0;1;4;0;1;1;0;1;2;0;0;1;0;1;1;4;389
  • 14.8.21
14.8.21 paris;cbei;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;-51;total
;Sx-;0;0;0;3;1;0;0;1;0;0;0;0;0;0;0;0;0;0;0;0;1;0;0;0;1;1;0;0;0;0;0;0;0;0;0;0;0;1;0;0;0;0;0;0;0;1;0;0;0;0;1;11
;Sc-;71;0;0;82;0;0;8;72;0;5;38;0;4;21;0;3;21;0;2;11;0;1;9;0;1;10;0;4;5;0;0;0;0;0;4;0;1;4;0;1;1;0;1;2;0;0;1;0;1;1;4;389

cbei autres intercalaires[modifier | modifier le wikicode]

cbei;autres intercalaires;;adresses1;;;cbei;autres intercalaires;;adresses2;;;cbei;autres intercalaires;;adresses3;;
;&tRNA;15;1;;;deb;°CDS;540067;187;;;deb;°CDS;4256439;267;comp;
;&tRNA;93;85;;;;&tRNA;541157;208;;;;&tRNA;4258671;79;comp;
fin;°CDS;254;;;;fin;°CDS;541440;;;;;&tRNA;4258826;7;comp;
deb;°CDS;2710;119;;;deb;°CDS;541918;252;comp;;;&tRNA;4258909;35;comp;
;&tRNA;3057;30;;;;&tRNA;543238;354;;;;&tRNA;4259021;752;comp;
;&tRNA;3178;241;;;fin;°CDS;543667;;;;fin;°CDS;4259847;;;
;&tRNA;3510;18;;;deb;°CDS;772270;262;;;deb;°CDS;4880246;508;comp;
;&tRNA;3619;125;;;;tmRNA;774356;871;;;;$rRNA;4880997;274;comp;
fin;°CDS;3835;;;;fin;°CDS;775585;;;;;$rRNA;4881388;578;comp;
deb;°CDS;13821;187;;;deb;°CDS;892419;565;;;;$rRNA;4884879;703;comp;
;&tRNA;14914;34;;;;$rRNA;893905;137;;;fin;°CDS;4887099;;comp;
fin;°CDS;15023;;comp;;;&tRNA;895554;118;;;deb;°CDS;6160739;343;comp;
deb;°CDS;124928;275;;;;$rRNA;895748;204;;;;&tRNA;6162321;242;;
;&tRNA;125614;20;;;;$rRNA;898866;552;;;fin;°CDS;6162639;;;
;&tRNA;125723;7;;;fin;°CDS;899535;;;;deb;°CDS;6165324;222;;
;&tRNA;125806;6;;;deb;°CDS;900798;709;;;;&tRNA;6165957;5;comp;
;&tRNA;125889;22;;;;$rRNA;902758;339;;;;$rRNA;6166038;188;comp;
;&tRNA;126000;7;;;;$rRNA;904609;273;;;fin;°CDS;6166343;;;
;&tRNA;126083;6;;;;$rRNA;907796;69;;;deb;°CDS;6175160;249;comp;
;&tRNA;126166;21;;;fin;°CDS;907982;;comp;;;&tRNA;6175847;1;comp;
;&tRNA;126276;70;;;deb;°CDS;951995;97;;;;&tRNA;6175924;44;comp;
;&tRNA;126422;21;;;;&tRNA;952728;396;;;;$rRNA;6176045;138;comp;
;&tRNA;126532;664;;;fin;°CDS;953210;;;;;$rRNA;6176300;339;comp;
fin;°CDS;127272;;;;deb;°CDS;1017389;70;;;;$rRNA;6179556;572;comp;
deb;°CDS;138638;307;;;;ncRNA;1017765;758;;;fin;°CDS;6181640;;comp;
;&tRNA;140451;234;;;fin;°CDS;1018872;;;;deb;°CDS;6182670;190;;
;&tRNA;140760;439;;;deb;°CDS;1646835;56;;;;&tRNA;6183610;5;comp;
;&tRNA;141274;299;;;;ncRNA;1647290;182;;;;$rRNA;6183691;159;comp;
fin;°CDS;141648;;;;fin;°CDS;1647666;;comp;;deb;°CDS;6183967;294;comp;
deb;°CDS;144627;548;;;deb;°CDS;1739334;380;;;;&tRNA;6185209;7;comp;
;$rRNA;146198;140;;;;&tRNA;1740314;3;;;;$rRNA;6185292;138;comp;
;&tRNA;147850;3;;;;&tRNA;1740393;5;;;;$rRNA;6185547;339;comp;
;&tRNA;147929;111;;;;&tRNA;1740473;443;;;;$rRNA;6188803;776;comp;
;$rRNA;148117;70;;;fin;°CDS;1740992;;comp;;fin;°CDS;6191091;;comp;
;$rRNA;151101;5;;;deb;°CDS;1846157;-183;;;deb;°CDS;6199510;661;comp;
;&tRNA;151223;4;;;;gene;1847876;588;;;;$rRNA;6202721;139;comp;
;&tRNA;151303;681;;;fin;°CDS;1848647;;;;;$rRNA;6202977;339;comp;
fin;°CDS;152059;;;;deb;°CDS;1894180;34;;;;$rRNA;6206233;1107;comp;
deb;°CDS;177450;76;;;;&tRNA;1895441;574;comp;;;$rRNA;6208852;138;comp;
;&tRNA;178174;65;;;fin;°CDS;1896102;;;;;$rRNA;6209107;339;comp;
fin;°CDS;178315;;;;deb;°CDS;2097496;727;;;;$rRNA;6212363;507;comp;
deb;°CDS;313730;90;;;;$rRNA;2098643;502;;;fin;°CDS;6214382;;comp;
;&tRNA;316298;4;;;;$rRNA;2100657;205;;;deb;°CDS;6256716;154;;
;&tRNA;316387;120;;;;$rRNA;2103775;315;;;;ncRNA;6257755;316;comp;
fin;°CDS;316582;;comp;;fin;°CDS;2104207;;;;fin;°CDS;6258338;;comp;
deb;°CDS;402474;125;;;deb;°CDS;2296804;104;;;deb;°CDS;6305349;135;comp;
;&tRNA;403079;17;;;;ncRNA;2297577;380;comp;;;&tRNA;6306438;281;comp;
;&tRNA;403172;149;;;fin;°CDS;2298150;;;;fin;°CDS;6306809;;comp;
;&tRNA;403395;6;;;deb;°CDS;2305297;275;;;deb;°CDS;6374512;125;;
;&tRNA;403478;16;;;;ncRNA;2306778;230;comp;;;&tRNA;6375810;303;comp;
;&tRNA;403570;35;;;fin;°CDS;2307274;;;;fin;°CDS;6376188;;comp;
;&tRNA;403679;5;;;deb;°CDS;2339219;667;;;deb;°CDS;6391977;114;comp;
;&tRNA;403761;3;;;;$rRNA;2340990;338;;;;$rRNA;6392868;134;comp;
;&tRNA;403840;7;;;;$rRNA;2342840;140;;;;$rRNA;6393119;214;comp;
;&tRNA;403922;18;;;;&tRNA;2345896;3;;;;$rRNA;6396248;1125;comp;
;&tRNA;404016;5;;;;$rRNA;2345974;429;;;;$rRNA;6398885;139;comp;
;&tRNA;404106;25;;;fin;°CDS;2346520;;;;;$rRNA;6399141;214;comp;
;&tRNA;404206;5;;;deb;°CDS;2351663;573;;;;$rRNA;6402270;753;comp;
;&tRNA;404285;57;;;;$rRNA;2352713;338;;;fin;°CDS;6404535;;comp;
;&tRNA;404418;7;;;;$rRNA;2354563;140;;;deb;°CDS;6436810;192;;
;&tRNA;404500;18;;;;&tRNA;2357618;3;;;;&tRNA;6437983;6;comp;
;&tRNA;404594;5;;;;$rRNA;2357696;90;;;;&tRNA;6438066;14;comp;
;&tRNA;404684;25;;;fin;°CDS;2357903;;;;;&tRNA;6438156;29;comp;
;&tRNA;404784;46;;;deb;°CDS;2765706;282;;;;&tRNA;6438260;10;comp;
;&tRNA;404904;325;;;;$rRNA;2766156;503;;;;&tRNA;6438345;6;comp;
fin;°CDS;405306;;;;;$rRNA;2768171;202;;;;&tRNA;6438428;16;comp;
deb;°CDS;413861;390;;;;$rRNA;2771285;5;;;;&tRNA;6438520;29;comp;
;$rRNA;416312;132;;;;&tRNA;2771407;6;;;;&tRNA;6438624;10;comp;
;&tRNA;417956;84;;;;&tRNA;2771489;25;;;;&tRNA;6438709;6;comp;
;$rRNA;418117;71;;;;&tRNA;2771591;448;;;;&tRNA;6438792;14;comp;
;&tRNA;421103;345;;;fin;°CDS;2772114;;;;;&tRNA;6438882;162;comp;
fin;°CDS;421523;;;;deb;°CDS;3556683;565;;;fin;°CDS;6439119;;comp;
deb;°CDS;486264;159;;;;&tRNA;3557617;505;;;deb;°CDS;6477551;501;;erreur à corriger
;&tRNA;486828;9;;;fin;°CDS;3558197;;comp;;;$rRNA;6480533;213;;
;&tRNA;486922;27;;;deb;°CDS;3752035;248;comp;;;$rRNA;6482258;108;;
;&tRNA;487025;12;;;;&tRNA;3752901;13;comp;;;$rRNA;6485280;14;;
;&tRNA;487112;9;;;fin;°CDS;3752999;;comp;;;;;;;
;&tRNA;487206;30;;;;;;;;;;;;;;
;&tRNA;487312;12;;;;;;;;;;;;;;
;&tRNA;487399;451;;;;;;;;;;;;;;
fin;°CDS;487935;;;;;;;;;;;;;;;

cbei intercalaires tRNA-cds[modifier | modifier le wikicode]

cbei;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;85;;76;13;;
;119;;125;;90;65;deb;
;187;comp’;34;;97;85;<201;9
;275;;664;;119;125;total;17
;307;;299;;125;162;taux;53%
;;;681;;135;208;;
;76;;65;;159;242;fin;
;90;comp’;120;;187;281;<201;5
;125;;325;;187;299;total;18
;;;345;;248;303;taux;28%
;159;;451;;249;325;;
;187;;208;;267;345;total;
comp’;252;;354;;275;354;<201;14
;97;;396;;294;396;total;35
;380;comp’;443;;307;448;taux;40%
comp’;34;comp’;574;;380;451;;
;;;448;;565;664;;
;565;comp’;505;;-;681;comp’;cumuls
;248;;13;;34;120;deb;4
;267;comp’;752;;125;443;;7
comp’;343;;242;;190;505;fin;1
comp’;222;;;;192;574;;5
;249;;;;222;752;total;
comp’;190;;;;252;-;<201;5
;294;;;;343;-;total;12
;135;;281;;;;taux;42%
comp’;125;;303;;;;;
comp’;192;;162;;;;;
;;;;;;;;
;;deb;fin;total;;;;
;<201;13;6;19;;;;
;total;24;23;47;;;;
;taux;54%;26%;40%;;;;

afn[modifier | modifier le wikicode]

afn opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Acid_ferm_DSM_20731/;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_013740.1;afn;;;;
56%GC;30.6.19 Paris;16s  6;60;doubles;intercalaires
;Acidaminococcus fermentans DSM 20731;;;;
;24678..26242;;16s;@1;359
;26602..29507;;23s;;228
;29736..29852;;5s;;
;;;;;
;36819..36894;;acg;;
;;;;;
;57713..59277;;16s;;359
;59637..62543;;23s;;228
;62772..62888;;5s;;
;;;;;
;169459..169534;;gcc;;
;;;;;
;249791..249867;;agg;;
;;;;;
comp;274627..274703;;cgt;;
;;;;;
;311123..311198;;aca;;22
;311221..311305;;tac;;5
;311311..311386;;atg;;3
;311390..311465;;acc;;6
;311472..311548;;atgf;;
;;;;;
;380482..382046;;16s;;251
;382298..385204;;23s;;229
;385434..385550;;5s;;
;;;;;
;461553..461627;;aac;;3
;461631..461705;;gaa;;8
;461714..461789;;gta;;50
;461840..461916;;cca;;11
;461928..462001;;gga;;8
;462010..462086;;aga;;
;;;;;
;526984..527070;;ctg;+;30
;527101..527186;;ctc;2 ctg;52
;527239..527325;;ctg;;
;;;;;
;578049..578123;;ggc;;
;;;;;
;636984..638548;;16s;@2;94
;638643..638719;;atc;;66
;638786..638861;;gca;;273
;639135..642040;;23s;;139
;642180..642296;;5s;;
;;;;;
;712229..712304;;cac;;18
;712323..712398;;caa;;3
;712402..712477;;aaa;;16
;712494..712577;;cta;;
;;;;;
comp;724421..724497;;gtc;;
;;;;;
;774880..774956;;gac;;4
;774961..775036;;ttc;;8
;775045..775119;;ggc;;9
;775129..775202;;tgc;;13
;775216..775304;;tta;;
;;;;;
;796654..796728;;cgg;;
;;;;;
;842393..842469;;gac;;2
;842472..842547;;ttc;;8
;842556..842630;;ggc;;9
;842640..842713;;tgc;;
;;;;;
;889670..889746;;ccc;;
;;;;;
;906136..906210;;aac;;
;;;;;
;1022783..1022859;;gac;;2
;1022862..1022936;;ggc;;1
;1022938..1023011;;tgg;;
;;;;;
;1555201..1555277;;ccg;;
;;;;;
comp;1567911..1567999;;tca;;
;;;;;
comp;1613773..1613863;;agc;;
;;;;;
;1702659..1702744;;ttg;;
;;;;;
comp;1711770..1711886;;5s;;228
comp;1712115..1715021;;23s;;359
comp;1715381..1716945;;16s;;
;;;;;
comp;1823852..1823927;;gta;;6
comp;1823934..1824008;;gaa;;8
comp;1824017..1824092;;aag;;
;;;;;
;1909446..1909536;;tcc;;
;;;;;
comp;1911342..1911429;;tcg;;
;;;;;
comp;1974984..1975058;;atgi;;
;;;;;
comp;1984782..1984856;;gag;;12
comp;1984869..1984942;;cag;+;111
comp;1985054..1985127;;cag;2 cag;
;;;;;
comp;2072279..2072395;;5s;;228
comp;2072624..2075529;;23s;;298
comp;2075828..2075903;;gca;;66
comp;2075970..2076046;;atc;;94
comp;2076141..2077705;;16s;;
;;;;;
;2148343..2148418;;gcg;;
;;;;;
comp;2287117..2287192;;aaa;;
;;;;;
comp;2303018..2303094;;gtg;;
;;;;;
comp;2323563..2323636;;ggg;;

afn cumuls[modifier | modifier le wikicode]

afn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;6;1;1;-
;16 23 5s 0;4;20;21;
;16 atc gca;2;40;2;
;16 23 5s a;0;60;2;
;max a;2;80;0;
;a doubles;0;100;0;
;spéciaux;0;120;1;
;total aas;4;140;0;
sans ;opérons;29;160;0;
;1 aa;20;180;0;
;max a;6;200;0;
;a doubles;2;;0;
;total aas;56;;27;0
total aas;;60;;;
remarques;;2;;;
avec jaune;;;moyenne;16;
;;;variance;23;
sans jaune;;;moyenne;12;
;;;variance;13;

afn blocs[modifier | modifier le wikicode]

afn blocs;;;;;;
16s;359;1565;359;1565;251;1565
23s;228;2906;228;2907;229;2907
5s;;117;;117;;117
;;;;;;
16s;94;1565;;5s;228;117
atc;66;;;23s;298;2906
gca;273;;;gca;66;
23s;139;2906;;atc;94;
5s;;117;;16s;;1565
;;;;;;
5s;228;117;;;;
23s;359;2907;;;;
16s;;1565;;;;

afn remarques[modifier | modifier le wikicode]

afn;;;;;;;60
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;2
atc;2;acc;1;aac;2;agc;1
ctc;1;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;3;ggc;4
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;2;aga;1
cta;1;cca;1;caa;1;cga;
gta;2;gca;2;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;2;ccg;1;cag;2;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

negativicutes distribution[modifier | modifier le wikicode]

22.1.21 Paris;;tRNAs total des negatives;;;;;;;;;;;;;;
genomes;;total;;;total;ttt;tgt;;1-3aas;;;;total;;ttt;tgt
9;;582;;;571;;;;;;;;58;;;
atgi;8;tct;;tat;;atgf;15;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;17;tcc;10;tac;16;tgc;13;;ttc;;tcc;;tac;1;tgc;
atc;17;acc;11;aac;26;agc;11;;atc;18;acc;;aac;6;agc;1
ctc;11;ccc;7;cac;10;cgt;16;;ctc;;ccc;;cac;2;cgt;2
gtc;8;gcc;7;gac;24;ggc;33;;gtc;;gcc;;gac;;ggc;
tta;11;tca;10;taa;;tga;1;;tta;;tca;;taa;;tga;
ata;;aca;13;aaa;20;aga;9;;ata;;aca;;aaa;;aga;
cta;9;cca;11;caa;13;cga;2;;cta;;cca;;caa;1;cga;
gta;24;gca;21;gaa;25;gga;10;;gta;;gca;21;gaa;1;gga;
ttg;11;tcg;9;tag;;tgg;13;;ttg;;tcg;;tag;;tgg;4
atgj;12;acg;9;aag;10;agg;9;;atgj;;acg;1;aag;;agg;
ctg;10;ccg;7;cag;11;cgg;9;;ctg;;ccg;;cag;;cgg;
gtg;4;gcg;5;gag;5;ggg;8;;gtg;;gcg;;gag;;ggg;
;;186;;263;;122;571;;;;7;;11;;1;19
9-23;;;;total;;ttt;tgt;;-rRNA;;;;total;;ttt;tgt
;;;;92;;;;;attention au -2;;;;421;;;
atgi;1;tct;;tat;;atgf;3;;atgi;7;tct;;tat;;atgf;12
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;6;tcc;2;tac;3;tgc;2;;ttc;11;tcc;8;tac;12;tgc;11
atc;1;acc;;aac;5;agc;2;;atc;-2;acc;11;aac;15;agc;8
ctc;2;ccc;;cac;3;cgt;4;;ctc;9;ccc;7;cac;5;cgt;10
gtc;;gcc;;gac;7;ggc;3;;gtc;8;gcc;7;gac;17;ggc;30
tta;4;tca;1;taa;;tga;;;tta;7;tca;9;taa;;tga;1
ata;;aca;5;aaa;5;aga;;;ata;;aca;8;aaa;15;aga;9
cta;1;cca;2;caa;5;cga;;;cta;8;cca;9;caa;7;cga;2
gta;7;gca;;gaa;5;gga;4;;gta;17;gca;0;gaa;19;gga;6
ttg;2;tcg;;tag;;tgg;2;;ttg;9;tcg;9;tag;;tgg;7
atgj;1;acg;;aag;2;agg;;;atgj;11;acg;8;aag;8;agg;9
ctg;2;ccg;;cag;;cgg;;;ctg;8;ccg;7;cag;11;cgg;9
gtg;;gcg;;gag;;ggg;;;gtg;4;gcg;5;gag;5;ggg;8
;;24;;64;;4;92;;;;118;;188;;117;423
;;;;;;;;;;;116;;188;;117;421

afn distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;1;tcc;1;tac;1;tgc;2;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;1;;atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;
ctc;;ccc;1;cac;;cgt;1;;ctc;1;ccc;;cac;1;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;1;;gtc;;gcc;;gac;3;ggc;3;;gtc;;gcc;;gac;;ggc;
tta;;tca;1;taa;;tga;;;tta;1;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;1;aga;;;ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;1;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;;atgj;1;acg;;aag;1;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;1;;ctg;2;ccg;;cag;;cgg;;;ctg;;ccg;;cag;2;cgg;
gtg;1;gcg;1;gag;;ggg;1;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total
afn;;20;;;;;20;;afn;34;;;;;;34;;afn;2;;;;;;2

afn données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: afn données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA tRNA;;afn;Sup 400;Sup 400
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;long;long;long
fxt;fct;afn;fx;fc;afn;fx40;fc40;afn;x-;c-;c;x;c;x;c;aa;c;aa;fx;fc;fc
;0;0;2;9;0;2;9;-1;0;38;105;361;CDS 16s;;16s 23s;;tRNA tRNA;hors bloc;405;411;628
;0;10;4;180;1;1;38;-2;0;0;105;51;319;;3* 359;;22;aca;416;411;636
;0;20;3;248;2;2;25;-3;0;0;122;188;346;;251;;5;tac;425;414;647
;3;30;7;105;3;0;20;-4;1;129;195;268;485;;23s 5s;;3;atgj;429;417;649
;1;40;21;48;4;0;28;-5;0;0;200;61;300;;4* 228;;6;acc;442;432;667
;2;50;15;38;5;0;13;-6;0;1;131;80;391;;229;;**;atgf;457;432;677
1;2;60;16;44;6;0;9;-7;0;6;74;134;265;;139;;3;aac;471;435;679
2;0;70;5;42;7;0;5;-8;0;41;266;393;5s CDS;;16s tRNA;;8;gaa;492;436;683
1;4;80;8;41;8;0;7;-9;0;1;145;158;286;266;2* 94;atc;50;gta;508;441;693
;1;90;8;45;9;1;19;-10;0;1;54;91;296;262;tRNA 23s;;11;cca;517;446;718
1;3;100;11;34;10;0;16;-11;0;19;131;70;;512;273;gca;8;gga;548;446;721
;4;110;10;32;11;1;28;-12;0;0;194;196;;193;298;gca;**;aga;550;452;736
;3;120;8;42;12;0;46;-13;0;5;96;;;;tRNA tRNA;intra;30;ctg;701;456;744
;3;130;15;43;13;1;29;-14;0;8;214;;;;2* 66;atc gca;52;ctc;772;468;795
1;4;140;21;34;14;0;22;-15;0;0;111;;;;;;**;ctg;957;472;845
;1;150;13;29;15;0;37;-16;0;3;73;;;;;;18;cac;992;472;922
1;2;160;14;27;16;0;24;-17;0;10;159;;;;;;3;caa;;475;1130
;0;170;10;28;17;0;10;-18;0;0;119;;;;;;16;aaa;;476;1154
;0;180;2;22;18;0;25;-19;0;2;127;;;;;;**;cta;;481;2261
1;1;190;13;13;19;1;12;-20;0;6;71;;;;;;4;gac;;495;
1;3;200;13;12;20;0;15;-21;0;0;156;;;;;;8;ttc;;497;
;0;210;10;15;21;1;20;-22;0;0;58;;;;;;9;ggc;;499;
;2;220;12;20;22;1;13;-23;0;4;102;;;CDS-CDS;inf 50;;13;tgc;;499;
;1;230;9;25;23;0;11;-24;0;0;137;;;intercalaire;;;**;tta;;502;
;0;240;12;21;24;1;9;-25;0;0;112;;;c-;x-;;2;gac;;503;
;0;250;6;12;25;0;9;-26;0;4;24;;;-113;-83;;8;ttc;;507;
;0;260;7;9;26;0;6;-27;0;0;21;;;-79;;;9;ggc;;513;
1;1;270;5;16;27;1;14;-28;0;0;93;;;-74;;;**;tgc;;515;
;0;280;6;10;28;0;10;-29;0;3;215;;;-71;;;2;gac;;519;
;0;290;5;6;29;2;3;-30;0;0;76;;;-68;;;1;ggc;;542;
;0;300;8;9;30;1;10;-31;0;2;379;;;-67;;;**;tgg;;544;
;0;310;4;11;31;2;5;-32;0;2;83;;;-67;;;6;gta;;551;
;0;320;4;4;32;2;5;-33;0;0;182;;;-59;;;8;gaa;;551;
;0;330;5;8;33;2;3;-34;0;0;136;;;-53;;;**;aag;;567;
;0;340;1;8;34;5;5;-35;0;3;23;;;;;;12;gag;;580;
;0;350;3;9;35;2;6;-36;0;0;222;;;total;intercalaires;;111;cag;;;
;0;360;2;8;36;3;3;-37;0;1;39;;;;242,27;;**;cag;;;
1;0;370;4;10;37;0;8;-38;0;2;122;;;ADN long;2329769;;;;;;
;1;380;4;4;38;3;3;-39;0;0;106;;;%;10.4;;;;;;
;0;390;3;4;39;2;6;-40;1;0;91;;;;;;;;;;
1;1;400;1;6;40;0;4;-41;0;1;451;;;non RNA;42;;;;;;
;2;reste;16;54;reste;309;795;-42;0;0;45;;;;;;;;;;
12;45;total;346;1385;total;346;1385;-43;0;0;486;;;;;;;;;;
12;43;diagr;328;1322;diagr;35;581;-44;0;1;45;;;;;;;;;;
0;3; t30;14;533;;;;-45;1;0;393;;;;;;;;;;
;;;;;;;;-46;0;0;;;;;;;;;;;
;;Récapitulatif des effectifs;;;;;;-47;0;0;;;;;;;;;;;
;;>0;<0;zéro;total;*;;-48;0;0;;;;;;;;;;;
;x;344;4;2;350;;;-49;0;0;;;;;;;;;;;
;c;1376;303;9;1688;;;-50;0;1;;;;;;;;;;;
;;;;;2038;154;;reste;1;9;;;;;;;;;;;
;;;;;;2192;;total;4;303;;;;;;;;;;;

afn autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: afn autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
  • contrôlé le 21.7.22
autres intercalaires;;afn;;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre;aas
deb;;CDS;23699;24358;319;*;
;;rRNA;24678;26242;359;*;16s
;;rRNA;26602;29507;228;*;23s
;;rRNA;29736;29852;286;*;5s
fin;;CDS;30139;30339;;0;
deb;;CDS;35919;36713;105;*;
;;tRNA;36819;36894;105;*;acg
fin;;CDS;37000;37914;;;
deb;;CDS;56077;57366;346;*;
;;rRNA;57713;59277;359;*;16s
;;rRNA;59637;62543;228;*;23s
;;rRNA;62772;62888;266;*;5s
fin;comp;CDS;63155;64390;;0;
deb;;CDS;168443;169336;122;*;
;;tRNA;169459;169534;361;*;gcc
fin;comp;CDS;169896;170894;;;
deb;comp;CDS;181646;182656;89;*;
;comp;misc_b;182746;182986;130;*;
fin;comp;CDS;183117;183803;;;
deb;comp;CDS;183775;185160;510;*;
;;misc_b;185671;185909;146;*;
fin;;CDS;186056;187753;;;
deb;;CDS;249164;249595;195;*;
;;tRNA;249791;249867;51;*;agg
fin;comp;CDS;249919;250062;;;
deb;;CDS;253385;254824;90;*;
;;misc_b;254915;255170;84;*;
fin;;CDS;255255;256238;;;
deb;comp;CDS;273899;274426;200;*;
;comp;tRNA;274627;274703;188;*;cgt
fin;;CDS;274892;276166;;;
deb;;CDS;310188;310991;131;*;
;;tRNA;311123;311198;22;*;aca
;;tRNA;311221;311305;5;*;tac
;;tRNA;311311;311386;3;*;atgj
;;tRNA;311390;311465;6;*;acc
;;tRNA;311472;311548;74;*;atgf
fin;;CDS;311623;312816;;;
deb;;CDS;359181;360227;58;*;
;;regulatory;360286;360394;52;*;
fin;;CDS;360447;361625;;;
deb;;CDS;378908;379996;485;*;
;;rRNA;380482;382046;251;*;16s
;;rRNA;382298;385204;229;*;23s
;;rRNA;385434;385550;262;*;5s
fin;comp;CDS;385813;386838;;;
deb;;CDS;414288;416231;246;*;
;;regulatory;416478;416590;98;*;
fin;;CDS;416689;417768;;;
deb;;CDS;460654;461286;266;*;
;;tRNA;461553;461627;3;*;aac
;;tRNA;461631;461705;8;*;gaa
;;tRNA;461714;461789;50;*;gta
;;tRNA;461840;461916;11;*;cca
;;tRNA;461928;462001;8;*;gga
;;tRNA;462010;462086;145;*;aga
fin;;CDS;462232;463230;;;
deb;;CDS;466993;468717;232;*;
;;misc_b;468950;469148;36;*;
fin;;CDS;469185;471839;;;
deb;;CDS;526396;526929;54;*;
;;tRNA;526984;527070;30;*;ctg
;;tRNA;527101;527186;52;*;ctc
;;tRNA;527239;527325;268;*;ctg
fin;comp;CDS;527594;528586;;0;
deb;comp;CDS;570200;571507;65;*;
;comp;regulatory;571573;571669;209;*;
fin;;CDS;571879;575394;;;
deb;;CDS;577378;577917;131;*;
;;tRNA;578049;578123;194;*;ggc
fin;;CDS;578318;579067;;;
deb;;CDS;635289;636683;300;*;
;;rRNA;636984;638548;94;*;16s
;;tRNA;638643;638719;66;*;atc
;;tRNA;638786;638861;273;*;gca
;;rRNA;639135;642040;139;*;23s
;;rRNA;642180;642296;296;*;5s
fin;;CDS;642593;643381;;0;
deb;;CDS;677296;678177;181;*;
;;misc_f;678359;678410;368;*;
fin;;CDS;678779;679798;;;
deb;;CDS;711704;712132;96;*;
;;tRNA;712229;712304;18;*;cac
;;tRNA;712323;712398;3;*;caa
;;tRNA;712402;712477;16;*;aaa
;;tRNA;712494;712577;61;*;cta
fin;comp;CDS;712639;712809;;0;
deb;;CDS;723480;724340;80;*;
;comp;tRNA;724421;724497;134;*;gtc
fin;;CDS;724632;725645;;;
deb;;CDS;774399;774665;214;*;
;;tRNA;774880;774956;4;*;gac
;;tRNA;774961;775036;8;*;ttc
;;tRNA;775045;775119;9;*;ggc
;;tRNA;775129;775202;13;*;tgc
;;tRNA;775216;775304;111;*;tta
fin;;CDS;775416;776684;;;
deb;;CDS;796146;796580;73;*;
;;tRNA;796654;796728;159;*;cgg
fin;;CDS;796888;797310;;;
deb;;CDS;841590;842273;119;*;
;;tRNA;842393;842469;2;*;gac
;;tRNA;842472;842547;8;*;ttc
;;tRNA;842556;842630;9;*;ggc
;;tRNA;842640;842713;127;*;tgc
fin;;CDS;842841;843362;;;
deb;;CDS;881739;882029;121;*;
;;repeat_reg;882151;886170;278;*;
fin;;CDS;886449;887618;;;
deb;;CDS;889017;889598;71;*;
;;tRNA;889670;889746;156;*;ccc
fin;;CDS;889903;891513;;;
deb;;CDS;905286;906077;58;*;
;;tRNA;906136;906210;102;*;aac
fin;;CDS;906313;907125;;;
deb;;CDS;913707;915986;78;*;
;;regulatory;916065;916164;91;*;
fin;;CDS;916256;917077;;;
deb;;CDS;947642;948565;32;*;
;;ncRNA;948598;948943;38;*;
fin;;CDS;948982;949302;;;
deb;comp;CDS;1017827;1018843;92;*;
;;misc_b;1018936;1019130;36;*;
fin;;CDS;1019167;1020189;;;
deb;;CDS;1020207;1022645;137;*;
;;tRNA;1022783;1022859;2;*;gac
;;tRNA;1022862;1022936;1;*;ggc
;;tRNA;1022938;1023011;112;*;tgg
fin;;CDS;1023124;1023423;;;
deb;comp;CDS;1111497;1112716;73;*;
;comp;misc_b;1112790;1113035;267;*;
fin;;CDS;1113303;1114085;;;
deb;;CDS;1305277;1306137;298;*;
;;regulatory;1306436;1306545;70;*;
fin;;CDS;1306616;1307653;;;
deb;;CDS;1328649;1328930;26;*;
;;tmRNA;1328957;1329305;406;*;
fin;comp;CDS;1329712;1332120;;;
deb;comp;CDS;1403493;1404494;52;*;
;comp;misc_b;1404547;1404789;111;*;
fin;comp;CDS;1404901;1406295;;;
deb;comp;CDS;1485384;1487072;59;*;
;comp;misc_b;1487132;1487376;146;*;
fin;comp;CDS;1487523;1488698;;;
deb;;CDS;1536256;1537929;68;*;
;;regulatory;1537998;1538074;113;*;erreur
fin;;CDS;1538188;1539855;;0;
deb;;CDS;1553542;1555176;24;*;
;;tRNA;1555201;1555277;393;*;ccg
fin;comp;CDS;1555671;1556342;;;
deb;comp;CDS;1567689;1567889;21;*;
;comp;tRNA;1567911;1567999;93;*;tca
fin;comp;CDS;1568093;1568569;;;
deb;;CDS;1612826;1613614;158;*;
;comp;tRNA;1613773;1613863;215;*;agc
fin;comp;CDS;1614079;1614846;;0;
deb;comp;CDS;1668440;1668919;42;*;
;comp;ncRNA;1668962;1669144;51;*;
fin;comp;CDS;1669196;1669855;;0;
deb;;CDS;1701767;1702582;76;*;
;;tRNA;1702659;1702744;91;*;ttg
fin;comp;CDS;1702836;1703666;;;
deb;;CDS;1710214;1711257;512;*;
;comp;rRNA;1711770;1711886;228;*;5s
;comp;rRNA;1712115;1715021;359;*;23s
;comp;rRNA;1715381;1716945;391;*;16s
fin;comp;CDS;1717337;1718857;;;
deb;comp;CDS;1823002;1823472;379;*;
;comp;tRNA;1823852;1823927;6;*;gta
;comp;tRNA;1823934;1824008;8;*;gaa
;comp;tRNA;1824017;1824092;83;*;aag
fin;comp;CDS;1824176;1825210;;;
deb;comp;CDS;1907578;1909263;182;*;
;;tRNA;1909446;1909536;53;*;tcc
;;ncRNA;1909590;1909689;115;*;
deb;comp;CDS;1909805;1911205;136;*;
;comp;tRNA;1911342;1911429;23;*;tcg
fin;comp;CDS;1911453;1911932;;;
deb;comp;CDS;1912058;1912981;43;*;
;comp;misc_b;1913025;1913256;130;*;
fin;;CDS;1913387;1914049;;;
deb;comp;CDS;1973889;1974761;222;*;
;comp;tRNA;1974984;1975058;39;*;atgi
fin;comp;CDS;1975098;1976867;;;
deb;comp;CDS;1983694;1984659;122;*;
;comp;tRNA;1984782;1984856;12;*;gag
;comp;tRNA;1984869;1984942;111;*;cag
;comp;tRNA;1985054;1985127;106;*;cag
fin;comp;CDS;1985234;1985980;;;
deb;;CDS;2070538;2072085;193;*;
;comp;rRNA;2072279;2072395;228;*;5s
;comp;rRNA;2072624;2075529;298;*;23s
;comp;tRNA;2075828;2075903;66;*;gca
;comp;tRNA;2075970;2076046;94;*;atc
;comp;rRNA;2076141;2077705;265;*;16s
fin;comp;CDS;2077971;2079029;;;
deb;;CDS;2147697;2148251;91;*;
;;tRNA;2148343;2148418;70;*;gcg
fin;comp;CDS;2148489;2148716;;;
deb;comp;CDS;2285667;2286665;451;*;
;comp;tRNA;2287117;2287192;45;*;aaa
fin;comp;CDS;2287238;2288464;;;
deb;comp;CDS;2301950;2302531;486;*;
;comp;tRNA;2303018;2303094;45;*;gtg
fin;comp;CDS;2303140;2303844;;;
deb;comp;CDS;2322585;2323169;393;*;
;comp;tRNA;2323563;2323636;196;*;ggg
fin;;CDS;2323833;2328641;;0;

afn intercalaires entre cds[modifier | modifier le wikicode]

afn intercalaires positifs S+[modifier | modifier le wikicode]

afn Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
rtb;min30;118;402;520;536;-105;148;253;-277;-165;202;;;
afn;min10;328;1322;1650;607;-17;108;125;-467;-407;-8;;;
mba;min10;705;1651;2356;154;-330;-221;109;-512;-477;-223;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
51;294;0.17;189;604;5;7;21;162;8;131;-81;;;
46;402;0.11;350;1688;6;5;11;180;36;580;-369;;;
45;214;0.21;1255;2688;1;8;18;114;51;428;-74;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
afn;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;&-7;-5;-3;1;R2;flex c+;comment.
1 à 400;29;-227;419;16;486;261;max40,140;&-95;712;-1690;137;722;250;min50
31 à 400;;;;;;;2 parties;&9.5;-42;-63;38;904;147;2 parties
droite;-a;cste;-;R2;note;R2’;;&-a;cste;-;R2;note;R2’;
1 à 400;75;40;-;303;poly;183;tF;&197;65;;425;poly;297;SF
31 à 400;;;;;;;;&92;36;-;859;dte;45;tm
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30, t30.
  • Corrélations et fréquences faibles
;400;200;250;;;;;;;;;;;
;coefficient de corrélation fx fc;;;;;;;corrélation;;;;;;
41-n;0.607;-0.017;0.108;;;;;-0.369;;;;;;
1-n;-0.008;-0.467;-0.407;;;;;;;;;14.8.21 paris;;
afn;fx;fc;;afn;fx%;fc%;;fx40;fc40;;x;afn;Sx-;Sc-
0;2;9;;0;6;7;0;2;9;>0;344;-1;0;38
10;4;180;;10;12;136;1;1;38;<0;4;-2;0;0
20;3;248;;20;9;188;2;2;25;zéro;2;-3;0;0
30;8;104;;30;24;79;3;0;20;total;350;-4;1;129
40;21;48;;40;64;36;4;0;28;;c;-5;0;0
50;15;38;;50;46;29;5;0;13;>0;1376;-6;0;1
60;16;44;;60;49;33;6;0;9;<0;303;-7;0;6
70;5;42;;70;15;32;7;0;5;zéro;9;-8;0;41
80;8;41;;80;24;31;8;0;7;total;1688;-9;0;1
90;8;45;;90;24;34;9;1;19;;;-10;0;1
100;11;34;;100;34;26;10;0;16;total;2038;-11;0;19
110;10;32;;110;30;24;11;1;28;;;-12;0;0
120;8;42;;120;24;32;12;0;46;;;-13;0;5
130;16;42;;130;49;32;13;1;29;;;-14;0;8
140;21;34;;140;64;26;14;0;22;;;-15;0;0
150;13;29;;150;40;22;15;0;37;;;-16;0;3
160;14;27;;160;43;20;16;0;24;;;-17;0;10
170;10;28;;170;30;21;17;0;10;;;-18;0;0
180;2;22;;180;6;17;18;0;25;;;-19;0;2
190;13;13;;190;40;10;19;1;12;;;-20;0;6
200;13;12;;200;40;9;20;0;15;;;-21;0;0
210;10;15;;210;30;11;21;1;20;;;-22;0;0
220;12;20;;220;37;15;22;1;13;;;-23;0;4
230;9;25;;230;27;19;23;0;11;;;-24;0;0
240;12;21;;240;37;16;24;1;9;;;-25;0;0
250;6;12;;250;18;9;25;0;9;;;-26;0;4
260;7;9;;260;21;7;26;1;5;;;-27;0;0
270;5;16;;270;15;12;27;1;14;;;-28;0;0
280;6;10;;280;18;8;28;0;10;;;-29;0;3
290;5;6;;290;15;5;29;2;3;;;-30;0;0
300;8;9;;300;24;7;30;1;10;;;-31;0;2
310;4;11;;310;12;8;31;2;5;;;-32;0;2
320;4;4;;320;12;3;32;2;5;;;-33;0;0
330;4;9;;330;12;7;33;2;3;;;-34;0;0
340;1;8;;340;3;6;34;5;5;;;-35;0;3
350;3;9;;350;9;7;35;2;6;;;-36;0;0
360;2;8;;360;6;6;36;3;3;;;-37;0;1
370;4;10;;370;12;8;37;0;8;;;-38;0;2
380;3;5;;380;9;4;38;3;3;;;-39;0;0
390;3;4;;390;9;3;39;2;6;;;-40;1;0
400;1;6;;400;3;5;40;0;4;;;-41;0;1
reste;16;54;;;;;reste;308;796;;;-42;0;0
total;346;1385;;t30;46;402;total;346;1385;;;-43;0;0
diagr;328;1322;;;;;diagr;36;580;;;-44;0;1
 - t30;313;790;;;;;;;;;;-45;1;0
;;;;;;;;;;;;-46;0;0
;;;;;;;;;;;;-47;0;0
;;;;;;;;;;;;-48;0;0
;;;;;;;;;;;;-49;0;0
;;;;;;;;;;;;-50;0;1
;;;;;;;;;;;;reste;1;9
;;;;;;;;;;;;total;4;303

afn intercalaires négatifs S-[modifier | modifier le wikicode]

  • 9.6.21
afn;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;;
comp’;;;;1;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;;;;;1;;;;;;1;4
continu;38;0;0;129;0;1;6;41;1;1;19;0;5;8;0;3;10;0;2;6;0;0;4;0;0;4;0;0;3;0;2;2;0;0;3;0;1;2;0;0;1;0;0;1;0;0;0;0;0;1;9;303

14.8.21

14.8.21 paris;afn;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;0;0;1;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;1;0;0;0;0;1;0;0;0;0;0;1;4
;Sc-;38;0;0;129;0;1;6;41;1;1;19;0;5;8;0;3;10;0;2;6;0;0;4;0;0;4;0;0;3;0;2;2;0;0;3;0;1;2;0;0;1;0;0;1;0;0;0;0;0;1;9;303

afn autres intercalaires[modifier | modifier le wikicode]

afn;autres intercalaires;;adresses1;;;afn;autres intercalaires;;adresses1;;;afn;autres intercalaires;;adresses1;
deb;°CDS;23699;319;;;deb;°CDS;635289;300;;;deb;°CDS;1485384;59;comp
;$rRNA;24678;359;;;;$rRNA;636984;94;;;;misc_binding;1487132;146;comp
;$rRNA;26602;228;;;;&tRNA;638643;66;;;fin;°CDS;1487523;;comp
;$rRNA;29736;286;;;;&tRNA;638786;273;;;deb;°CDS;1536256;68;
fin;°CDS;30139;;;;;$rRNA;639135;139;;;;regulatory;1537998;113;
deb;°CDS;35919;105;;;;$rRNA;642180;296;;;fin;°CDS;1538188;;
;&tRNA;36819;105;;;fin;°CDS;642593;;;;deb;°CDS;1553542;24;
fin;°CDS;37000;;;;deb;°CDS;677296;181;;;;&tRNA;1555201;393;
deb;°CDS;56077;346;;;;misc_feature;678359;368;;;fin;°CDS;1555671;;comp
;$rRNA;57713;359;;;fin;°CDS;678779;;;;deb;°CDS;1567689;21;comp
;$rRNA;59637;228;;;deb;°CDS;711704;96;;;;&tRNA;1567911;93;comp
;$rRNA;62772;266;;;;&tRNA;712229;18;;;fin;°CDS;1568093;;comp
fin;°CDS;63155;;comp;;;&tRNA;712323;3;;;deb;°CDS;1612826;158;
deb;°CDS;168443;122;;;;&tRNA;712402;16;;;;&tRNA;1613773;215;comp
;&tRNA;169459;361;;;;&tRNA;712494;61;;;fin;°CDS;1614079;;comp
fin;°CDS;169896;;comp;;fin;°CDS;712639;;comp;;deb;°CDS;1668440;42;comp
deb;°CDS;181646;89;comp;;deb;°CDS;723480;80;;;;ncRNA;1668962;51;comp
;misc_binding;182746;130;comp;;;&tRNA;724421;134;comp;;fin;°CDS;1669196;;comp
fin;°CDS;183117;;comp;;fin;°CDS;724632;;;;deb;°CDS;1701767;76;
deb;°CDS;183775;510;comp;;deb;°CDS;774399;214;;;;&tRNA;1702659;91;
;misc_binding;185671;146;;;;&tRNA;774880;4;;;fin;°CDS;1702836;;comp
fin;°CDS;186056;;;;;&tRNA;774961;8;;;deb;°CDS;1710214;512;
deb;°CDS;249164;195;;;;&tRNA;775045;9;;;;$rRNA;1711770;228;comp
;&tRNA;249791;51;;;;&tRNA;775129;13;;;;$rRNA;1712115;359;comp
fin;°CDS;249919;;comp;;;&tRNA;775216;111;;;;$rRNA;1715381;391;comp
deb;°CDS;253385;90;;;fin;°CDS;775416;;;;fin;°CDS;1717337;;comp
;misc_binding;254915;84;;;deb;°CDS;796146;73;;;deb;°CDS;1823002;379;comp
fin;°CDS;255255;;;;;&tRNA;796654;159;;;;&tRNA;1823852;6;comp
deb;°CDS;273899;200;comp;;fin;°CDS;796888;;;;;&tRNA;1823934;8;comp
;&tRNA;274627;188;comp;;deb;°CDS;841590;119;;;;&tRNA;1824017;83;comp
fin;°CDS;274892;;;;;&tRNA;842393;2;;;fin;°CDS;1824176;;comp
deb;°CDS;310188;131;;;;&tRNA;842472;8;;;deb;°CDS;1907578;182;comp
;&tRNA;311123;22;;;;&tRNA;842556;9;;;;&tRNA;1909446;53;comp
;&tRNA;311221;5;;;;&tRNA;842640;127;;;;ncRNA;1909590;115;
;&tRNA;311311;3;;;fin;°CDS;842841;;;;deb;°CDS;1909805;136;
;&tRNA;311390;6;;;deb;°CDS;881739;121;;;;&tRNA;1911342;23;
;&tRNA;311472;74;;;;repeat_region;882151;278;;;fin;°CDS;1911453;;
fin;°CDS;311623;;;;fin;°CDS;886449;;;;deb;°CDS;1912058;43;comp
deb;°CDS;359181;58;;;deb;°CDS;889017;71;;;;misc_binding;1913025;130;comp
;regulatory;360286;52;;;;&tRNA;889670;156;;;fin;°CDS;1913387;;
fin;°CDS;360447;;;;fin;°CDS;889903;;;;deb;°CDS;1973889;222;comp
deb;°CDS;378908;485;;;deb;°CDS;905286;58;;;;&tRNA;1974984;39;comp
;$rRNA;380482;251;;;;&tRNA;906136;102;;;fin;°CDS;1975098;;comp
;$rRNA;382298;229;;;fin;°CDS;906313;;;;deb;°CDS;1983694;122;comp
;$rRNA;385434;262;;;deb;°CDS;913707;78;;;;&tRNA;1984782;12;comp
fin;°CDS;385813;;comp;;;regulatory;916065;91;;;;&tRNA;1984869;111;comp
deb;°CDS;414288;246;;;fin;°CDS;916256;;;;;&tRNA;1985054;106;comp
;regulatory;416478;98;;;deb;°CDS;947642;32;;;fin;°CDS;1985234;;comp
fin;°CDS;416689;;;;;ncRNA;948598;38;;;deb;°CDS;2070538;193;
deb;°CDS;460654;266;;;fin;°CDS;948982;;;;;$rRNA;2072279;228;comp
;&tRNA;461553;3;;;deb;°CDS;1017827;92;comp;;;$rRNA;2072624;298;comp
;&tRNA;461631;8;;;;misc_binding;1018936;36;;;;&tRNA;2075828;66;comp
;&tRNA;461714;50;;;fin;°CDS;1019167;;;;;&tRNA;2075970;94;comp
;&tRNA;461840;11;;;deb;°CDS;1020207;137;;;;$rRNA;2076141;265;comp
;&tRNA;461928;8;;;;&tRNA;1022783;2;;;fin;°CDS;2077971;;comp
;&tRNA;462010;145;;;;&tRNA;1022862;1;;;deb;°CDS;2147697;91;
fin;°CDS;462232;;;;;&tRNA;1022938;112;;;;&tRNA;2148343;70;
deb;°CDS;466993;232;;;fin;°CDS;1023124;;;;fin;°CDS;2148489;;comp
;misc_binding;468950;36;;;deb;°CDS;1111497;73;comp;;deb;°CDS;2285667;451;comp
fin;°CDS;469185;;;;;misc_binding;1112790;267;comp;;;&tRNA;2287117;45;comp
deb;°CDS;526396;54;;;fin;°CDS;1113303;;;;fin;°CDS;2287238;;comp
;&tRNA;526984;30;;;deb;°CDS;1305277;298;;;deb;°CDS;2301950;486;comp
;&tRNA;527101;52;;;;regulatory;1306436;70;;;;&tRNA;2303018;45;comp
;&tRNA;527239;268;;;fin;°CDS;1306616;;;;fin;°CDS;2303140;;comp
fin;°CDS;527594;;comp;;deb;°CDS;1328649;26;;;deb;°CDS;2322585;393;comp
deb;°CDS;570200;65;comp;;;tmRNA;1328957;406;;;;&tRNA;2323563;196;comp
;regulatory;571573;209;comp;;fin;°CDS;1329712;;comp;;fin;°CDS;2323833;;
fin;°CDS;571879;;;;deb;°CDS;1403493;52;comp;;;;;;
deb;°CDS;577378;131;;;;misc_binding;1404547;111;comp;;;;;;
;&tRNA;578049;194;;;fin;°CDS;1404901;;comp;;;;;;
fin;°CDS;578318;;;;;;;;;;;;;;

afn intercalaires tRNA[modifier | modifier le wikicode]

comp’;aa;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;;;;;;
;;;105;;105;;21;23;deb;
;;;122;comp’;361;;24;39;<201;20
;;;195;comp’;51;;54;45;total;25
;3 8 50 11 8;;200;comp’;188;;58;70;%;80%
;;;131;;145;;71;83;;
;30 52;;54;comp’;268;;73;93;fin;
;;;131;;194;;76;102;<201;17
;18 3 16;;96;comp’;61;;91;105;total;18
;;comp’;80;comp’;134;;96;106;%;94%
;4 8 9 13;;214;;111;;105;111;;
;;;73;;159;;119;112;total;
;2  8  9;;119;;127;;122;127;<201;37
;;;71;;156;;122;145;total;43
;;;58;;102;;131;156;%;86%
;2  1;;137;;112;;131;159;;
;;;24;comp’;393;;136;194;;
;;;21;;93;;137;196;;
;;comp’;158;;215;;182;215;;
;;;76;comp’;91;;195;;;
;6  8;;379;;83;;200;;;
;;;182;;;;214;;;
;;;136;;23;;222;;;
;;;222;;39;;379;;;
;12  111;;122;;106;;393;;;
;;;91;comp’;70;;451;;comp’;cumuls
;;;451;;45;;80;51;deb;2
;;;393;comp’;196;;158;61;<201;100%
;;;;;;;;91;fin;
;;;;;;;;134;<201;5
;deb;fin;total;;;;;188;total;8
<201;22;22;44;;;;;268;%;63%
total;27;26;53;;;;;361;total;10
taux;81%;85%;83%;;;;;393;<201;70%

afn par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;afn;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;11;3;2;;;;16;
16;moyen;5;12;;;;4;21;
14;fort;4;19;;;;;23;
; ;20;34;2;;;4;60;
10;g+cga;6;2;2;;;;10;
2;agg+cgg;2;;;;;;2;
4;carre ccc;3;1;;;;;4;
5;autres;;;;;;;;
;;11;3;2;;;;16;
;total tRNAs  ‰ ;;;;;;;;
;afn;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;183;50;33;;;;267;26
16;moyen;83;200;0;;;67;350;324
14;fort;67;317;0;;;;383;650
; ;333;567;33;;;67;60;729
10;g+cgg;100;33;33;;;;167;10
2;agg+cga;33;;;;;;33;
4;carre ccc;50;17;;;;;67;16
5;autres;;;;;;;;
;;183;50;33;;;;267;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;afn;1aa;>1aa;dup;;ref. ‰;1aa;>1aa;dup
21;faible;196;54;36;286;26;55;9;
16;moyen;89;214;;304;324;25;35;
14;fort;71;339;;411;650;20;56;
; ;357;607;36;56;729;20;34;
10;g+cgg;107;36;36;179;10;55;;
2;agg+cga;36;;;36;;18;;
4;carre ccc;54;18;;71;16;27;;
5;autres;;;;;;;;
;;196;54;36;286;;11;;

negativicutes, estimation des -rRNAs[modifier | modifier le wikicode]

negativicutes;;;;;;;;;;;;;;;;;;;;;;;;;
9 génomes total avec rRNA;;;;nega;total;ttt;tgt;;100 génomes total avec rRNA;;;;nega;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;9;149; ; ;;indices;;;;9;1656;0;0;;neg1;effectifs;;1aa+>1aa+dup;;;;56
atgi;1;tct;;tat;;atgf;3;;atgi;11;tct;;tat;;atgf;33;;atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;6;tcc;2;tac;4;tgc;2;;ttc;67;tcc;22;tac;44;tgc;22;;ttc;2;tcc;1;tac;1;tgc;2
atc;18;acc;;aac;11;agc;3;;atc;200;acc;;aac;122;agc;33;;atc;;acc;1;aac;2;agc;1
ctc;2;ccc;;cac;5;cgt;6;;ctc;22;ccc;;cac;56;cgt;67;;ctc;1;ccc;1;cac;1;cgt;1
gtc;;gcc;;gac;7;ggc;3;;gtc;;gcc;;gac;78;ggc;33;;gtc;1;gcc;1;gac;3;ggc;4
tta;4;tca;1;taa;;tga;;;tta;44;tca;11;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;;aca;5;aaa;5;aga;;;ata;;aca;56;aaa;56;aga;;;ata;;aca;1;aaa;2;aga;1
cta;1;cca;2;caa;6;cga;;;cta;11;cca;22;caa;67;cga;;;cta;1;cca;1;caa;1;cga;
gta;7;gca;21;gaa;6;gga;4;;gta;78;gca;233;gaa;67;gga;44;;gta;2;gca;;gaa;2;gga;1
ttg;2;tcg;;tag;;tgg;6;;ttg;22;tcg;;tag;;tgg;67;;ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;2;agg;;;atgj;11;acg;11;aag;22;agg;;;atgj;1;acg;1;aag;1;agg;1
ctg;2;ccg;;cag;;cgg;;;ctg;22;ccg;;cag;;cgg;;;ctg;2;ccg;1;cag;2;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;1;gcg;1;gag;1;ggg;1
;;69;;75;;5;149;;;;767;;833;;56;1656;;;;16;;24;;16;56
11.1.21 Paris;;;;nega;total;ttt;tgt;;22.1.21 Paris;;;;nega;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;143;6935;0;0;;indices;;;;9;571;;;;neg1;indices;;1aa+>1aa+dup;;;;5600
atgi;78;tct;;tat;;atgf;133;;atgi;89;tct;;tat;;atgf;167;;atgi;100;tct;;tat;;atgf;100
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;122;tcc;89;tac;133;tgc;122;;ttc;189;tcc;111;tac;178;tgc;144;;ttc;200;tcc;100;tac;100;tgc;200
atc;-11;acc;122;aac;167;agc;89;;atc;189;acc;122;aac;289;agc;122;;atc;;acc;100;aac;200;agc;100
ctc;100;ccc;78;cac;56;cgt;111;;ctc;122;ccc;78;cac;111;cgt;178;;ctc;100;ccc;100;cac;100;cgt;100
gtc;89;gcc;78;gac;189;ggc;333;;gtc;89;gcc;78;gac;267;ggc;367;;gtc;100;gcc;100;gac;300;ggc;400
tta;78;tca;100;taa;;tga;11;;tta;122;tca;111;taa;;tga;11;;tta;100;tca;100;taa;;tga;
ata;;aca;89;aaa;167;aga;100;;ata;;aca;144;aaa;222;aga;100;;ata;;aca;100;aaa;200;aga;100
cta;89;cca;100;caa;78;cga;22;;cta;100;cca;122;caa;144;cga;22;;cta;100;cca;100;caa;100;cga;
gta;189;gca;0;gaa;211;gga;67;;gta;267;gca;233;gaa;278;gga;111;;gta;200;gca;;gaa;200;gga;100
ttg;100;tcg;100;tag;;tgg;78;;ttg;122;tcg;100;tag;;tgg;144;;ttg;100;tcg;100;tag;;tgg;100
atgj;122;acg;89;aag;89;agg;100;;atgj;133;acg;100;aag;111;agg;100;;atgj;100;acg;100;aag;100;agg;100
ctg;89;ccg;78;cag;122;cgg;100;;ctg;111;ccg;78;cag;122;cgg;100;;ctg;200;ccg;100;cag;200;cgg;100
gtg;44;gcg;56;gag;56;ggg;89;;gtg;44;gcg;56;gag;56;ggg;89;;gtg;100;gcg;100;gag;100;ggg;100
;;1300;;2089;;1300;4689;;;;2067;;2922;;1356;6344;;;;1600;;2400;;1600;5600
rapports;;63;;71;;96;74;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;neg1;indices;;1aa+>1aa+dup;;différence;;
atgi;88;tct;;tat;;atgf;80;;fiches;50.667;;;fréquences;;;;;atgi;22;tct;;tat;;atgf;25
att;;act;;aat;;agt;;;total des aas sans rRNA;456;;;0/0;2;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;avec;152;;;10;11;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;genom;9;;;20;13;;;;gtt;;gct;;gat;;ggt;
ttc;65;tcc;80;tac;75;tgc;85;;;;;;30;9;;;;ttc;39;tcc;11;tac;25;tgc;39
atc;-6;acc;100;aac;58;agc;73;;neg1;56;;;40;5;;;;atc;100;acc;18;aac;17;agc;11
ctc;82;ccc;100;cac;50;cgt;63;;sans;56;;;50;3;41;;;ctc;0;ccc;22;cac;44;cgt;10
gtc;100;gcc;100;gac;71;ggc;91;;avec;4;;;60;2;;;;gtc;11;gcc;22;gac;37;ggc;17
tta;64;tca;90;taa;;tga;100;;genom;1;;;70;0;;;;tta;22;tca;0;taa;;tga;100
ata;;aca;62;aaa;75;aga;100;;;;;;80;0;;;;ata;;aca;11;aaa;17;aga;0
cta;89;cca;82;caa;54;cga;100;;L’estimation par nega;;;;90;0;;;;cta;11;cca;0;caa;22;cga;100
gta;71;gca;0;gaa;76;gga;60;;est  10% au dessus;;;;100;3;;;;gta;6;gca;;gaa;5;gga;33
ttg;82;tcg;100;tag;;tgg;54;;des aas sans;;;;;0;;;;ttg;0;tcg;0;tag;;tgg;22
atgj;92;acg;89;aag;80;agg;100;;;;;;;48;;;;atgj;18;acg;11;aag;11;agg;0
ctg;80;ccg;100;cag;100;cgg;100;;;;;;;;;;;ctg;56;ccg;22;cag;39;cgg;0
gtg;;gcg;;gag;100;ggg;100;;;;;;;;;;;gtg;56;gcg;44;gag;44;ggg;11
;;;;;;;;;;;;;;;;;;;;275;;263;;294;832

clostridia synthèse[modifier | modifier le wikicode]

clostridia données intercalaires[modifier | modifier le wikicode]

Les clostridia;;psor;cdc;cdc8;cbc;cbn;cle;hmo;cbei;;;;* Autres intercalaires: 1779;;;Ft: 299;Ici: 931;Reste: 549;;;;;;;;;;;;;;;;;;;;hors/contig;H / C;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;;CDS 16s c;CDS 16s x;5s CDS c;5s CDS x;5s 16s c;5s 16s x;;16s 23s;;23s 5s;;16s tRNA;;tRNA 23s;;5s tRNA;;tRNA 5s;;tRNA in;;tRNA contig;;tRNA h;;psor;;cbc;;cbei;;cbn;
;effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;;20;81;85;40;1107;161;1;137;1;35;1;77;1;84;1;3;1;14;1;7;4;1;1;1;;8;gta;84;cgt;30;tca;12;gaa
tot;fxt;fct;tot;fx;fc;tot;fx40;fc40;tot;x-;c-;;117;111;90;69;1125;;1;194;1;40;1;109;1;97;1;13;1;336;2;3;4;2;1;2;;20;gaa;20;agc;241;agc;13;gta
0;0;2;0;3;204;0;3;204;-1;0;473;;181;111;100;99;;;1;213;1;70;1;118;1;109;1;14;2;3;2;6;14;3;8;3;;10;aaa;306;tca;18;tca;5;gac
10;0;1;10;55;1786;1;7;364;-2;1;0;;181;264;109;112;;;1;226;1;76;1;123;1;111;1;15;2;8;2;9;23;4;21;4;;10;aca;20;agc;*;agc;18;aca
20;0;1;20;52;2435;2;7;356;-3;0;2;;181;342;118;114;;;1;285;1;93;1;124;1;118;1;44;2;11;2;11;27;5;29;5;;7;gac;*;tca;20;tta;12;gaa
30;1;1;30;92;1463;3;4;187;-4;19;543;;189;347;119;144;;;1;315;1;114;1;132;1;145;1;89;2;12;2;53;37;6;13;6;;9;gta;17;gaa;7;atgf;13;gta
40;5;0;40;120;903;4;9;188;-5;1;4;;192;348;126;188;;;1;502;1;122;1;137;1;152;2;8;;;;;29;7;15;7;;5;gaa;9;gta;6;atgj;5;gac
50;2;1;50;133;612;5;3;132;-6;3;0;;193;364;127;213;;;1;503;1;126;1;140;1;198;5;6;;;;;15;8;4;8;;*;aaa;4;gac;22;tta;*;aca
60;2;5;60;136;674;6;5;73;-7;0;87;;205;376;128;216;;;1;578;1;132;4;54;1;233;8;4;;;;;32;9;8;9;;cdc  néant;;5;aca;7;atgf;5;tta
70;1;13;70;138;587;7;3;63;-8;4;416;;239;388;131;402;;;1;613;1;134;4;55;1;238;9;7;;;;;10;10;7;10;;cdc8;;18;gaa;6;atgj;5;atgf
80;1;9;80;143;617;8;4;101;-9;1;1;;240;498;138;590;;;2;188;1;181;;;1;240;9;64;;;;;9;11;1;11;;33;aca;7;gta;21;tta;46;atgj
90;3;7;90;157;585;9;9;149;-10;0;38;;241;507;159;;;;2;214;1;182;;;1;250;13;5;;;;;4;12;5;12;;4;gta;57;gac;70;atgf;5;tta
100;1;10;100;150;592;10;4;173;-11;4;227;;249;548;177;;;;2;265;1;204;;;1;263;1;353;x cdc8;;;;5;13;3;13;;6;gaa;17;gaa;21;tta;30;atgf
110;3;5;110;153;587;11;8;285;-12;1;0;;253;;177;;;;2;283;1;205;;;1;272;;;;23s tRNA;;16s 5s;16;14;4;14;;*;aaa;9;gta;*;atgf;46;atgj
120;3;9;120;162;568;12;4;344;-13;2;39;;253;;180;;;;2;324;1;213;;;1;284;;tRNA 16s;1;8;1;79;12;15;1;15;;cle;;4;gac;17;cca;5;tta
130;4;11;130;178;496;13;5;243;-14;1;135;;276;;228;;;;2;325;1;273;;;1;374;1;138;1;41;1;144;5;16;2;16;;23;gaa;*;aca;149;gga;*;atgf
140;3;5;140;160;467;14;1;277;-15;2;0;;276;;245;;;;2;338;1;274;;;1;376;1;151;1;50;1;146;4;17;4;17;;45;cca;4;tta;6;aga;17;gta
150;4;8;150;143;518;15;3;256;-16;1;16;;282;;273;;;;3;221;2;34;;;1;390;1;204;1;56;1;336;4;18;9;18;;11;aaa;53;atgf;16;cca;14;gac
160;4;6;160;191;438;16;4;204;-17;2;99;;283;;273;;;;3;228;2;98;;;2;95;1;459;1;61;2;262;2;19;1;19;;56;gac;10;atgf;35;gga;4;ttc
170;0;7;170;173;416;17;5;233;-18;0;0;;284;;301;;;;5;339;2;100;;;2;237;2;110;1;71;3;261;0;20;5;20;;7;gta;*;atgj;5;aga;8;ggc
180;2;4;180;160;373;18;5;230;-19;1;16;;294;;315;;;;8;196;2;139;;;2;241;2;116;1;92;4;337;3;21;4;21;;187;tta;7;cca;3;cac;57;tgc
190;3;5;190;187;369;19;9;180;-20;1;73;;302;;363;;;;8;237;2;193;;;2;283;2;123;1;94;6;79;0;22;3;22;;26;aca;6;gga;7;caa;*;tgc
200;2;3;200;141;348;20;8;183;-21;2;0;;309;;429;;;;;;3;138;;;3;262;;;1;95;;;4;23;4;23;;10;tac;5;aga;18;aaa;21;cga
210;3;6;210;166;311;21;9;179;-22;2;9;;323;;452;;;;;;3;144;;;4;114;;5s 23s;1;98;;;3;24;1;24;;31;atgj;26;aag;5;cta;28;gga
220;3;2;220;145;323;22;3;149;-23;0;45;;325;;454;;;;;;4;108;;;;;1;230;1;100;;;3;25;2;25;;*;ttc;29;cca;25;ggc;4;aaa
230;5;1;230;142;265;23;7;151;-24;0;2;;331;;508;;;;;;4;202;;;;;;;1;103;;;0;26;3;26;;5;gga;24;gga;5;gga;4;caa
240;1;4;240;108;255;24;3;157;-25;1;13;;346;;552;;;;;;5;78;;;;;;;1;107;;;2;27;1;27;;5;aga;*;cga;57;aag;5;cac
250;0;7;250;130;217;25;7;154;-26;2;44;;369;;661;;;;;;7;127;;;;;;;1;116;;;2;28;1;28;;31;cac;5;gta;7;caa;3;aag
260;5;2;260;120;248;26;11;127;-27;1;0;;387;;;;;;;;;;;;;;;;1;119;;;3;29;3;29;;23;caa;3;gac;18;aaa;6;aga
270;1;10;270;112;234;27;13;157;-28;0;11;;390;;16s CDS c;16s CDS x;CDS 23s c;CDS 23s x;;;;;;;;;;;1;476;;;1;30;4;30;;30;aaa;4;ttc;5;cta;4;gga
280;1;4;280;98;211;28;12;136;-29;0;38;;393;;2;228;531;;;;;;;;;;;;2;48;;;2;31;2;31;;26;cta;9;ggc;25;ggc;21;cca
290;1;3;290;97;215;29;10;121;-30;0;0;;402;;294;;563;;;;;;;;;;;;2;111;;;1;32;1;32;;5;gga;*;tgc;46;gga;5;aag
300;0;3;300;119;208;30;17;132;-31;0;7;;416;;695;;407;;;;;;;;;;;;2;112;;;1;33;2;33;;6;aga;hmo;;*;cga;5;aga
310;2;3;310;69;180;31;12;125;-32;3;26;;423;;;;;;;;;;;;;;;;2;140;;;1;34;0;34;;*;caa;7;ctc;9;tac;5;gga
320;3;2;320;101;153;32;9;108;-33;0;0;;423;;23s CDS c;23s CDS x;CDS 5s c;CDS 5s x;;;;;;;;;;;;;;;0;35;2;35;;7;atgj;18;acc;27;gta;3;ggc
330;1;7;330;100;162;33;11;91;-34;1;3;;424;;188;87;335;184;51;;53;;16;;33;;64;;34;;30;281;0;36;0;36;;4;gta;14;tgg;12;aca;22;cta
340;0;2;340;80;120;34;12;75;-35;0;13;;431;;223;109;;228;;;;;;;;;;;;;;;0;37;0;37;;10;gac;19;ggg;9;tac;4;aaa
350;2;2;350;57;131;35;12;95;-36;0;0;;437;;237;188;;301;;;;;;;;;;;;;;;0;38;0;38;;20;tgg;7;ggc;30;gta;4;caa
360;0;2;360;71;142;36;15;89;-37;0;4;;453;;299;260;;343;;;;;;;;;;;;;;;0;39;1;39;;*;aac;8;ttg;12;aca;5;cac
370;0;0;370;74;135;37;9;81;-38;1;12;;459;;313;;;;;;;;;;;;;;;;;;0;40;0;40;;;;x+ 293;gtg;*;tac;5;aag
380;0;2;380;63;126;38;14;74;-39;0;0;;488;;322;;;;;;;;;;;;;;;;;;0;41;0;41;;;;*;ccg;79;aaa;5;aga
390;2;2;390;54;120;39;13;81;-40;1;3;;501;;336;;;;;;;;;;;;;;;;;;2;42;0;42;;;;2;gaa;7;cac;5;gga
400;0;1;400;43;100;40;13;84;-41;0;5;;506;;357;;;;;;;;;;;;;;;;;;1;43;0;43;;;;6;ttc;35;aga;6;ggc
reste;20;27;reste;953;1896;reste;5407;13999;-42;0;0;;507;;463;;;;;;;;;;;;;;;;;;0;44;0;44;;;;4;tac;*;gga;*;cca
;94;205;total;5729;20790;total;5729;20790;-43;0;1;;525;;;;;;;;;;;;;;;;;;;;0;45;1;45;;;;18;caa;6;gac;39;tac
;;;diagr;;;diagr;;;-44;2;6;;542;;;;;;;;;;;;;;;;;;;;0;46;3;46;;;;4;aaa;14;gta;8;gta
;;; t30;;;;;;-45;0;0;;558;;;;;;;;;;;;;;;;;;;;1;47;0;47;;;;9;ggc;29;gaa;4;tac
;;;;;;;;;-46;1;2;;559;;12;5;4;4;25;;;;;;;;;;;;;;0;48;0;48;;;;*;cac;10;aca;*;aca
;;;Récapitulatif des effectifs;;;;;;-47;0;13;;565;;;;;;;;;;;;;;;;;;;;0;49;0;49;;;;;;6;gac;144;cgt
;;;>0;<0;zéro;total;*;;-48;0;0;;570;;;;;;;;;;;;;;;;;;;;1;50;0;50;;;;;;16;gta;23;agc
;;x;5726;67;3;5790;;;-49;0;1;;572;;;;;;;;;;;;;;;;;;;;13;;22;;;;;;;29;gaa;69;tca
;;c;20586;2475;204;23265;;;-50;0;19;;573;;;;;;;;;;;;931;;;;;;;503;300;;202;;;;;;;10;aca;*;tca
;;;;;;29055;1779;;reste;6;29;;585;;;;;;;;;;;;;;;;;;;;1;58;1;53;;;;;;6;gac;;
;;;;;;;30834;;total;;;;602;;;;;;;;;;;;;;;;;;;;2;60;1;56;;;;;;14;gta;;
;;;;;;;;;;;;;643;;;;;;;;;;;;;;;;;;;;2;61;3;57;;;;;;*;gaa;;
;;;;;;;;;;;;;652;;;;;;;;;;;;;;;;;;;;2;85;1;60;;;;;;;;;
;;;;;;;;;;;;;667;;;;;;;;;;;;;;;;;;;;1;88;1;62;;;;;;;;;
;;;;;;;;;;;;;703;;;;;;;;;;;;;;;;;;;;2;89;1;65;;;;;;;;;
;;;;;;;;;;;;;705;;;;;;;;;;;;;;;;;;;;1;91;1;69;;;;;;;;;
;;;;;;;;;;;;;709;;;;;;;;;;;;;;;;;;;;1;120;1;70;;;;;;;;;
;;;;;;;;;;;;;727;;;;;;;;;;;;;;;;;;;;1;311;1;75;;;;;;;;;
;;;;;;;;;;;;;753;;;;;;;;;;;;;;;;;;;;;;1;79;;;;;;;;;
;;;;;;;;;;;;;774;;;;;;;;;;;;;;;;;;;;;;1;84;;;;;;;;;
;;;;;;;;;;;;;776;;;;;;;;;;;;;;;;;;;;;;1;85;;;;;;;;;
;;;;;;;;;;;;;778;;;;;;;;;;;;;;;;;;;;;;1;144;;;;;;;;;
;;;;;;;;;;;;;780;;;;;;;;;;;;;;;;;;;;;;1;148;;;;;;;;;
;;;;;;;;;;;;;909;;;;;;;;;;;;;;;;;;;;;;1;149;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;187;;;;;;;;;
;;;;;;;;;;;;;67;13;28;11;2;1;122;;;;;;;;;;;;;;;;1;234;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;241;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;306;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;439;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;x;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;hmo;1;293;;;;;;;;;

clostridia distribution par génome[modifier | modifier le wikicode]

clos;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
psor;12;5;4;72;;7;;4;104
cdc;4;4;2;70;;3;;;83
cdc8;4;5;2;89;;4;;4;108
cbc*;36;10;;0;;0;;6;52
cbn;52;12;2;6;3;4;;7;86
cle;40;19;;26;3;9;;8;105
hmo;37;12;;39;;11;;10;109
cbei;63;11;3;0;;4;;12;93
;;;;;;;;;
total;248;78;13;302;6;42;0;51;740

clostridia distribution du total[modifier | modifier le wikicode]

clos8;;;;;;;628;;;;;;;;;57;;;;;;;;;55
atgi;10;tct;;tat;;atgf;22;;atgi;8;tct;;tat;;atgf;2;;atgi;;tct;;tat;;atgf;2
att;;act;;aat;;agt;1;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;3;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;19;tcc;7;tac;23;tgc;16;;ttc;6;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;;tgc;2
atc;3;acc;9;aac;22;agc;13;;atc;1;acc;1;aac;7;agc;1;;atc;11;acc;;aac;5;agc;
ctc;3;ccc;4;cac;16;cgt;11;;ctc;1;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;4;gcc;1;gac;32;ggc;20;;gtc;;gcc;;gac;1;ggc;4;;gtc;;gcc;5;gac;;ggc;
tta;22;tca;19;taa;;tga;3;;tta;4;tca;1;taa;;tga;;;tta;;tca;2;taa;;tga;
ata;1;aca;30;aaa;31;aga;24;;ata;;aca;;aaa;6;aga;1;;ata;;aca;3;aaa;;aga;
cta;19;cca;25;caa;22;cga;4;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;41;gca;;gaa;36;gga;29;;gta;;gca;5;gaa;2;gga;2;;gta;;gca;26;gaa;;gga;5
ttg;9;tcg;2;tag;;tgg;11;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;23;acg;4;aag;6;agg;6;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;6;ccg;2;cag;4;cgg;1;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;
gtg;1;gcg;1;gag;4;ggg;3;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos8;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos8;dupli;1aa;-5s;+5s;-16s;+16s;total
;248;78;13;302;6;42;740;;;;;;51;6;;57;;total;8;;13;;;42;55
;;;;;;;;;;;;;1-3aas;;;;;;;;;;;;

clostridia distribution par type[modifier | modifier le wikicode]

clos8;;;;;;;628;;clos8;1208;;;;;;78;;clos8;;;;;;;240;;clos8;;;;;;;8;;clos8;;;;;;;302
atgi;10;tct;0;tat;0;atgf;22;;atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;8;;atgi;;tct;;tat;;atgf;2;;atgi;9;tct;;tat;;atgf;11
att;0;act;0;aat;0;agt;1;;att;;act;;aat;;agt;1;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;3;cct;0;cat;0;cgc;0;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;19;tcc;7;tac;23;tgc;16;;ttc;1;tcc;6;tac;;tgc;1;;ttc;6;tcc;;tac;10;tgc;3;;ttc;;tcc;;tac;;tgc;2;;ttc;12;tcc;1;tac;13;tgc;10
atc;3;acc;9;aac;22;agc;13;;atc;;acc;3;aac;1;agc;3;;atc;;acc;3;aac;5;agc;5;;atc;;acc;;aac;;agc;;;atc;3;acc;3;aac;16;agc;5
ctc;3;ccc;4;cac;16;cgt;11;;ctc;2;ccc;1;cac;;cgt;1;;ctc;1;ccc;1;cac;8;cgt;3;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;2;cac;8;cgt;7
gtc;4;gcc;1;gac;32;ggc;20;;gtc;;gcc;1;gac;;ggc;;;gtc;2;gcc;;gac;15;ggc;11;;gtc;;gcc;;gac;;ggc;;;gtc;2;gcc;;gac;17;ggc;9
tta;22;tca;19;taa;0;tga;3;;tta;;tca;1;taa;;tga;3;;tta;11;tca;6;taa;;tga;;;tta;;tca;2;taa;;tga;;;tta;11;tca;10;taa;;tga;
ata;1;aca;30;aaa;31;aga;24;;ata;1;aca;2;aaa;;aga;;;ata;;aca;15;aaa;14;aga;10;;ata;;aca;;aaa;;aga;;;ata;;aca;13;aaa;17;aga;14
cta;19;cca;25;caa;22;cga;4;;cta;5;cca;4;caa;;cga;1;;cta;6;cca;10;caa;8;cga;3;;cta;;cca;;caa;;cga;;;cta;8;cca;11;caa;14;cga;
gta;41;gca;0;gaa;36;gga;29;;gta;;gca;;gaa;;gga;1;;gta;20;gca;;gaa;17;gga;13;;gta;;gca;;gaa;;gga;;;gta;21;gca;;gaa;19;gga;15
ttg;9;tcg;2;tag;0;tgg;11;;ttg;8;tcg;2;tag;;tgg;5;;ttg;1;tcg;;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;4
atgj;23;acg;4;aag;6;agg;6;;atgj;;acg;4;aag;1;agg;5;;atgj;10;acg;;aag;5;agg;1;;atgj;;acg;;aag;;agg;;;atgj;13;acg;;aag;;agg;
ctg;6;ccg;2;cag;4;cgg;1;;ctg;3;ccg;1;cag;3;cgg;;;ctg;1;ccg;;cag;1;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;2;ccg;1;cag;;cgg;
gtg;1;gcg;1;gag;4;ggg;3;;gtg;;gcg;1;gag;3;ggg;;;gtg;1;gcg;;gag;;ggg;3;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;1;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total
;248;78;13;302;6;42;740;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;;;;;*;;;

clostridia par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;clos8;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;31;19;2;6;2;5;65;
16;moyen;36;66;4;101;20;42;269;
14;fort;11;155;2;195;29;14;406;
; ;78;240;8;302;51;61;740;
10;g+cga;16;13;;2;;;31;
2;agg+cgg;5;2;;;1;;8;
4;carre ccc;4;4;;4;1;5;13;
5;autres;6;;2;;;;8;
;;31;19;2;6;2;5;65;
;total tRNAs  ‰ ;;;;;;;;
;clos8;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;42;26;3;8;3;7;88;26
16;moyen;49;89;5;136;27;57;364;324
14;fort;15;209;3;264;39;19;549;650
; ;105;324;11;408;69;82;740;729
10;g+cga;22;18;;3;;;42;10
2;agg+cgg;7;3;;;1;;11;
4;carre ccc;5;5;;5;1;7;18;16
5;autres;8;0;3;0;;;11;
;;42;26;3;8;3;7;88;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;clos8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;95;58;6;160;26;40;8;
16;moyen;110;202;12;325;324;46;28;
14;fort;34;475;6;515;650;14;65;
; ;239;736;25;326;729;78;240;
10;g+cga;49;40;;89;10;52;;
2;agg+cgg;15;6;;21;;16;;
4;carre ccc;12;12;;25;16;13;;
5;autres;18;;6;25;;19;;
;;95;58;6;160;;31;;

clostridia, estimation des -rRNAs[modifier | modifier le wikicode]

clostridia;;;;;;;;;;;;;;;;;;;;;;;;;
43 génomes total avec rRNA;;;;clos;total;ttt;tgt;;100 génomes total avec rRNA;;;;clos;total;ttt;tgt;;;;;;;;;
effectifs;sans +16s;;;43;856; ; ;;indices;;;;43;1991;;;;clos8;effectifs;;1aa+>1aa+dup;;;;326
atgi;29;tct;;tat;;atgf;30;;atgi;67;tct;;tat;;atgf;70;;atgi;1;tct;;tat;;atgf;11
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;1
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;3;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;44;tcc;1;tac;26;tgc;16;;ttc;102;tcc;2.3;tac;60;tgc;37;;ttc;7;tcc;6;tac;10;tgc;6
atc;72;acc;10;aac;64;agc;11;;atc;167;acc;23;aac;149;agc;26;;atc;;acc;6;aac;6;agc;8
ctc;2;ccc;3;cac;12;cgt;8;;ctc;4.7;ccc;7.0;cac;28;cgt;19;;ctc;3;ccc;2;cac;8;cgt;4
gtc;4;gcc;12;gac;40;ggc;23;;gtc;9.3;gcc;28;gac;93;ggc;53;;gtc;2;gcc;1;gac;15;ggc;11
tta;19;tca;13;taa;;tga;;;tta;44;tca;30;taa;;tga;;;tta;11;tca;9;taa;;tga;3
ata;;aca;29;aaa;48;aga;21;;ata;;aca;67;aaa;112;aga;49;;ata;1;aca;17;aaa;14;aga;10
cta;18;cca;17;caa;25;cga;1;;cta;42;cca;40;caa;58;cga;2.3;;cta;11;cca;14;caa;8;cga;4
gta;38;gca;92;gaa;45;gga;31;;gta;88;gca;214;gaa;105;gga;72;;gta;20;gca;;gaa;17;gga;14
ttg;;tcg;1;tag;;tgg;9;;ttg;;tcg;2.3;tag;;tgg;21;;ttg;9;tcg;2;tag;;tgg;7
atgj;18;acg;3;aag;2;agg;1;;atgj;42;acg;7.0;aag;4.7;agg;2.3;;atgj;10;acg;4;aag;6;agg;6
ctg;5;ccg;2;cag;1;cgg;3;;ctg;12;ccg;4.7;cag;2.3;cgg;7.0;;ctg;4;ccg;1;cag;4;cgg;1
gtg;1;gcg;;gag;4;ggg;2;;gtg;2.3;gcg;;gag;9.3;ggg;4.7;;gtg;1;gcg;1;gag;3;ggg;3
;;346;;468;;42;856;;;;805;;1088;;98;1991;;;;107;;168;;51;326
27.5.20 Tanger;;;;clos;total;ttt;tgt;;27.5.20 Tanger;;;;clos8;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;11144;4.0;0.6;;indices;sans +16s;;;174;11144;4.0;0.6;;clos8;indices;;1aa+>1aa+dup;;;;
atgi;92;tct;1.1;tat;;atgf;117;;atgi;159;tct;1.1;tat;;atgf;187;;atgi;13;tct;;tat;;atgf;138
att;1.1;act;;aat;;agt;0.6;;att;1.1;act;;aat;;agt;0.6;;att;;act;;aat;;agt;13
ctt;15.5;cct;2.3;cat;;cgc;;;ctt;15.5;cct;2.3;cat;;cgc;;;ctt;38;cct;;cat;;cgc;
gtt;0.6;gct;;gat;;ggt;;;gtt;0.6;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;104;tcc;101;tac;127;tgc;114;;ttc;206;tcc;103;tac;187;tgc;151;;ttc;88;tcc;75;tac;125;tgc;75
atc;-15;acc;79;aac;99;agc;107;;atc;152;acc;102;aac;248;agc;133;;atc;;acc;75;aac;75;agc;100
ctc;76;ccc;55;cac;112;cgt;97;;ctc;81;ccc;62;cac;140;cgt;116;;ctc;38;ccc;25;cac;100;cgt;50
gtc;44;gcc;33;gac;149;ggc;167;;gtc;53;gcc;61;gac;242;ggc;220;;gtc;25;gcc;13;gac;188;ggc;138
tta;128;tca;112;taa;1.1;tga;55;;tta;172;tca;142;taa;1.1;tga;55;;tta;138;tca;113;taa;;tga;38
ata;2.9;aca;151;aaa;159;aga;125;;ata;2.9;aca;218;aaa;271;aga;174;;ata;13;aca;213;aaa;175;aga;125
cta;106;cca;123;caa;98;cga;46;;cta;148;cca;163;caa;156;cga;48;;cta;138;cca;175;caa;100;cga;50
gta;198;gca;5;gaa;134;gga;171;;gta;286;gca;219;gaa;239;gga;243;;gta;250;gca;;gaa;213;gga;175
ttg;108;tcg;81;tag;2.3;tgg;99;;ttg;108;tcg;83;tag;2.3;tgg;120;;ttg;113;tcg;25;tag;;tgg;88
atgj;90;acg;70;aag;115;agg;94;;atgj;132;acg;77;aag;120;agg;96;;atgj;125;acg;50;aag;75;agg;75
ctg;64;ccg;59;cag;75;cgg;53;;ctg;76;ccg;64;cag;77;cgg;60;;ctg;50;ccg;13;cag;50;cgg;13
gtg;32;gcg;35;gag;74;ggg;65;;gtg;34;gcg;35;gag;83;ggg;70;;gtg;13;gcg;13;gag;38;ggg;38
;;1426;;1894;;1080;4400;;;;2231;;2982;;1177;6390;;;;1325;;2100;;638;4063
rapports;;64;;64;;92;69;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;clos8;indices;;1aa+>1aa+dup;;différence;;
atgi;58;tct;;tat;;atgf;63;;fiches;47.674;;;fréquences;;;;;atgi;86;tct;100;tat;;atgf;15
att;;act;;aat;;agt;;;total des aas sans rRNA;2050;;;0/0;;;;;att;100;act;;aat;;agt;95
ctt;100;cct;;cat;;cgc;;;avec;888;;;10;11;;;;ctt;59;cct;100;cat;;cgc;
gtt;;gct;;gat;;ggt;;;genom;43;;;20;6;;;;gtt;100;gct;;gat;;ggt;
ttc;50;tcc;98;tac;68;tgc;75;;;;;;30;10;;;;ttc;16;tcc;26;tac;1;tgc;34
atc;-10;acc;77;aac;40;agc;81;;clos8;40.75;;;40;5;;;;atc;100;acc;5;aac;24;agc;7
ctc;94;ccc;89;cac;80;cgt;84;;sans;326;;;50;4;36;;;ctc;51;ccc;55;cac;11;cgt;49
gtc;82;gcc;54;gac;62;ggc;76;;avec;752;;;60;3;;;;gtc;43;gcc;62;gac;21;ggc;17
tta;74;tca;79;taa;;tga;100;;genom;8;;;70;4;;;;tta;7;tca;1;taa;100;tga;32
ata;100;aca;69;aaa;59;aga;72;;;;;;80;3;;;;ata;77;aca;29;aaa;9;aga;0
cta;72;cca;75.7;caa;63;cga;95;;L’estimation par clos8;;;;90;1;;;;cta;23;cca;29;caa;2;cga;9
gta;69;gca;2;gaa;56;gga;70;;est  15 % en dessous;;;;100;2;;;;gta;21;gca;100;gaa;37;gga;2
ttg;100;tcg;97;tag;;tgg;83;;des aas sans;;;;;0;;;;ttg;4;tcg;69;tag;100;tgg;12
atgj;68;acg;91;aag;96;agg;98;;43;;100;;;49;;;;atgj;28;acg;29;aag;35;agg;20
ctg;85;ccg;93;cag;97;cgg;88;;atc;59;152;;;;;;;ctg;22;ccg;79;cag;33;cgg;76
gtg;93;gcg;100;gag;89;ggg;93;;gca;73;219;;;;;;;gtg;61;gcg;64;gag;49;ggg;43
;;;;;;;;;;;;;;;;;;;;265;;272;;944;1481

gamma[modifier | modifier le wikicode]

Shewanella[modifier | modifier le wikicode]

spl opérons[modifier | modifier le wikicode]

39.1%GC;30.6.19 Paris;16s  11;147;doubles;intercalaires
;Shewanella pealeana;;;;
;45136..46685;;16s;@1;339
;47025..49946;;23s;;112
;50059..50174;;5s;;
;;;;;
;51490..53039;;16s;;339
;53379..56298;;23s;;114
;56413..56528;;5s;;
;;;;;
;182271..183820;;16s;@2;71
;183892..183968;;atc;;65
;184034..184109;;gca;;364
;184474..187395;;23s;;112
;187508..187623;;5s;;100
;187724..187800;;gac;;
;;;;;
;191614..191689;;aca;;8
;191698..191782;;tac;;35
;191818..191891;;gga;;
;;;;;
;235182..236731;;16s;;374
;237106..240025;;23s;;114
;240140..240255;;5s;;
;;;;;
;243631..245180;;16s;;338
;245519..248440;;23s;;113
;248554..248669;;5s;;68
;248738..248813;;acc;;17
;248831..248946;;5s;;
;;;;;
;416766..416842;;cgg;;39
;416882..416957;;cac;;41
;416999..417075;;cca;+;58
;417134..417210;;cca;2 cca;
;;;;;
;493711..495260;;16s;;339
;495600..498519;;23s;;114
;498634..498749;;5s;;
;;;;;
;641376..641466;;tca;@3;1172
;642639..642729;;tca;;
;;;;;
;645847..647396;;16s;;71
;647468..647544;;atc;;65
;647610..647685;;gca;;329
;648015..650937;;23s;;156
;651094..651209;;5s;;
;;;;;
;728115..728199;;ttg;;
;;;;;
comp;1168942..1169018;;atgi;;
;;;;;
comp;1339706..1339781;;aca;+;52
comp;1339834..1339909;;ttc;2 ttc;539
comp;1340449..1340524;;aca;2 aca;52
comp;1340577..1340652;;ttc;;
;;;;;
comp;1342467..1342542;;aca;;52
comp;1342595..1342670;;ttc;;
;;;;;
;1456724..1456815;;agc;;21
;1456837..1456913;;cgt;+;30
;1456944..1457020;;cgt;7 cgt;32
;1457053..1457129;;cgt;3 agc;30
;1457160..1457236;;cgt;;33
;1457270..1457346;;cgt;;9
;1457356..1457447;;agc;;76
;1457524..1457600;;cgt;;35
;1457636..1457712;;cgt;;9
;1457722..1457813;;agc;;
;;;;;
comp;1627363..1627438;;agg;;
;;;;;
comp;1770483..1770558;;gta;+;37
comp;1770596..1770671;;gta;11 gta;37
comp;1770709..1770784;;gta;;37
comp;1770822..1770897;;gta;;37
comp;1770935..1771010;;gta;;37
comp;1771048..1771123;;gta;;37
comp;1771161..1771236;;gta;;37
comp;1771274..1771349;;gta;;37
comp;1771387..1771462;;gta;;37
comp;1771500..1771575;;gta;;39
comp;1771615..1771690;;gta;;
;;;;;
;1773910..1773985;;gcc;+;80
;1774066..1774141;;gaa;13 gaa;102
;1774244..1774319;;gaa;2 gcc;102
;1774422..1774497;;gaa;;102
;1774600..1774675;;gaa;;102
;1774778..1774853;;gaa;;102
;1774956..1775031;;gaa;;102
;1775134..1775209;;gaa;;102
;1775312..1775387;;gaa;;253
;1775641..1775716;;gaa;;102
;1775819..1775894;;gaa;;102
;1775997..1776072;;gaa;;102
;1776175..1776250;;gaa;;102
;1776353..1776428;;gaa;;47
;1776476..1776551;;gcc;;
;;;;;
;2081297..2082846;;16s;;338
;2083185..2086104;;23s;;114
;2086219..2086334;;5s;;
;;;;;
comp;2143274..2143350;;ccc;;
;;;;;
comp;2366164..2366240;;atgf;+;40
comp;2366281..2366357;;atgf;4 atgf;40
comp;2366398..2366474;;atgf;;40
comp;2366515..2366591;;atgf;;
;;;;;
;2376218..2376308;;tca;;
;;;;;
;2379767..2379842;;ggc;;13
;2379856..2379929;;tgc;;85
;2380015..2380100;;tta;;
;;;;;
;2550857..2550932;;ggc;;13
;2550946..2551019;;tgc;+;95
;2551115..2551200;;tta;3 tgc;634
;2551835..2551908;;tgc;3 tta;95
;2552004..2552089;;tta;;479
;2552569..2552642;;tgc;;132
;2552775..2552860;;tta;;
;;;;;
;2558019..2558109;;tca;;
;;;;;
comp;2717566..2717655;;tcc;;
;;;;;
comp;2759730..2759806;;atgf;+;189
comp;2759996..2760072;;atgf;4 atgf;45
comp;2760118..2760194;;gtc;2 gtc;2
comp;2760197..2760273;;atgf;;35
comp;2760309..2760385;;gtc;;13
comp;2760399..2760475;;atgf;;
;;;;;
;2858823..2858907;;tac;+;30
;2858938..2859022;;tac;5 tac;85
;2859108..2859192;;tac;;107
;2859300..2859384;;tac;;107
;2859492..2859576;;tac;;
;;;;;
;2866268..2866343;;aac;+;45
;2866389..2866464;;aac;7aac;41
;2866506..2866581;;aac;;26
;2866608..2866683;;aac;;32
;2866716..2866791;;aac;;33
;2866825..2866900;;aac;;40
;2866941..2867016;;aac;;
;;;;;
comp;2929429..2929505;;gac;+;97
comp;2929603..2929679;;gac;4 gac;97
comp;2929777..2929853;;gac;;83
comp;2929937..2930013;;gac;;
;;;;;
comp;3120289..3120364;;aaa;+;58
comp;3120423..3120498;;aaa;12 aaa;58
comp;3120557..3120632;;aaa;;58
comp;3120691..3120766;;aaa;;59
comp;3120826..3120901;;aaa;;57
comp;3120959..3121034;;aaa;;58
comp;3121093..3121168;;aaa;;58
comp;3121227..3121302;;aaa;;59
comp;3121362..3121437;;aaa;;58
comp;3121496..3121571;;aaa;;59
comp;3121631..3121706;;aaa;;59
comp;3121766..3121841;;aaa;;
;;;;;
comp;3269860..3269935;;cac;;8
comp;3269944..3270020;;aga;;63
comp;3270084..3270160;;cca;;
;;;;;
comp;3757983..3758059;;atgf;;
comp;3758163..3758249;;ctc;;
;;;;;
comp;3835257..3835331;;caa;+;51
comp;3835383..3835467;;cta;5 caa;131
comp;3835599..3835673;;caa;5 cta;20
comp;3835694..3835778;;cta;3 atg;96
comp;3835875..3835949;;caa;;49
comp;3835999..3836083;;cta;;211
comp;3836295..3836371;;atg;;5
comp;3836377..3836451;;caa;;47
comp;3836499..3836583;;cta;;55
comp;3836639..3836715;;atg;;5
comp;3836721..3836795;;caa;;47
comp;3836843..3836927;;cta;;55
comp;3836983..3837059;;atg;;
;;;;;
comp;3862885..3862961;;tgg;+;167
comp;3863129..3863205;;tgg;2 tgg;
;;;;;
comp;3867049..3867164;;5s;;114
comp;3867279..3870198;;23s;;338
comp;3870537..3872086;;16s;;
;;;;;
;3882154..3882229;;ttc;;
;;;;;
comp;4331488..4331563;;ggc;+;130
comp;4331694..4331769;;ggc;6 ggc;47
comp;4331817..4331892;;ggc;;162
comp;4332055..4332130;;ggc;;16
comp;4332147..4332222;;ggc;;48
comp;4332271..4332346;;ggc;;
;;;;;
comp;4616881..4616996;;5s;;112
comp;4617109..4620030;;23s;;364
comp;4620395..4620470;;gca;;65
comp;4620536..4620612;;atc;;71
comp;4620684..4622233;;16s;;
;;;;;
comp;5129770..5129846;;gac;;100
comp;5129947..5130062;;5s;;115
comp;5130178..5133097;;23s; ;339
comp;5133437..5134986;;16s;;

spl cumuls[modifier | modifier le wikicode]

spl cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;0;;1;;1;;100;
;16 23 5s 0;6;20;12;;50;;20;;200;
;16 atc gca;3;40;27;;100;;40;;300;
;16 23 5s a;2;60;28;;150;;60;;400;
;max a;3;80;3;;200;;80;;500;
;a doubles;0;100;8;;250;;100;;600;
;spéciaux;0;120;13;;300;;120;;700;
;total aas;9;140;3;;350;;140;;800;
sans ;opérons;29;160;0;;400;;160;;900;
;1 aa;8;180;2;;450;;180;;1000;
;max a;15;200;1;;500;;200;;1100;
;a doubles;15;;6;;;;;;;
;total aas;133;;103;;;0;;0;;0
total aas;;142;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;88;;;;;;;
;;;variance;143;;;;;;;
sans jaune;;;moyenne;58;;;;;;;
;;;variance;35;;;;;;;

spl blocs[modifier | modifier le wikicode]

spl blocs;;;;;;;
16s;339;339;374;339;338;338;
23s;112;114;114;114;114;114;
5s;;;;;;;
;;;;;;;
16s;71;71;71;16s;338;16s;339
atc;65;65;65;23s;113;23s;115
gca;364;329;364;5s;68;5s;100
23s;112;156;112;acc;17;gac;
5s;100;;;5s;;;
gac;;;;;;;

spl distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;6;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;1-3 aas;att;;act;;aat;;agt;;spl;att;;act;;aat;;agt;;spl;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;après 5s;ctt;;cct;;cat;;cgc;;gta11;ctt;;cct;;cat;;cgc;;gta11;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;acc;gtt;;gct;;gat;;ggt;;tca2;gtt;;gct;;gat;;ggt;;tca2;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;;2 gac;ttc;3;tcc;;tac;;tgc;4;cca2;ttc;;tcc;;tac;5;tgc;;cca2;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;3;tac5;atc;;acc;;aac;7;agc;;tac5;atc;;acc;1;aac;;agc;
ctc;;ccc;1;cac;;cgt;;;ctc;1;ccc;;cac;2;cgt;;aac7;ctc;;ccc;;cac;;cgt;7;aac7;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;séquences;gtc;2;gcc;2;gac;;ggc;;gac4 ;gtc;;gcc;;gac;4;ggc;8;gac4 ;gtc;;gcc;;gac;2;ggc;
tta;;tca;2;taa;;tga;;(aca ttc)2;tta;4;tca;;taa;;tga;;aaa12;tta;;tca;2;taa;;tga;;aaa12;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;(tgc tta)3;ata;;aca;4;aaa;;aga;1;gaa13;ata;;aca;;aaa;12;aga;;gaa13;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;(atf gtc)2;cta;5;cca;1;caa;5;cga;;atgf4+2;cta;;cca;2;caa;;cga;;atgf4+2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;(caa cta atgj)3 ;gta;;gca;;gaa;;gga;1;cgt5+2;gta;11;gca;;gaa;13;gga;;cgt5+2;gta;;gca;;gaa;;gga;
ttg;1;tcg;;tag;;tgg;;ou;ttg;;tcg;;tag;;tgg;;ggc8;ttg;;tcg;;tag;;tgg;2;ggc8;ttg;;tcg;;tag;;tgg;
atgj;;acg;;aag;;agg;1;(caa cta)5;atgj;3;acg;;aag;;agg;;tgg2;atgj;;acg;;aag;;agg;;tgg2;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
spl;;8;;;;;8;;spl;46;;;;;;46;;spl;79;;;;;;79;;spl;;;;3;;;3

spl données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: spl données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA tRNA;;tRNA tRNA;;CDS-CDS;;400-700;reste;Sup 700
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;aa;intercalaire;aa;intercalaire;aa;frequence;effectif;;long;long
fxt;fct;spl;fx;fc;spl;fx40;fc40;spl;x-;c-;c;x;c;x;c;;c;;c;;spl;fx;fc;fx;fc
1;0;0;1;17;0;1;17;-1;;126;606;234;CDS 16s ;;16s 23s;;tRNA tRNA;hors bloc;tRNA tRNA;suite;400;1075;2229;706;703
;0;10;8;284;1;0;46;-2;2;0;195;236;647;614;4* 349;;8;aca;45;aac;410;18;14;707;706
;0;20;19;193;2;0;53;-3;;0;155;320;988;687;384;;35;tac;41;aac;420;17;14;712;706
;0;30;13;120;3;1;29;-4;5;136;789;-23;876;1908;3* 348;;**;gga;26;aac;430;9;15;712;709
1;0;40;29;86;4;0;22;-5;;0;695;286;206;1178;23s 5s;;39;cgg;32;aac;440;11;9;721;712
;0;50;17;74;5;1;16;-6;;0;220;330;611;807;8* 132;;41;cac;33;aac;450;8;12;734;715
;0;60;39;80;6;2;13;-7;;10;441;117;5s CDS;;2* 133;;58;cca;40;aac;460;9;11;738;717
;0;70;50;72;7;2;14;-8;2;46;913;500;703;339;177;;**;cca;**;aac;470;12;7;739;717
;0;80;68;100;8;1;29;-9;;0;1058;545;727;454;16s tRNA;;1172;tca;97;gac;480;6;6;745;729
;1;90;53;92;9;1;29;-10;;8;581;34;;768;3* 74;atc;**;tca;97;gac;490;4;8;746;731
1;0;100;56;90;10;0;33;-11;;28;176;705;;304;tRNA 23s;;52;aca;83;gac;500;11;8;768;735
;1;110;38;64;11;2;27;-12;;0;257;977;;454;371;gca;539;ttc;**;gac;510;8;5;774;740
1;2;120;54;73;12;1;35;-13;;5;104;136;;798;336;gca;52;aca;58;aaa;520;8;6;780;740
;1;130;44;84;13;3;20;-14;;15;134;383;5s 16s;;371;gca;**;ttc;58;aaa;530;6;6;784;744
1;1;140;26;56;14;1;29;-15;1;0;455;254;1319;;5s tRNA;;52;aca;58;aaa;540;8;4;784;746
;0;150;27;51;15;5;15;-16;;3;216;545;;;100;gac;**;ttc;59;aaa;550;4;5;798;759
;4;160;30;52;16;0;10;-17;1;8;152;184;;;68;acc;21;agc;57;aaa;560;4;7;807;763
;1;170;31;49;17;3;13;-18;;0;530;98;;;100;gac;30;cgt;58;aaa;570;9;6;814;765
;3;180;36;53;18;2;20;-19;;1;595;291;;;tRNA 5s;;32;cgt;58;aaa;580;1;6;830;775
2;1;190;24;43;19;1;14;-20;;7;89;1011;;;17;acc;30;cgt;59;aaa;590;3;4;844;781
;3;200;34;36;20;1;10;-21;;0;178;465;;;tRNA tRNA;intra;33;cgt;58;aaa;600;5;2;865;789
;0;210;24;37;21;2;12;-22;;0;192;289;;;3* 65;atc gca;9;cgt;59;aaa;610;0;5;884;791
;2;220;25;39;22;1;12;-23;;4;353;187;;;;;76;agc;59;aaa;620;2;8;885;793
;0;230;25;33;23;0;13;-24;;0;315;;;;;;35;cgt;**;aaa;630;4;3;897;795
2;0;240;27;32;24;4;19;-25;;0;187;;;;;;9;cgt;8;cac;640;2;4;904;801
;0;250;23;25;25;3;3;-26;;2;572;;;;;;**;agc;63;aga;650;2;4;909;814
1;2;260;22;30;26;0;9;-27;;0;124;;;;;;9* 37;gta;**;cca;660;2;4;912;817
;0;270;23;31;27;2;21;-28;;1;830;;;;;;39;gta;103;atgf;670;3;4;915;832
;0;280;24;23;28;0;9;-29;;2;193;;;;;;**;gta;**;ctc;680;2;4;944;833
2;0;290;27;29;29;1;11;-30;;0;255;;CDS-CDS;inf 50;;;80;gcc;51;caa;690;2;1;946;836
1;0;300;21;23;30;0;11;-31;;0;157;;intercalaire;;;;11* 102;gaa;131;cta;700;2;3;959;850
;0;310;18;18;31;3;17;-32;;3;114;;c-;x-;;;253;gaa;20;caa;;48;58;968;857
1;1;320;16;19;32;4;9;-33;;0;162;;-98;-52;;;47;gaa;96;cta;;;;975;861
1;0;330;11;18;33;3;8;-34;;1;495;;-77;;;;**;gcc;49;caa;;;;1007;862
;0;340;16;20;34;5;9;-35;;0;180;;-56;;;;3* 40;atgf;211;cta;;;;1009;866
;0;350;13;17;35;2;8;-36;;0;160;;-53;;;;**;atgf;5;atgj;;;;1016;874
;1;360;14;16;36;1;6;-37;;0;663;;-53;;;;13;ggc;47;caa;;;;1046;877
;0;370;15;22;37;4;6;-38;;1;113;;total;intercalaires;;;85;tgc;55;cta;;;;1103;887
;0;380;10;9;38;5;10;-39;;0;427;;;789,212;;;**;tta;5;atgj;;;;1140;926
1;0;390;14;10;39;1;7;-40;;0;;;ADN long;5,174,581;;;13;ggc;47;caa;;;;1141;933
;0;400;10;9;40;1;6;-41;;1;;;%;15.3;;;95;tgc;55;cta;;;;1157;936
7;15;reste;230;253;reste;1235;1782;-42;;0;;;;;;;634;tta;**;atgj;;;;1166;937
23;39;total;1305;2482;total;1305;2482;-43;;1;;;non RNA;32;;;95;tgc;167;tgg;;;;1221;944
15;24;diagr;1074;2212;diagr;69;683;-44;;0;;;;;;;479;tta;**;tgg;;;;1329;957
0;0; t30;40;597;;;;-45;;0;;;;;;;132;tgc;20;ggc;;;;1401;959
;;;;;;;;-46;;0;;;;;;;**;tta;13;ggt;;;;1593;1016
;;Récapitulatif des effectifs;;;;;;-47;;0;;;;;;;128;cat;47;ggc;;;;1722;1150
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;128;cat;47;ggc;;;;1942;1154
;x;1304;12;1;1317;;;-49;;0;;;;;;;189;atgf;15;ggt;;;;;1161
;c;2465;414;17;2896;;;-50;;0;;;;;;;45;atgf;16;ggc;;;;;1178
;;;;;4213;253;;reste;1;5;;;;;;;2;gtc;48;ggc;;;;;1225
;;;;;;4466;;total;12;414;;;;;;;35;atgf;**;ggc;;;;;1254
;;;;;;;;;;;;;;;;;13;gtc;;;;;;;1318
;;;;;;;;;;;;;;;;;**;atgf;;;;;;;1331
;;;;;;;;;;;;;;;;;30;tac;;;;;;;1489
;;;;;;;;;;;;;;;;;85;tac;;;;;;;1674
;;;;;;;;;;;;;;;;;107;tac;;;;;;;2727
;;;;;;;;;;;;;;;;;107;tac;;;;;;;3180
;;;;;;;;;;;;;;;;;**;tac;;;;;;;

spl autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: spl autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;spl;;;;;
deb fin;comp;gene;adress1;adresse2;intercalaire;autre;aas
deb;comp;CDS;43968;44525;614;*;
;;rRNA;45140;46682;349;*;16s
;;rRNA;47032;49926;132;*;23s
;;rRNA;50059;50174;1319;*;5s
;;rRNA;51494;53036;349;*;16s
;;rRNA;53386;56280;132;*;23s
;;rRNA;56413;56528;339;*;5s
fin;comp;CDS;56868;57011;;;
deb;comp;CDS;146328;146498;-16;*;
;comp;regulatory;146483;146744;188;*;
fin;;CDS;146933;149083;;;
deb;comp;CDS;181132;181587;687;*;
;;rRNA;182275;183817;74;*;16s
;;tRNA;183892;183968;65;*;atc
;;tRNA;184034;184109;371;*;gca
;;rRNA;184481;187375;132;*;23s
;;rRNA;187508;187623;100;*;5s
;;tRNA;187724;187800;606;*;gac
fin;;CDS;188407;189432;;;
deb;comp;CDS;190429;191379;234;*;
;;tRNA;191614;191689;8;*;aca
;;tRNA;191698;191782;35;*;tac
;;tRNA;191818;191891;195;*;gga
fin;;CDS;192087;193271;;;
deb;;CDS;233942;234538;647;*;
;;rRNA;235186;236728;384;*;16s
;;rRNA;237113;240007;132;*;23s
;;rRNA;240140;240255;454;*;5s
deb;comp;CDS;240710;241726;1908;*;
;;rRNA;243635;245177;348;*;16s
;;rRNA;245526;248420;133;*;23s
;;rRNA;248554;248669;68;*;5s
;;tRNA;248738;248813;17;*;acc
;;rRNA;248831;248946;703;*;5s
fin;;CDS;249650;250924;;0;
deb;;CDS;282426;283268;135;*;
;;ncRNA;283404;283755;313;*;
fin;comp;CDS;284069;285322;;;
deb;comp;CDS;413908;416529;236;*;
;;tRNA;416766;416842;39;*;cgg
;;tRNA;416882;416957;41;*;cac
;;tRNA;416999;417075;58;*;cca
;;tRNA;417134;417210;320;*;cca
fin;comp;CDS;417531;419450;;;
deb;comp;CDS;492003;492536;1178;*;
;;rRNA;493715;495257;349;*;16s
;;rRNA;495607;498501;132;*;23s
;;rRNA;498634;498749;768;*;5s
fin;comp;CDS;499518;500534;;;
deb;;CDS;550745;552652;-23;*;
;comp;tRNA;552630;552724;286;*;tga
fin;;CDS;553011;553874;;;
deb;;CDS;640018;641220;155;*;
;;tRNA;641376;641466;1172;*;tca
;;tRNA;642639;642729;789;*;tca
deb;;CDS;643519;644862;988;*;
;;rRNA;645851;647393;74;*;16s
;;tRNA;647468;647544;65;*;atc
;;tRNA;647610;647685;336;*;gca
;;rRNA;648022;650916;177;*;23s
;;rRNA;651094;651209;727;*;5s
fin;;CDS;651937;653757;;0;
deb;comp;CDS;727650;727784;330;*;
;;tRNA;728115;728199;695;*;ttg
fin;;CDS;728895;730808;;0;
deb;;CDS;878528;879232;406;*;
;;regulatory;879639;879784;204;*;
fin;;CDS;879989;881359;;;
deb;;CDS;1166653;1168824;117;*;
;comp;tRNA;1168942;1169018;220;*;atgi
fin;comp;CDS;1169239;1171089;;;
deb;;CDS;1284512;1284730;-193;*;
;comp;misc_f;1284538;1284656;121;*;
fin;comp;CDS;1284778;1285140;;0;
deb;;CDS;1337892;1339205;500;*;
;comp;tRNA;1339706;1339781;52;*;aca
;comp;tRNA;1339834;1339909;539;*;ttc
;comp;tRNA;1340449;1340524;52;*;aca
;comp;tRNA;1340577;1340652;545;*;ttc
deb;;CDS;1341198;1342432;34;*;
;comp;tRNA;1342467;1342542;52;*;aca
;comp;tRNA;1342595;1342670;441;*;ttc
fin;comp;CDS;1343112;1343390;;;
deb;;CDS;1455613;1455810;913;*;
;;tRNA;1456724;1456815;21;*;agc
;;tRNA;1456837;1456913;30;*;cgt
;;tRNA;1456944;1457020;32;*;cgt
;;tRNA;1457053;1457129;30;*;cgt
;;tRNA;1457160;1457236;33;*;cgt
;;tRNA;1457270;1457346;9;*;cgt
;;tRNA;1457356;1457447;76;*;agc
;;tRNA;1457524;1457600;35;*;cgt
;;tRNA;1457636;1457712;9;*;cgt
;;tRNA;1457722;1457813;1058;*;agc
fin;;CDS;1458872;1459117;;;
deb;comp;CDS;1564741;1565973;165;*;
;comp;tmRNA;1566139;1566494;110;*;
fin;comp;CDS;1566605;1567099;;0;
deb;comp;CDS;1625951;1626781;581;*;
;comp;tRNA;1627363;1627438;176;*;agg
fin;comp;CDS;1627615;1628784;;0;
deb;comp;CDS;1769998;1770225;257;*;
;comp;tRNA;1770483;1770558;37;*;gta
;comp;tRNA;1770596;1770671;37;*;gta
;comp;tRNA;1770709;1770784;37;*;gta
;comp;tRNA;1770822;1770897;37;*;gta
;comp;tRNA;1770935;1771010;37;*;gta
;comp;tRNA;1771048;1771123;37;*;gta
;comp;tRNA;1771161;1771236;37;*;gta
;comp;tRNA;1771274;1771349;37;*;gta
;comp;tRNA;1771387;1771462;37;*;gta
;comp;tRNA;1771500;1771575;39;*;gta
;comp;tRNA;1771615;1771690;705;*;gta
deb;;CDS;1772396;1773805;104;*;
;;tRNA;1773910;1773985;80;*;gcc
;;tRNA;1774066;1774141;102;*;gaa
;;tRNA;1774244;1774319;102;*;gaa
;;tRNA;1774422;1774497;102;*;gaa
;;tRNA;1774600;1774675;102;*;gaa
;;tRNA;1774778;1774853;102;*;gaa
;;tRNA;1774956;1775031;102;*;gaa
;;tRNA;1775134;1775209;102;*;gaa
;;tRNA;1775312;1775387;253;*;gaa
;;tRNA;1775641;1775716;102;*;gaa
;;tRNA;1775819;1775894;102;*;gaa
;;tRNA;1775997;1776072;102;*;gaa
;;tRNA;1776175;1776250;102;*;gaa
;;tRNA;1776353;1776428;47;*;gaa
;;tRNA;1776476;1776551;977;*;gcc
fin;comp;CDS;1777529;1779358;;0;
deb;comp;CDS;1928606;1930189;113;*;
;comp;misc_f;1930303;1930412;474;*;
fin;;CDS;1930887;1931621;;;
deb;;CDS;2079870;2080424;876;*;
;;rRNA;2081301;2082843;348;*;16s
;;rRNA;2083192;2086086;132;*;23s
;;rRNA;2086219;2086334;304;*;5s
fin;comp;CDS;2086639;2087564;;;
deb;;CDS;2142913;2143137;136;*;
;comp;tRNA;2143274;2143350;134;*;ccc
fin;comp;CDS;2143485;2145269;;;
deb;;CDS;2225993;2226382;125;*;
;;regulatory;2226508;2226638;52;*;
fin;;CDS;2226691;2228829;;;
deb;comp;CDS;2365103;2365708;455;*;
;comp;tRNA;2366164;2366240;40;*;atgf
;comp;tRNA;2366281;2366357;40;*;atgf
;comp;tRNA;2366398;2366474;40;*;atgf
;comp;tRNA;2366515;2366591;383;*;atgf
fin;;CDS;2366975;2369110;;;
deb;comp;CDS;2374251;2375963;254;*;
;;tRNA;2376218;2376308;216;*;tca
fin;;CDS;2376525;2377169;;;
deb;;CDS;2379066;2379614;152;*;
;;tRNA;2379767;2379842;13;*;ggc
;;tRNA;2379856;2379929;85;*;tgc
;;tRNA;2380015;2380100;530;*;tta
fin;;CDS;2380631;2381200;;;
deb;;CDS;2548825;2550261;595;*;
;;tRNA;2550857;2550932;13;*;ggc
;;tRNA;2550946;2551019;95;*;tgc
;;tRNA;2551115;2551200;634;*;tta
;;tRNA;2551835;2551908;95;*;tgc
;;tRNA;2552004;2552089;479;*;tta
;;tRNA;2552569;2552642;132;*;tgc
;;tRNA;2552775;2552860;545;*;tta
fin;comp;CDS;2553406;2553735;;;
deb;;CDS;2556685;2557929;89;*;
;;tRNA;2558019;2558109;184;*;tca
fin;comp;CDS;2558294;2559073;;;
deb;;CDS;2716829;2717467;98;*;
;comp;tRNA;2717566;2717655;178;*;tcc
fin;comp;CDS;2717834;2719828;;;
deb;comp;CDS;2758794;2759069;192;*;
;comp;tRNA;2759262;2759367;128;*;cat
;comp;tRNA;2759496;2759601;128;*;cat
;comp;tRNA;2759730;2759806;189;*;atgf
;comp;tRNA;2759996;2760072;45;*;atgf
;comp;tRNA;2760118;2760194;2;*;gtc
;comp;tRNA;2760197;2760273;35;*;atgf
;comp;tRNA;2760309;2760385;13;*;gtc
;comp;tRNA;2760399;2760475;353;*;atgf
fin;comp;CDS;2760829;2762043;;;
deb;comp;CDS;2858049;2858531;291;*;
;;tRNA;2858823;2858907;30;*;tac
;;tRNA;2858938;2859022;85;*;tac
;;tRNA;2859108;2859192;107;*;tac
;;tRNA;2859300;2859384;107;*;tac
;;tRNA;2859492;2859576;315;*;tac
fin;;CDS;2859892;2860968;;0;
deb;comp;CDS;2863253;2865256;1011;*;
;;tRNA;2866268;2866343;45;*;aac
;;tRNA;2866389;2866464;41;*;aac
;;tRNA;2866506;2866581;26;*;aac
;;tRNA;2866608;2866683;32;*;aac
;;tRNA;2866716;2866791;33;*;aac
;;tRNA;2866825;2866900;40;*;aac
;;tRNA;2866941;2867016;187;*;aac
fin;;CDS;2867204;2869120;;;
deb;comp;CDS;2904901;2906862;188;*;
;comp;regulatory;2907051;2907149;230;*;
fin;comp;CDS;2907380;2908291;;0;
deb;comp;CDS;2926979;2928856;572;*;
;comp;tRNA;2929429;2929505;97;*;gac
;comp;tRNA;2929603;2929679;97;*;gac
;comp;tRNA;2929777;2929853;83;*;gac
;comp;tRNA;2929937;2930013;124;*;gac
fin;comp;CDS;2930138;2931472;;;
deb;comp;CDS;3118298;3119458;830;*;
;comp;tRNA;3120289;3120364;58;*;aaa
;comp;tRNA;3120423;3120498;58;*;aaa
;comp;tRNA;3120557;3120632;58;*;aaa
;comp;tRNA;3120691;3120766;59;*;aaa
;comp;tRNA;3120826;3120901;57;*;aaa
;comp;tRNA;3120959;3121034;58;*;aaa
;comp;tRNA;3121093;3121168;58;*;aaa
;comp;tRNA;3121227;3121302;59;*;aaa
;comp;tRNA;3121362;3121437;58;*;aaa
;comp;tRNA;3121496;3121571;59;*;aaa
;comp;tRNA;3121631;3121706;59;*;aaa
;comp;tRNA;3121766;3121841;193;*;aaa
fin;comp;CDS;3122035;3122760;;;
deb;;CDS;3243130;3243747;634;*;
;comp;ncRNA;3244382;3244478;176;*;
fin;comp;CDS;3244655;3244972;;0;
deb;comp;CDS;3268300;3269604;255;*;
;comp;tRNA;3269860;3269935;8;*;cac
;comp;tRNA;3269944;3270020;63;*;aga
;comp;tRNA;3270084;3270160;465;*;cca
fin;;CDS;3270626;3271480;;0;
deb;comp;CDS;3757370;3757825;157;*;
;comp;tRNA;3757983;3758059;103;*;atgf
;comp;tRNA;3758163;3758249;114;*;ctc
fin;comp;CDS;3758364;3758699;;;
deb;comp;CDS;3834636;3835094;162;*;
;comp;tRNA;3835257;3835331;51;*;caa
;comp;tRNA;3835383;3835467;131;*;cta
;comp;tRNA;3835599;3835673;20;*;caa
;comp;tRNA;3835694;3835778;96;*;cta
;comp;tRNA;3835875;3835949;49;*;caa
;comp;tRNA;3835999;3836083;211;*;cta
;comp;tRNA;3836295;3836371;5;*;atgj
;comp;tRNA;3836377;3836451;47;*;caa
;comp;tRNA;3836499;3836583;55;*;cta
;comp;tRNA;3836639;3836715;5;*;atgj
;comp;tRNA;3836721;3836795;47;*;caa
;comp;tRNA;3836843;3836927;55;*;cta
;comp;tRNA;3836983;3837059;495;*;atgj
fin;comp;CDS;3837555;3838646;;;
deb;comp;CDS;3862357;3862704;180;*;
;comp;tRNA;3862885;3862961;167;*;tgg
;comp;tRNA;3863129;3863205;160;*;tgg
fin;comp;CDS;3863366;3864334;;;
deb;;CDS;3865578;3866594;454;*;
;comp;rRNA;3867049;3867164;132;*;5s
;comp;rRNA;3867297;3870191;348;*;23s
;comp;rRNA;3870540;3872082;807;*;16s
fin;;CDS;3872890;3873405;;0;
deb;comp;CDS;3879732;3881864;289;*;
;;tRNA;3882154;3882229;187;*;ttc
fin;comp;CDS;3882417;3884279;;0;
deb;comp;CDS;3930329;3932182;122;*;
;comp;regulatory;3932305;3932527;233;*;
fin;comp;CDS;3932761;3933408;;0;
deb;;CDS;4051244;4051564;82;*;
;;ncRNA;4051647;4051828;251;*;
fin;comp;CDS;4052080;4052250;;;
deb;comp;CDS;4130284;4131048;211;*;
;comp;regulatory;4131260;4131412;506;*;
fin;comp;CDS;4131919;4132536;;0;
deb;;CDS;4146436;4146708;183;*;
;;regulatory;4146892;4146991;94;*;
fin;;CDS;4147086;4148081;;0;
deb;comp;CDS;4330369;4330824;663;*;
;comp;tRNA;4331488;4331563;20;*;ggc
;comp;tRNA;4331584;4331680;13;*;ggt
;comp;tRNA;4331694;4331769;47;*;ggc
;comp;tRNA;4331817;4331892;47;*;ggc
;comp;tRNA;4331940;4332039;15;*;ggt
;comp;tRNA;4332055;4332130;16;*;ggc
;comp;tRNA;4332147;4332222;48;*;ggc
;comp;tRNA;4332271;4332346;113;*;ggc
fin;comp;CDS;4332460;4333005;;0;
deb;comp;CDS;4446808;4448991;66;*;
;comp;regulatory;4449058;4449140;441;*;
fin;;CDS;4449582;4449893;;;
deb;comp;CDS;4452358;4453668;212;*;
;;regulatory;4453881;4453980;104;*;
fin;;CDS;4454085;4455455;;0;
deb;;CDS;4615072;4616082;798;*;
;comp;rRNA;4616881;4616996;132;*;5s
;comp;rRNA;4617129;4620023;371;*;23s
;comp;tRNA;4620395;4620470;65;*;gca
;comp;tRNA;4620536;4620612;74;*;atc
;comp;rRNA;4620687;4622229;206;*;16s
fin;comp;CDS;4622436;4623133;;;
deb;comp;CDS;5003438;5004418;-13;*;
;comp;regulatory;5004406;5004542;257;*;
fin;;CDS;5004800;5006449;;0;
deb;comp;CDS;5129088;5129342;427;*;
;comp;tRNA;5129770;5129846;100;*;gac
;comp;rRNA;5129947;5130062;133;*;5s
;comp;rRNA;5130196;5133090;349;*;23s
;comp;rRNA;5133440;5134982;611;*;16s
fin;comp;CDS;5135594;5137015;;0;

Intergen51. spl. Les différents types d'intercalaires[modifier | modifier le wikicode]

Les types d’intercalaires;;spl;;;;;;
intercalaires CDS-CDS;;;;;;* autres intercalaires;;
continu;S+;S-;S0;total;c/x;RNA-RNA;CDS-rRNA;total
c;2 482;414;17;2 913;2,2;141;7;148
x;1 305;12;1;1 318;;0;11;11
t;3 787;426;18;4 231;;141;18;159
%;89,5;10,1;0,0;;;;;
Détail des * autres intercalaires;;;;;;;;
intercalaires tRNA-CDS;;;;;;récapitulatif des * autres intercalaires;;
continu;R+;R-;R0;total;c/x;* autres;total;%
c;39;0;0;39;1,7;tRNA-CDS;62;25
x;22;1;0;23;;RNA-RNA;141;56
t;61;1;0;62;;CDS-rRNA;18;7
%;98,4;1,6;0,0;;;non RNA;32;13
-;;;;;;total;253;10
Les taux remarquables;;;;;;;;
taux;%reste;;;%t30;;%t5;%0;
gamme;400;400;6-50;-;-;-;-;-
type;S+;R+;S-;S+;R+;S-;S+;R+
c;10,2;38,5;1,2;24,1;0,0;63;0,6;0,0
x;17,6;30,4;8,3;3,1;0,0;58;0,1;0,0

Intergen51. spl. Les intercalaires tRNA-tRNA extra bloc[modifier | modifier le wikicode]

;;;correl;;;;;
;308;264;0,794;;;;;
CDS-CDS;;% total;publié;26/11/22;;;;
frequence;;;effectif;;;;;
spl;fx%;fc%;fx;fc;spl;fc40;;tRNA h spl
0;1;7;1;17;0;17;5;3
10;6;114;8;284;1;46;10;4
20;15;78;19;193;2;53;15;5
30;10;48;13;120;3;29;20;3
40;22;35;29;86;4;22;25;1
50;13;30;17;74;5;16;30;4
60;30;32;39;80;6;13;35;7
70;38;29;50;72;7;14;40;15
80;52;40;68;100;8;29;45;4
90;41;37;53;92;9;29;50;7
100;43;36;56;90;10;33;55;6
110;29;26;38;64;11;27;60;12
120;41;29;54;73;12;35;65;1
130;34;34;44;84;13;20;70;0
140;20;23;26;56;14;29;75;0
150;21;21;27;51;15;15;80;2
160;23;21;30;52;16;10;85;3
170;24;20;31;49;17;13;90;0
180;28;21;36;53;18;20;95;2
190;18;17;24;43;19;14;100;3
200;26;15;34;36;20;10;105;12
210;18;15;24;37;21;12;110;2
220;19;16;25;39;22;12;115;0
230;19;13;25;33;23;13;120;0
240;21;13;27;32;24;19;;12
250;18;10;23;25;25;3;;
260;17;12;22;30;26;9;;
270;18;12;23;31;27;21;;
280;18;9;24;23;28;9;;
290;21;12;27;29;29;11;;
300;16;9;21;23;30;11;;
310;14;7;18;18;31;17;;
320;12;8;16;19;32;9;;
330;8;7;11;18;33;8;;
340;12;8;16;20;34;9;;
350;10;7;13;17;35;8;;
360;11;6;14;16;36;6;;
370;11;9;15;22;37;6;;
380;8;4;10;9;38;10;;
390;11;4;14;10;39;7;;
400;8;4;10;9;40;6;;
reste;;;230;253;;;;
total;;;1305;2482;;;;
diagr;;;1074;2212;;;;
 t30;;;40;597;;;;

spl intercalaires entre cds[modifier | modifier le wikicode]

spl intercalaires positifs S+[modifier | modifier le wikicode]

spl. Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
myr;min20;828;2081;2909;872;649;764;115;-143;41;323;;;
spl;min10;1071;2215;3286;884;735;784;49;-353;-202;172;;;
rru;min40;874;2056;2930;829;193;611;418;722;792;861;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
71;392;0.18;999;2556;5;5;20;110;97;899;-78;;;
37;270;0.14;1313;2900;1;6;9;143;69;683;-342;;;
169;266;0.64;1037;2749;1;4;71;222;175;630;17;;;
;;;;;;;;;;;;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
spl;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;-7;-5;-3;1;R2;flex c+;comment.
1 à 400;47;-333;594;7.7;611;236;max80;-47;363;-934;95;806;257;min50
31 à 400;-;-;-;-;-;-;;10.3;-50;-57;43;915;162;2 parties
droite;-a;cste;-;R2;note;R2’;;-a;cste;-;R2;note;R2’;
1 à 400;59;37;-;275;poly;336;tF;158;57;;614;poly;192;SF
31 à 400;;;;;;;;106;43;-;885;dte;30;tf
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30 40 50 60, t30 t60.
  • Corrélations et fréquences faibles
;400;200;250;;;;;;corrélation;;;;;
;coefficient de corrélation fx fc;;;;;;;;-0.342;;;;;
41-n;0.884;0.735;0.784;;;;;;;;;;;
1-n;0.172;-0.353;-0.202;;;;;;;;;14.8.21 Paris;;
spl;fx;fc;;spl;fx%;fc%;;fx40;fc40;;x;spl;Sx-;Sc-
0;1;17;;0;1;8;0;1;17;>0;1300;-1;0;126
10;8;284;;10;7;128;1;0;46;<0;12;-2;2;0
20;19;193;;20;18;87;2;0;53;zéro;1;-3;0;0
30;13;120;;30;12;54;3;1;29;total;1313;-4;5;136
40;29;86;;40;27;39;4;0;22;;c;-5;0;0
50;16;75;;50;15;34;5;1;16;>0;2469;-6;0;0
60;39;80;;60;36;36;6;2;13;<0;414;-7;0;10
70;50;72;;70;47;33;7;2;14;zéro;17;-8;2;46
80;67;101;;80;63;46;8;1;29;total;2900;-9;0;0
90;52;93;;90;49;42;9;1;29;;;-10;0;8
100;56;90;;100;52;41;10;0;33;;;-11;0;28
110;38;64;;110;35;29;11;2;27;;;-12;0;0
120;54;73;;120;50;33;12;1;35;;;-13;0;5
130;44;84;;130;41;38;13;3;20;;;-14;0;15
140;26;56;;140;24;25;14;1;29;;;-15;1;0
150;27;51;;150;25;23;15;5;15;;;-16;0;3
160;30;52;;160;28;23;16;0;10;;;-17;1;8
170;30;50;;170;28;23;17;3;13;;;-18;0;0
180;36;53;;180;34;24;18;2;20;;;-19;0;1
190;24;43;;190;22;19;19;1;14;;;-20;0;7
200;33;37;;200;31;17;20;1;10;;;-21;0;0
210;24;37;;210;22;17;21;2;12;;;-22;0;0
220;25;39;;220;23;18;22;1;12;;;-23;0;4
230;25;33;;230;23;15;23;0;13;;;-24;0;0
240;28;31;;240;26;14;24;4;19;;;-25;0;0
250;23;25;;250;21;11;25;3;3;;;-26;0;2
260;22;30;;260;21;14;26;0;9;;;-27;0;0
270;23;31;;270;21;14;27;2;21;;;-28;0;1
280;25;22;;280;23;10;28;0;9;;;-29;0;2
290;27;29;;290;25;13;29;1;11;;;-30;0;0
300;20;24;;300;19;11;30;0;11;;;-31;0;0
310;18;18;;310;17;8;31;3;17;;;-32;0;3
320;16;19;;320;15;9;32;4;9;;;-33;0;0
330;11;18;;330;10;8;33;3;8;;;-34;0;1
340;16;20;;340;15;9;34;5;9;;;-35;0;0
350;13;17;;350;12;8;35;2;8;;;-36;0;0
360;14;16;;360;13;7;36;1;6;;;-37;0;0
370;15;22;;370;14;10;37;4;6;;;-38;0;1
380;10;9;;380;9;4;38;5;10;;;-39;0;0
390;14;10;;390;13;5;39;1;7;;;-40;0;0
400;11;8;;400;10;4;40;1;6;;;-41;0;1
reste;229;254;;;;;reste;1231;1786;;;-42;0;0
total;1301;2486;;t30;37;270;total;1301;2486;;;-43;0;1
diagr;1071;2215;;t60;116;378;diagr;69;683;;;-44;0;0
 - t30;1031;1618;;;;;;;;;;-45;0;0
 - t60;947;1377;;;;;;;;;;-46;0;0
;;;;;;;;;;;;-47;0;0
;;;;;;;;;;;;-48;0;0
;;;;;;;;;;;;-49;0;0
;;;;;;;;;;;;-50;0;0
;;;;;;;;;;;;reste;1;5
;;;;;;;;;;;;total;12;414
;;;;;;;;;;;;-52;1;

spl intercalaires négatifs S-[modifier | modifier le wikicode]

9.6.21 Paris

spl;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;;
comp’;;2;;5;;;;2;;;;;;;1;;1;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1;12
continu;126;0;0;136;0;0;10;46;0;8;28;0;5;15;0;3;8;0;1;7;0;0;4;0;0;2;0;1;2;0;0;3;0;1;0;0;0;1;0;0;1;0;1;0;0;0;0;0;0;0;5;414
  • 14.8.21 Paris
14.8.21 Paris;spl;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;2;0;5;0;0;0;2;0;0;0;0;0;0;1;0;1;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;0;1;12
;Sc-;126;0;0;136;0;0;10;46;0;8;28;0;5;15;0;3;8;0;1;7;0;0;4;0;0;2;0;1;2;0;0;3;0;1;0;0;0;1;0;0;1;0;1;0;0;0;0;0;0;0;5;414

spl autres intercalaires[modifier | modifier le wikicode]

spl;autres intercalaires;;adresses1;;;spl;autres intercalaires;;adresses2;;;spl;autres intercalaires;;adresses3;;;spl;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;43968;614;comp;;deb;°CDS;1337892;500;;;deb;°CDS;2379066;152;;;deb;°CDS;3757370;157;comp
;$rRNA;45140;349;;;;&tRNA;1339706;52;comp;;;&tRNA;2379767;13;;;;&tRNA;3757983;103;comp
;$rRNA;47032;132;;;;&tRNA;1339834;539;comp;;;&tRNA;2379856;85;;;;&tRNA;3758163;114;comp
;$rRNA;50059;1319;;;;&tRNA;1340449;52;comp;;;&tRNA;2380015;530;;;fin;°CDS;3758364;;comp
;$rRNA;51494;349;;;;&tRNA;1340577;545;comp;;fin;°CDS;2380631;;;;deb;°CDS;3834636;162;comp
;$rRNA;53386;132;;;deb;°CDS;1341198;34;;;deb;°CDS;2548825;595;;;;&tRNA;3835257;51;comp
;$rRNA;56413;339;;;;&tRNA;1342467;52;comp;;;&tRNA;2550857;13;;;;&tRNA;3835383;131;comp
fin;°CDS;56868;;comp;;;&tRNA;1342595;441;comp;;;&tRNA;2550946;95;;;;&tRNA;3835599;20;comp
deb;°CDS;146328;-16;comp;;fin;°CDS;1343112;;comp;;;&tRNA;2551115;634;;;;&tRNA;3835694;96;comp
;regulatory;146483;188;comp;;deb;°CDS;1455613;913;;;;&tRNA;2551835;95;;;;&tRNA;3835875;49;comp
fin;°CDS;146933;;;;;&tRNA;1456724;21;;;;&tRNA;2552004;479;;;;&tRNA;3835999;211;comp
deb;°CDS;181132;687;comp;;;&tRNA;1456837;30;;;;&tRNA;2552569;132;;;;&tRNA;3836295;5;comp
;$rRNA;182275;74;;;;&tRNA;1456944;32;;;;&tRNA;2552775;545;;;;&tRNA;3836377;47;comp
;&tRNA;183892;65;;;;&tRNA;1457053;30;;;fin;°CDS;2553406;;comp;;;&tRNA;3836499;55;comp
;&tRNA;184034;371;;;;&tRNA;1457160;33;;;deb;°CDS;2556685;89;;;;&tRNA;3836639;5;comp
;$rRNA;184481;132;;;;&tRNA;1457270;9;;;;&tRNA;2558019;184;;;;&tRNA;3836721;47;comp
;$rRNA;187508;100;;;;&tRNA;1457356;76;;;fin;°CDS;2558294;;comp;;;&tRNA;3836843;55;comp
;&tRNA;187724;606;;;;&tRNA;1457524;35;;;deb;°CDS;2716829;98;;;;&tRNA;3836983;495;comp
fin;°CDS;188407;;;;;&tRNA;1457636;9;;;;&tRNA;2717566;178;;;fin;°CDS;3837555;;comp
deb;°CDS;190429;234;comp;;;&tRNA;1457722;1058;;;fin;°CDS;2717834;;comp;;deb;°CDS;3862357;180;comp
;&tRNA;191614;8;;;fin;°CDS;1458872;;;;deb;°CDS;2758794;192;comp;;;&tRNA;3862885;167;comp
;&tRNA;191698;35;;;deb;°CDS;1564741;165;comp;;;&tRNA;2759262;128;comp;;;&tRNA;3863129;160;comp
;&tRNA;191818;195;;;;tmRNA;1566139;110;comp;;;&tRNA;2759496;128;comp;;fin;°CDS;3863366;;comp
fin;°CDS;192087;;;;fin;°CDS;1566605;;comp;;;&tRNA;2759730;189;comp;;deb;°CDS;3865578;454;
deb;°CDS;233942;647;;;deb;°CDS;1625951;581;comp;;;&tRNA;2759996;45;comp;;;$rRNA;3867049;132;comp
;$rRNA;235186;384;;;;&tRNA;1627363;176;comp;;;&tRNA;2760118;2;comp;;;$rRNA;3867297;348;comp
;$rRNA;237113;132;;;fin;°CDS;1627615;;comp;;;&tRNA;2760197;35;comp;;;$rRNA;3870540;807;comp
;$rRNA;240140;454;;;deb;°CDS;1769998;257;comp;;;&tRNA;2760309;13;comp;;fin;°CDS;3872890;;
deb;°CDS;240710;1908;comp;;;&tRNA;1770483;37;;;;&tRNA;2760399;353;comp;;deb;°CDS;3879732;289;comp
;$rRNA;243635;348;;;;&tRNA;1770596;37;;;fin;°CDS;2760829;;comp;;;&tRNA;3882154;187;
;$rRNA;245526;133;;;;&tRNA;1770709;37;;;deb;°CDS;2858049;291;comp;;fin;°CDS;3882417;;comp
;$rRNA;248554;68;;;;&tRNA;1770822;37;;;;&tRNA;2858823;30;;;deb;°CDS;3930329;122;comp
;&tRNA;248738;17;;;;&tRNA;1770935;37;;;;&tRNA;2858938;85;;;;regulatory;3932305;233;comp
;$rRNA;248831;703;;;;&tRNA;1771048;37;;;;&tRNA;2859108;107;;;fin;°CDS;3932761;;comp
fin;°CDS;249650;;;;;&tRNA;1771161;37;;;;&tRNA;2859300;107;;;deb;°CDS;4051244;82;
deb;°CDS;282426;135;;;;&tRNA;1771274;37;;;;&tRNA;2859492;315;;;;ncRNA;4051647;251;
;ncRNA;283404;313;;;;&tRNA;1771387;37;;;fin;°CDS;2859892;;;;fin;°CDS;4052080;;comp
fin;°CDS;284069;;comp;;;&tRNA;1771500;39;;;deb;°CDS;2863253;1011;comp;;deb;°CDS;4130284;211;comp
deb;°CDS;413908;236;comp;;;&tRNA;1771615;705;;;;&tRNA;2866268;45;;;;regulatory;4131260;506;comp
;&tRNA;416766;39;;;deb;°CDS;1772396;104;;;;&tRNA;2866389;41;;;fin;°CDS;4131919;;comp
;&tRNA;416882;41;;;;&tRNA;1773910;80;;;;&tRNA;2866506;26;;;deb;°CDS;4146436;183;
;&tRNA;416999;58;;;;&tRNA;1774066;102;;;;&tRNA;2866608;32;;;;regulatory;4146892;94;
;&tRNA;417134;320;;;;&tRNA;1774244;102;;;;&tRNA;2866716;33;;;fin;°CDS;4147086;;
fin;°CDS;417531;;comp;;;&tRNA;1774422;102;;;;&tRNA;2866825;40;;;deb;°CDS;4330369;663;comp
deb;°CDS;492003;1178;comp;;;&tRNA;1774600;102;;;;&tRNA;2866941;187;;;;&tRNA;4331488;20;comp
;$rRNA;493715;349;;;;&tRNA;1774778;102;;;fin;°CDS;2867204;;;;;&tRNA;4331584;13;comp
;$rRNA;495607;132;;;;&tRNA;1774956;102;;;deb;°CDS;2904901;188;comp;;;&tRNA;4331694;47;comp
;$rRNA;498634;768;;;;&tRNA;1775134;102;;;;regulatory;2907051;230;comp;;;&tRNA;4331817;47;comp
fin;°CDS;499518;;comp;;;&tRNA;1775312;253;;;fin;°CDS;2907380;;comp;;;&tRNA;4331940;15;comp
deb;°CDS;550745;-23;;;;&tRNA;1775641;102;;;deb;°CDS;2926979;572;comp;;;&tRNA;4332055;16;comp
;&tRNA;552630;286;comp;;;&tRNA;1775819;102;;;;&tRNA;2929429;97;comp;;;&tRNA;4332147;48;comp
fin;°CDS;553011;;;;;&tRNA;1775997;102;;;;&tRNA;2929603;97;comp;;;&tRNA;4332271;113;comp
deb;°CDS;640018;155;;;;&tRNA;1776175;102;;;;&tRNA;2929777;83;comp;;fin;°CDS;4332460;;comp
;&tRNA;641376;1172;;;;&tRNA;1776353;47;;;;&tRNA;2929937;124;comp;;deb;°CDS;4446808;66;comp
;&tRNA;642639;789;;;;&tRNA;1776476;977;;;fin;°CDS;2930138;;comp;;;regulatory;4449058;441;comp
deb;°CDS;643519;988;;;fin;°CDS;1777529;;comp;;deb;°CDS;3118298;830;comp;;fin;°CDS;4449582;;
;$rRNA;645851;74;;;deb;°CDS;1928606;113;comp;;;&tRNA;3120289;58;comp;;deb;°CDS;4452358;212;comp
;&tRNA;647468;65;;;;misc_feature;1930303;474;comp;;;&tRNA;3120423;58;comp;;;regulatory;4453881;104;
;&tRNA;647610;336;;;fin;°CDS;1930887;;;;;&tRNA;3120557;58;comp;;fin;°CDS;4454085;;
;$rRNA;648022;177;;;deb;°CDS;2079870;876;;;;&tRNA;3120691;59;comp;;deb;°CDS;4615072;798;
;$rRNA;651094;727;;;;$rRNA;2081301;348;;;;&tRNA;3120826;57;comp;;;$rRNA;4616881;132;comp
fin;°CDS;651937;;;;;$rRNA;2083192;132;;;;&tRNA;3120959;58;comp;;;$rRNA;4617129;371;comp
deb;°CDS;727650;330;comp;;;$rRNA;2086219;304;;;;&tRNA;3121093;58;comp;;;&tRNA;4620395;65;comp
;&tRNA;728115;695;;;fin;°CDS;2086639;;comp;;;&tRNA;3121227;59;comp;;;&tRNA;4620536;74;comp
fin;°CDS;728895;;;;deb;°CDS;2142913;136;;;;&tRNA;3121362;58;comp;;;$rRNA;4620687;206;comp
deb;°CDS;878528;406;;;;&tRNA;2143274;134;comp;;;&tRNA;3121496;59;comp;;fin;°CDS;4622436;;comp
;regulatory;879639;204;;;fin;°CDS;2143485;;comp;;;&tRNA;3121631;59;comp;;deb;°CDS;5003438;-13;comp
fin;°CDS;879989;;;;deb;°CDS;2225993;125;;;;&tRNA;3121766;193;comp;;;regulatory;5004406;257;comp
deb;°CDS;1166653;117;;;;regulatory;2226508;52;;;fin;°CDS;3122035;;comp;;fin;°CDS;5004800;;
;&tRNA;1168942;220;comp;;fin;°CDS;2226691;;;;deb;°CDS;3243130;634;;;deb;°CDS;5129088;427;comp
fin;°CDS;1169239;;comp;;deb;°CDS;2365103;455;comp;;;ncRNA;3244382;176;comp;;;&tRNA;5129770;100;comp
deb;°CDS;1284512;-193;;;;&tRNA;2366164;40;comp;;fin;°CDS;3244655;;comp;;;$rRNA;5129947;133;comp
;misc_feature;1284538;121;comp;;;&tRNA;2366281;40;comp;;deb;°CDS;3268300;255;comp;;;$rRNA;5130196;349;comp
fin;°CDS;1284778;;comp;;;&tRNA;2366398;40;comp;;;&tRNA;3269860;8;comp;;;$rRNA;5133440;611;comp
;;;;;;;&tRNA;2366515;383;comp;;;&tRNA;3269944;63;comp;;fin;°CDS;5135594;;comp
;;;;;;fin;°CDS;2366975;;;;;&tRNA;3270084;465;comp;;;;;;
;;;;;;deb;°CDS;2374251;254;comp;;fin;°CDS;3270626;;;;;;;;
;;;;;;;&tRNA;2376218;216;;;;;;;;;;;;;
;;;;;;fin;°CDS;2376525;;;;;;;;;;;;;;

spl intercalaires tRNA[modifier | modifier le wikicode]

spl ;intercalaires tRNA;;;;;;;;;;;
108 aas;pas de comp’;;;;;;;;;;;
aa1;aa2;aa3;;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
&234;&455;&830;;;;;606;;89;113;;
8;40*3;58*3;;comp’;&234;;195;;98;114;'''deb;
35;&152;59;;comp’;&236;comp’;320;;104;124;<201;9
&236;13;57;;comp’;-23;comp’;286;;152;134;total;18
39;85;58*2;;;&155;;789;;155;160;taux;50%
41;&595;59;;comp’;330;;695;;157;176;;
58;13;58;;comp’;117;;220;;162;187;'''fin;
&155;95;59*2;;comp’;&500;comp’;545;;180;193;<201;9
1172;634;&255;;comp’;&34;;441;;192;195;total;21
&500;95;8;;;&913;;1058;;255;216;taux;43%
52;479;63;;;581;;176;;427;220;;
539;132;&157;;comp’;&257;;705;;455;315;'''total;
52;&192;103;;;&104;comp’;977;;572;353;<201;18
&34;128*2;&162;;comp’;136;;134;;581;441;total;39
52;189;51;;;&455;comp’;383;;595;495;taux;46%
&913;45;131;;comp’;254;;216;;663;530;;
21;2;20;;;&152;;530;;830;606;;
30;35;96;;;89;comp’;184;;913;695;;
32;13;49;;;98;;178;;'''-;705;;
30;&291;211;;;&595;comp’;545;;'''-;789;;
33;30;5;;;&192;;353;;'''-;1058;'''comp’;'''cumuls
9;85;47;;comp’;&291;;315;;-23;178;'''deb;
76;107*2;55;;comp’;&1011;;187;;34;184;<201;4
35;&1011;5;;;&572;;124;;117;187;total;13
9;45;47;;;&830;;193;;136;286;taux;31%
&257;41;55;;;&255;comp’;465;;234;320;'''fin;
37*9;26;&180;;;&157;;114;;236;383;<201;3
39;32;167;;;&162;;495;;254;465;total;10
&104;33;&663;;;&180;;160;;257;545;taux;30%
80;40;20;;comp’;289;comp’;187;;289;545;;
102*7;&572;13;;;&663;;113;;291;977;'''total;
253;97*2;47*2;;;427;;;;330;'''-;<201;7
102*4;83;15;;;;;;;500;'''-;total;23
47;;16;;;;;;;1011;'''-;taux;30%
;;48;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;deb;fin;total
;;;;;;;;;<201;13;12;25
;;;;;;;;;total;31;31;62
;;;;;;;;;taux;42%;39%;40%

Vibrio parahaemolyticus[modifier | modifier le wikicode]

vpb opérons[modifier | modifier le wikicode]

45.3%GC;6.7.19 Paris;16s 11 ;126;doubles;intercalaires
Vibrio parahaemolyticus BB22OP;;;chr1;;
;33614..35175;;16s;@4;80
;35256..35331;;gaa;;2
;35334..35409;;aaa;;30
;35440..35515;;gta;;55
comp;35571..35768;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;59
;35828..38743;;23s;;73
;38817..38932;;5s;;
;;;;;
;49997..50073;;cgg;;32
;50106..50181;;cac;+;72
;50254..50330;;cca;2 cac;49
;50380..50455;;cac;2 cca;24
;50480..50556;;cca;;
;;;;;
comp;400045..400120;;atgi;;
;;;;;
;577971..579532;;16s;;88
;579621..579696;;gcc;;12
;579709..579784;;gaa;;258
;580043..582958;;23s;;73
;583032..583147;;5s;;30
;583178..583254;;gac;;35
;583290..583366;;tgg;;
;;;;;
comp;769649..769733;;cta;+;29
comp;769763..769847;;cta;10 cta;47
comp;769895..769971;;atg;4 atg;24
comp;769996..770080;;cta;5 caa;52
comp;770133..770207;;caa;;29
comp;770237..770321;;cta;;53
comp;770375..770451;;atg;;24
comp;770476..770560;;cta;;52
comp;770613..770687;;caa;;29
comp;770717..770801;;cta;;54
comp;770856..770930;;caa;;29
comp;770960..771044;;cta;;35
comp;771080..771154;;caa;;48
comp;771203..771287;;cta;;31
comp;771319..771403;;cta;;77
comp;771481..771557;;atg;;77
comp;771635..771709;;caa;;31
comp;771741..771825;;cta;;40
comp;771866..771942;;atg;;
;;;;;
;786939..787015;;cca;;
;;;;;
comp;802315..802391;;agg;;
;;;;;
;910219..910295;;aga;;
;;;;;
comp;982089..982173;;tac;+;81
comp;982255..982339;;tac;4 tac;81
comp;982421..982505;;tac;;81
comp;982587..982671;;tac;;
;;;;;
;1124715..1124802;;tcc;;
;;;;;
;1418321..1418397;;gtc;+;32
;1418430..1418506;;gtc;2gtc;
;;;;;
comp;1988127..1988202;;ggc;+;10
comp;1988213..1988299;;tta;2 ggc;76
comp;1988376..1988451;;ggc;;20
comp;1988472..1988545;;tgc;;
;;;;;
;2164082..2164157;;aac;;
;;;;;
;2193593..2193683;;tca;;
;;;;;
comp;2547884..2547960;;atgf;;56
comp;2548017..2548100;;ctc;;
;;;;;
;2652092..2652168;;cgt;+;56
comp;2652225..2652301;;cgt;9 cgt;57
comp;2652359..2652435;;cgt;2 agc;57
comp;2652493..2652569;;cgt;;57
comp;2652627..2652703;;cgt;;57
comp;2652761..2652837;;cgt;;56
comp;2652894..2652970;;cgt;;210
comp;2653181..2653257;;cgt;;31
comp;2653289..2653380;;agc;@5;320
comp;2653701..2653777;;cgt;;31
comp;2653809..2653900;;agc;;
;;;;;
;2735697..2735772;;ttc;+;64
;2735837..2735912;;aca;3 ttc;7
;2735920..2735995;;ttc;2 aca;70
;2736066..2736141;;aac;2 aac;71
;2736213..2736288;;aca;;7
;2736296..2736371;;ttc;;43
;2736415..2736490;;aac;;
;;;;;
;2738623..2738698;;ttc;;51
;2738750..2738825;;aca;+;21
;2738847..2738922;;aac;2 aca;39
;2738962..2739037;;aca;2 aac;15
;2739053..2739128;;aac;;
;;;;;
comp;2741263..2741339;;gac;;31
comp;2741371..2741487;;5s;;57
comp;2741545..2741620;;acc;;100
comp;2741721..2741836;;5s;;73
comp;2741910..2744825;;23s;;257
comp;2745083..2745158;;gca;;41
comp;2745200..2745276;;atc;;56
comp;2745333..2746894;;16s;;
;;;;;
comp;2755928..2756012;;ttg;;
;;;;;
comp;2847646..2847722;;tgg;;68
comp;2847791..2847867;;gac;;30
comp;2847898..2848013;;5s;;73
comp;2848087..2851002;;23s;;258
comp;2851261..2851336;;gaa;;80
comp;2851417..2852978;;16s;;
;;;;;
comp;2987485..2987561;;atgf;+;56
comp;2987618..2987693;;ggc;5 atgf;18
comp;2987712..2987788;;atgf;8 ggc;35
comp;2987824..2987899;;ggc;;50
comp;2987950..2988025;;ggc;;49
comp;2988075..2988150;;ggc;;49
comp;2988200..2988275;;ggc;;30
comp;2988306..2988382;;atgf;;55
comp;2988438..2988513;;ggc;;30
comp;2988544..2988620;;atgf;;39
comp;2988660..2988735;;ggc;;19
comp;2988755..2988831;;atgf;;35
comp;2988867..2988942;;ggc;;
;;;;;
comp;3060924..3061000;;tgg;;68
comp;3061069..3061145;;gac;;30
comp;3061176..3061291;;5s;;73
comp;3061365..3064280;;23s;;257
comp;3064538..3064613;;gta;;14
comp;3064628..3064703;;gca;;32
comp;3064736..3064811;;aaa;;2
comp;3064814..3064889;;gaa;;80
comp;3064970..3066531;;16s;@3;319
comp;3066851..3066966;;5s;;73
comp;3067040..3069955;;23s;;261
comp;3070217..3071778;;16s;;
;;;;;
comp;3105094..3105169;;acc;;13
comp;3105183..3105257;;gga;;35
comp;3105293..3105377;;tac;;36
comp;3105414..3105489;;aca;;
;;;;;
comp;3111073..3111149;;gac;;30
comp;3111180..3111295;;5s;;73
comp;3111369..3114284;;23s;;261
comp;3114546..3116107;;16s;@1;317
comp;3116425..3116540;;5s;;73
comp;3116614..3119529;;23s;;261
comp;3119791..3121352;;16s;;
;;;;;
comp;3175944..3176034;;tca;;69
comp;3176104..3176219;;5s;;73
comp;3176293..3179211;;23s;;257
comp;3179469..3179544;;gca;;41
comp;3179586..3179662;;atc;;56
comp;3179719..3181280;;16s;@2;
;;;;;
comp;3217187..3217263;;gac;;30
comp;3217294..3217409;;5s;;73
comp;3217483..3220398;;23s;;59
;3220458..3220655;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;55
comp;3220711..3220786;;gta;;30
comp;3220817..3220892;;aaa;;2
comp;3220895..3220970;;gaa;;80
comp;3221051..3222612;;16s;;
Vibrio parahaemolyticus BB22OP;;;chr2;;
;132908..134469;;16s;;80
;134550..134625;;gaa;;2
;134628..134703;;aaa;;16
;134720..134795;;gca;;14
;134810..134885;;gta;;54
comp;134940..135122;;MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS;CDS 180;19
;135142..138059;;23s;;73
;138133..138248;;5s;;69
;138318..138408;;tca;;
;;;;;
comp;192886..192969;;ctc;;
;;;;;
comp;591931..592021;;tca;;
;;;;;
comp;1009457..1009530;;tgc;;73
comp;1009604..1009690;;tta;;
;;;;;
comp;1021568..1021641;;tgc;;73
comp;1021715..1021801;;tta;;
;;;;;
comp;1029973..1030048;;ggc;;3
comp;1030052..1030125;;tgc;;

vpb cumuls[modifier | modifier le wikicode]

vpb cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;;1;;100;
;16 23 5s 0;0;20;9;8;50;;20;;200;
;16 atc gca;2;40;24;4;100;;40;;300;
;16 23 5s a;1;60;21;2;150;;60;;400;
;max a;6;80;9;2;200;;80;;500;
;a doubles;0;100;3;0;250;;100;;600;
;spéciaux;6;120;0;0;300;;120;;700;
;total aas;33;140;0;0;350;;140;;800;
sans ;opérons;25;160;0;0;400;;160;;900;
;1 aa;11;180;0;0;450;;180;;1000;
;max a;19;200;0;0;500;;200;;1100;
;a doubles;8;;1;0;;;;;;
;total aas;93;;67;16;;0;;0;;0
total aas;;126;;;;;;;;;
remarques;;5;;;;;;;;;
avec jaune;;;moyenne;46;26;;;;;;
;;;variance;29;22;;;;;;
sans jaune;;;moyenne;43;;;;;;;
;;;variance;17;;;;;;;

vpb blocs[modifier | modifier le wikicode]

vpb blocs;;;;;;;
16s;80;16s;80;16s;80;;
gaa;2;gaa;2;gaa;2;;
aaa;30;aaa;30;aaa;16;;
gta;55;gta;55;gca;14;;
cds 198;59;cds 198;59;gta;54;;
23s;73;23s;73;cds 180;19;;
5s;;5s;30;23s;73;;
;;gac;;5s;69;;
;;;;tca;;;
;;;;;;;
16s;56;16s;56;16s;88;16s;80
atc;41;atc;41;gcc;12;gaa;258
gca;257;gca;257;gaa;258;23s;73
23s;73;23s;73;23s;73;5s;30
5s;100;5s;69;5s;30;gac;
acc;57;tca;;gac;;;
5s;31;;;;;;
gac;;;;;;;
;;;;;;;
16s;261;16s;261;;;;
23s;73;23s;73;;;;
5s;319;5s;317;;;;
16s;80;16s;261;;;;
gaa;2;23s;73;;;;
aaa;32;5s;30;;;;
gca;14;gac;;;;;
gta;257;;;;;;
23s;73;;;;;;
5s;30;;;;;;
gac;;;;;;;

vpb distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;6;gtc2;atgi;;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;ggc4;ttc;4;tcc;;tac;1;tgc;4;ggc4;ttc;;tcc;;tac;4;tgc;;ggc4;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;;;atc;;acc;1;aac;4;agc;2;;atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;
ctc;1;ccc;;cac;;cgt;;acc 5s + 1 >a;ctc;1;ccc;;cac;2;cgt;1;acc 5s + 1 >a;ctc;;ccc;;cac;;cgt;8;acc 5s + 1 >a;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;tca 2 5s+ 2 a;gtc;;gcc;;gac;;ggc;7;tca 2 5s+ 2 a;gtc;2;gcc;;gac;;ggc;4;tca 2 5s+ 2 a;gtc;;gcc;;gac;6;ggc;
tta;;tca;2;taa;;tga;;;tta;3;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;
ata;;aca;;aaa;;aga;1;;ata;;aca;5;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;;cca;1;caa;;cga;;;cta;6;cca;2;caa;5;cga;;;cta;4;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;3
atgj;;acg;;aag;;agg;1;;atgj;4;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
vpb;;11;;;;;11;;vpb;60;;;;;;60;;vpb;22;;;;;;22;;vpb;;;;12;;;12

vpb1 données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: vpb1 données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNAbloc;;tRNA contig;;tRNA tRNA;;tRNA tRNA;vpb1;CDS-CDS;reste;;
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;aa;intercalaire;;intercalaire;aa;intercalaire;aa;Sup 400;Sup 400;Sup 500;Sup 500
fxt;fct;vpb1;fx;fc;vpb1;fx40;fc40;vpb1;x-;c-;c;x;c;x;c;;c;aa;c;hors bloc;c;hors bloc;long;long;long;long
;0;0;1;9;0;1;9;-1;;83;cont;x;CDS 16s;;16s 23s;;tRNA contig;;tRNA tRNA;;tRNA tRNA;suite;fx;fc;fx;fc
;0;10;12;254;1;2;25;-2;;0;284;337;454;556;3* 277;;35;gac;32;cgg;64;ttc;402;402;505;501
;3;20;12;187;2;1;45;-3;;0;140;243;504;496;23s 5s;;**;tgg;72;cac;7;aca;403;405;514;506
;0;30;9;114;3;2;36;-4;2;115;366;139;487;;10* 91;;2* 68;tgg;49;cac;70;ttc;408;405;519;507
;0;40;16;74;4;1;16;-5;;0;18;259;575;;16s tRNA;;**;gac;24;cac;71;aac;412;408;521;509
;1;50;26;58;5;0;24;-6;1;0;268;290;817;;97;gcc;;;**;cac;7;aca;412;413;529;519
;0;60;35;45;6;1;8;-7;;7;179;203;472;;2* 65;atc;;;29;cta;43;ttc;420;413;531;537
;0;70;57;54;7;1;15;-8;1;41;50;477;5s CDS;;4* 89;gaa;;;47;cta;**;aac;421;417;536;537
;0;80;56;57;8;2;21;-9;;0;144;282;;110;tRNA 23s;;;;24;atgj;51;ttc;428;417;537;540
;0;90;48;57;9;1;44;-10;;4;457;95;5s 16s;;2* 264;gca;;;52;cta;21;aca;429;418;541;540
3;1;100;36;48;10;1;20;-11;2;29;179;587;319;;2* 265;gaa;;;29;caa;39;aac;431;418;543;546
;1;110;36;60;11;1;25;-12;;0;736;168;317;;264;gta;;;53;cta;15;aca;431;424;546;547
;0;120;20;53;12;0;31;-13;;3;390;135;;;2* 319;gta;;;24;atgj;**;aac;432;426;547;551
;0;130;33;50;13;0;21;-14;;21;327;302;;;5s tRNA;;;;52;cta;56;atgf;432;427;548;553
2;1;140;22;38;14;1;23;-15;1;0;153;456;;;5* 30;gac;;;29;caa;18;ggc;433;430;551;557
;1;150;15;47;15;2;18;-16;;1;227;620;;;31;gac;CDS-CDS;inf 50;54;cta;35;atgf;434;432;551;561
;2;160;13;47;16;0;9;-17;;12;15;96;;;100;acc;intercalaire;;29;caa;50;ggc;438;434;552;581
1;0;170;16;47;17;1;19;-18;;0;569;206;;;69;tca;c-;x-;35;cta;49;ggc;438;435;556;596
;2;180;11;42;18;3;17;-19;;2;243;497;;;tRNA 5s;;-56;-65;48;caa;49;ggc;445;436;557;597
;1;190;18;31;19;2;8;-20;;10;11;964;;;57;acc;total;intercalaires;31;cta;30;ggc;445;437;560;606
;0;200;16;31;20;2;16;-21;1;0;243;93;;;tRNA tRNA;intra;;403,53;77;cta;55;atgf;446;437;560;609
2;0;210;9;26;21;2;14;-22;1;2;100;;;;2;gaa;ADN long;3,297,305;77;atgj;30;ggc;450;443;561;610
;0;220;15;21;22;0;8;-23;;5;272;;;;30;aaa;%;12.2;31;caa;39;atgf;452;445;573;616
;1;230;14;26;23;0;9;-24;;0;234;;;;**;gta;;;40;cta;19;ggc;454;446;575;619
;1;240;8;21;24;1;20;-25;;1;565;;;;12;gcc;non RNA;32;**;atgj;35;atgf;456;448;575;621
1;2;250;8;22;25;0;10;-26;;1;190;;;;**;gaa;;;81;tac;**;ggc;458;450;575;625
1;0;260;12;15;26;1;15;-27;;0;156;;;;41;gca;;;81;tac;13;acc;459;451;579;636
;1;270;15;17;27;1;6;-28;;0;103;;;;**;atc;;;81;tac;35;gga;461;452;611;639
;1;280;8;12;28;1;18;-29;;2;;;;;14;gta;;;**;tac;36;tac;461;455;618;647
2;1;290;12;15;29;2;5;-30;;0;;;;;32;gca;;;32;gtc;**;aca;464;456;634;650
;0;300;9;19;30;1;9;-31;;0;;;;;2;aaa;;;**;gtc;;;464;456;637;652
1;0;310;7;18;31;1;11;-32;;1;;;;;**;gaa;;;10;ggc;;;467;460;639;670
;0;320;12;6;32;1;11;-33;;0;;;;;41;gca;;;76;tta;;;475;473;641;687
;1;330;6;8;33;3;6;-34;;1;;;;;**;atc;;;20;ggc;;;481;474;669;707
1;0;340;4;6;34;4;9;-35;;2;;;;;30;gta;;;**;tgc;;;489;476;669;714
;0;350;11;8;35;0;5;-36;;0;;;;;2;aaa;;;56;atgf;;;489;477;683;716
;0;360;7;4;36;0;10;-37;;0;;;;;**;gaa;;;**;ctc;;;490;481;685;731
;1;370;8;6;37;2;6;-38;;0;;;;;;;;;56;cgt;;;495;487;688;751
;0;380;5;4;38;1;6;-39;;0;;;;;;;;;57;cgt;;;497;487;699;755
;1;390;7;3;39;2;6;-40;;0;;;;;;;;;57;cgt;;;499;489;701;798
;0;400;7;4;40;2;4;-41;1;0;;;;;;;;;57;cgt;;;500;491;716;799
6;4;reste;90;93;reste;732;1119;-42;;0;;;;;;;;;57;cgt;;;;492;718;821
20;27;total;782;1757;total;782;1757;-43;;0;;;;;;;;;56;cgt;;;;494;721;880
14;23;diagr;691;1655;diagr;49;629;-44;1;0;;;;;;;;;210;cgt;;;;496;757;908
0;3;t30;33;555;;;;-45;;0;;;;;;;;;31;cgt;;;;500;794;976
;;;;;;;;-46;;0;;;;;;;;;**;agc;;;;;803;1070
;Récapitulatif des effectifs;;;;;;;-47;1;0;;;;;;;;;31;cgt;;;;;815;1131
;;>0;<0;zéro;total;*;;-48;;0;;;;;;;;;**;agc;;;;;820;1145
;x;781;13;1;795;;;-49;;0;;;;;;;;;;;;;;;894;1347
;c;1748;344;9;2101;;;-50;;1;;;;;;;;;;;;;;;895;1605
;;;;;2896;203;;reste;1;0;;;;;;;;;;;;;;;1022;
;;;;;;3099;;total;13;344;;;;;;;;;;;;;;;;

vpb2 données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: vpb2 données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA tRNA;;CDS-CDS;;;
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;vpb2;Sup 400;Sup 400;Sup 500;Sup 500
fxt;fct;vpb2;fx;fc;vpb2;fx40;fc40;vpb2;x-;c-;c;x;c;x;c;aa;c;aa;long;long;long;long
;0;0;1;11;0;1;11;-1;;50;32;501;CDS 16s;;23s 5s;;tRNA tRNA;hors bloc;fx;fc;fx;fc
;0;10;11;116;1;0;18;-2;1;0;843;563;468;;91;;73;tgc;403;406;503;501
;0;20;6;71;2;1;16;-3;;0;356;24;;;16s tRNA;;**;tta;404;408;525;505
1;0;30;11;46;3;2;7;-4;4;53;221;329;;;89;gaa;73;tgc;405;410;529;510
1;1;40;8;27;4;1;6;-5;;0;222;678;;;tRNA 23s;;**;tta;408;410;531;515
;0;50;17;21;5;0;4;-6;1;0;;537;;;263;gta;3;ggc;413;411;533;521
;0;60;14;28;6;0;6;-7;;1;;314;;;5s tRNA;;**;tgc;413;412;543;529
;0;70;29;30;7;1;4;-8;;23;;34;;;69;tca;;;415;412;544;536
;0;80;39;25;8;1;8;-9;;0;;;;;tRNA tRNA;intra;;;416;413;545;538
;0;90;32;33;9;3;29;-10;;1;;;;;2;gaa;;;417;415;548;544
;0;100;28;24;10;2;18;-11;1;11;;;;;16;aaa;;;418;418;552;550
;0;110;24;18;11;0;14;-12;;0;;;;;14;gca;;;419;426;552;569
;0;120;29;19;12;1;13;-13;;1;;;;;**;gta;;;431;432;556;590
;0;130;18;17;13;1;5;-14;3;6;;;;;;;;;432;432;557;592
;0;140;11;16;14;0;6;-15;;0;;;;;;;CDS-CDS;inf 50;433;433;575;596
;0;150;16;15;15;1;8;-16;;0;;;;;;;intercalaire;;434;434;576;607
;0;160;15;30;16;0;4;-17;;6;;;;;;;c-;x-;439;442;577;624
;0;170;10;19;17;0;2;-18;;0;;;;;;;-97;-53;443;445;613;639
;0;180;8;23;18;1;9;-19;;1;;;;;;;-74;;444;446;613;649
;0;190;11;17;19;2;3;-20;;2;;;;;;;-59;;445;446;615;672
;0;200;7;3;20;0;7;-21;;0;;;;;;;total;intercalaires;457;452;625;673
;0;210;14;16;21;1;7;-22;;0;;;;;;;;242,529;457;454;653;697
;0;220;9;14;22;1;6;-23;1;2;;;;;;;ADN long;1,806,219;460;454;666;711
;2;230;9;13;23;0;4;-24;;0;;;;;;;%;13.4;460;456;674;752
;0;240;13;18;24;0;5;-25;;0;;;;;;;;;461;460;685;781
;0;250;14;9;25;1;4;-26;;4;;;;;;;non RNA;8;466;461;690;805
;0;260;12;7;26;1;4;-27;;0;;;;;;;;;469;463;722;844
;0;270;11;9;27;3;4;-28;;0;;;;;;;;;469;468;739;892
;0;280;6;8;28;2;6;-29;;2;;;;;;;;;472;473;742;930
;0;290;7;6;29;0;3;-30;;0;;;;;;;;;473;476;753;1030
;0;300;3;9;30;2;3;-31;;0;;;;;;;;;473;480;773;1265
;0;310;2;6;31;0;3;-32;;1;;;;;;;;;475;;802;1409
1;0;320;6;3;32;0;5;-33;;0;;;;;;;;;482;;816;1427
1;0;330;8;3;33;1;3;-34;;0;;;;;;;;;489;;867;1439
;0;340;5;8;34;1;2;-35;;1;;;;;;;;;491;;882;
;0;350;1;8;35;1;2;-36;;0;;;;;;;;;496;;1150;
;1;360;6;8;36;1;1;-37;;0;;;;;;;;;;;1282;
;0;370;5;2;37;1;3;-38;;1;;;;;;;;;;;;
;0;380;7;2;38;1;1;-39;1;0;;;;;;;;;;;;
;0;390;3;5;39;2;2;-40;;1;;;;;;;;;;;;
;0;400;4;2;40;0;5;-41;;0;;;;;;;;;;;;
4;1;reste;71;63;reste;524;557;-42;;0;;;;;;;;;;;;
8;5;total;561;828;total;561;828;-43;;0;;;;;;;;;;;;
4;4;diagr;489;754;diagr;36;260;-44;;0;;;;;;;;;;;;
1;0;t30;28;233;;;;-45;;0;;;;;;;;;;;;
;;;;;;;;-46;;1;;;;;;;;;;;;
;Récapitulatif des effectifs;;;;;;;-47;;0;;;;;;;;;;;;
;;>0;<0;zéro;total;*;;-48;1;0;;;;;;;;;;;;
;x;560;14;1;575;;;-49;;0;;;;;;;;;;;;
;c;817;171;11;999;;;-50;;3;;;;;;;;;;;;
;;;;;1574;32;;reste;1;0;;;;;;;;;;;;
;;;;;;1606;;total;14;171;;;;;;;;;;;;

vpb1 autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: vpb1 autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;vpb1;;;;;
deb;;CDS;32632;33159;454;*;
;;rRNA;33614;35166;89;*;1553
;;tRNA;35256;35331;2;*;gaa
;;tRNA;35334;35409;30;*;aaa
;;tRNA;35440;35515;319;*;gta
;;rRNA;35835;38725;91;*;2891
;;rRNA;38817;38932;110;*;116
fin;comp;CDS;39043;39933;;0;
deb;comp;CDS;49246;49659;337;*;
;;tRNA;49997;50073;32;*;cgg
;;tRNA;50106;50181;72;*;cac
;;tRNA;50254;50330;49;*;cac
;;tRNA;50380;50455;24;*;cac
;;tRNA;50480;50556;243;*;cac
fin;comp;CDS;50800;51525;;0;
deb;;CDS;330209;330847;37;*;
;;regulatory;330885;331020;72;*;
fin;;CDS;331093;332085;;;
deb;comp;CDS;398957;399760;284;*;
;comp;tRNA;400045;400120;140;*;atgi
fin;comp;CDS;400261;402123;;;
deb;;CDS;447282;448145;166;*;
;;ncRNA;448312;448741;175;*;
fin;;CDS;448917;449867;;;
deb;comp;CDS;503781;504251;439;*;
;;misc_f;504691;504810;54;*;
fin;;CDS;504865;507324;;;
deb;comp;CDS;568478;569656;13;*;
;comp;misc_f;569670;569792;107;*;
fin;comp;CDS;569900;570226;;;
deb;;CDS;574893;577466;504;*;
;;rRNA;577971;579523;97;*;1553
;;tRNA;579621;579696;12;*;gcc
;;tRNA;579709;579784;265;*;gaa
;;rRNA;580050;582940;91;*;2891
;;rRNA;583032;583147;30;*;116
;;tRNA;583178;583254;35;*;gac
;;tRNA;583290;583366;366;*;tgg
fin;;CDS;583733;584065;;;
deb;comp;CDS;670277;672010;111;*;
;comp;tmRNA;672122;672489;67;*;
fin;comp;CDS;672557;673042;;0;
deb;;CDS;768334;769509;139;*;
;comp;tRNA;769649;769733;29;*;cta
;comp;tRNA;769763;769847;47;*;cta
;comp;tRNA;769895;769971;24;*;atgj
;comp;tRNA;769996;770080;52;*;cta
;comp;tRNA;770133;770207;29;*;caa
;comp;tRNA;770237;770321;53;*;cta
;comp;tRNA;770375;770451;24;*;atgj
;comp;tRNA;770476;770560;52;*;cta
;comp;tRNA;770613;770687;29;*;caa
;comp;tRNA;770717;770801;54;*;cta
;comp;tRNA;770856;770930;29;*;caa
;comp;tRNA;770960;771044;35;*;cta
;comp;tRNA;771080;771154;48;*;caa
;comp;tRNA;771203;771287;31;*;cta
;comp;tRNA;771319;771403;77;*;cta
;comp;tRNA;771481;771557;77;*;atgj
;comp;tRNA;771635;771709;31;*;caa
;comp;tRNA;771741;771825;40;*;cta
;comp;tRNA;771866;771942;18;*;atgj
fin;comp;CDS;771961;772221;;;
deb;comp;CDS;786539;786679;259;*;
;;tRNA;786939;787015;290;*;cca
fin;comp;CDS;787306;788178;;0;
deb;comp;CDS;801540;802046;268;*;
;comp;tRNA;802315;802391;179;*;agg
fin;comp;CDS;802571;803704;;0;
deb;comp;CDS;909155;910015;203;*;
;;tRNA;910219;910295;50;*;aga
fin;;CDS;910346;910864;;;
deb;;CDS;980739;981611;477;*;
;comp;tRNA;982089;982173;81;*;tac
;comp;tRNA;982255;982339;81;*;tac
;comp;tRNA;982421;982505;81;*;tac
;comp;tRNA;982587;982671;282;*;tac
fin;;CDS;982954;984048;;;
deb;;CDS;997215;999218;137;*;
;;ncRNA;999356;999452;132;*;
fin;;CDS;999585;1000319;;0;
deb;comp;CDS;1081601;1082191;116;*;
;comp;regulatory;1082308;1082397;266;*;
fin;comp;CDS;1082664;1083668;;;
deb;;CDS;1124121;1124570;144;*;
;;tRNA;1124715;1124802;457;*;tcc
fin;;CDS;1125260;1126897;;;
deb;comp;CDS;1170475;1170882;597;*;
;;regulatory;1171480;1171660;113;*;
fin;;CDS;1171774;1173375;;0;
deb;comp;CDS;1176029;1176982;364;*;
;;misc_f;1177347;1177484;54;*;
fin;;CDS;1177539;1178435;;;
deb;;CDS;1417803;1418141;179;*;
;;tRNA;1418321;1418397;32;*;gtc
;;tRNA;1418430;1418506;95;*;gtc
fin;comp;CDS;1418602;1419771;;;
deb;comp;CDS;1803089;1803247;528;*;
;;regulatory;1803776;1803877;118;*;
fin;;CDS;1803996;1805372;;0;
deb;comp;CDS;1984514;1987390;736;*;
;comp;tRNA;1988127;1988202;10;*;ggc
;comp;tRNA;1988213;1988299;76;*;tta
;comp;tRNA;1988376;1988451;20;*;ggc
;comp;tRNA;1988472;1988545;390;*;tgc
fin;comp;CDS;1988936;1989493;;;
deb;;CDS;2000638;2000763;-54;*;
;;misc_f;2000710;2000813;125;*;
fin;;CDS;2000939;2002516;;;
deb;comp;CDS;2157175;2158164;-12;*;
;comp;regulatory;2158153;2158286;173;*;
fin;;CDS;2158460;2159353;;0;
deb;comp;CDS;2161464;2163494;587;*;
;;tRNA;2164082;2164157;327;*;aac
fin;;CDS;2164485;2165063;;;
deb;;CDS;2191631;2193439;153;*;
;;tRNA;2193593;2193683;168;*;tca
fin;comp;CDS;2193852;2194760;;0;
deb;comp;CDS;2547201;2547656;227;*;
;comp;tRNA;2547884;2547960;56;*;atgf
;comp;tRNA;2548017;2548100;15;*;ctc
fin;comp;CDS;2548116;2548454;;;
deb;comp;CDS;2651265;2651522;569;*;
;comp;tRNA;2652092;2652168;56;*;cgt
;comp;tRNA;2652225;2652301;57;*;cgt
;comp;tRNA;2652359;2652435;57;*;cgt
;comp;tRNA;2652493;2652569;57;*;cgt
;comp;tRNA;2652627;2652703;57;*;cgt
;comp;tRNA;2652761;2652837;56;*;cgt
;comp;tRNA;2652894;2652970;210;*;cgt
;comp;tRNA;2653181;2653257;31;*;cgt
;comp;tRNA;2653289;2653380;243;*;agc
deb;comp;CDS;2653624;2653689;11;*;
;comp;tRNA;2653701;2653777;31;*;cgt
;comp;tRNA;2653809;2653900;243;*;agc
fin;comp;CDS;2654144;2654341;;;
deb;;CDS;2699087;2699395;8;*;
;;ncRNA;2699404;2699588;4;*;
fin;;CDS;2699593;2700186;;;
deb;;CDS;2734457;2735596;100;*;
;;tRNA;2735697;2735772;64;*;ttc
;;tRNA;2735837;2735912;7;*;aca
;;tRNA;2735920;2735995;70;*;ttc
;;tRNA;2736066;2736141;71;*;aac
;;tRNA;2736213;2736288;7;*;aca
;;tRNA;2736296;2736371;43;*;ttc
;;tRNA;2736415;2736490;272;*;aac
deb;;CDS;2736763;2738388;234;*;
;;tRNA;2738623;2738698;51;*;ttc
;;tRNA;2738750;2738825;21;*;aca
;;tRNA;2738847;2738922;39;*;aac
;;tRNA;2738962;2739037;15;*;aca
;;tRNA;2739053;2739128;135;*;aac
deb;comp;CDS;2739264;2740697;565;*;
;comp;tRNA;2741263;2741339;31;*;gac
;comp;rRNA;2741371;2741487;57;*;117
;comp;tRNA;2741545;2741620;100;*;acc
;comp;rRNA;2741721;2741836;91;*;116
;comp;rRNA;2741928;2744818;264;*;2891
;comp;tRNA;2745083;2745158;41;*;gca
;comp;tRNA;2745200;2745276;65;*;atc
;comp;rRNA;2745342;2746894;487;*;1553
fin;comp;CDS;2747382;2748635;;;
deb;;CDS;2754342;2755625;302;*;
;comp;tRNA;2755928;2756012;190;*;ttg
fin;comp;CDS;2756203;2756868;;0;
deb;comp;CDS;2838215;2839336;326;*;
;;regulatory;2839663;2839841;102;*;
fin;;CDS;2839944;2841296;;0;
deb;;CDS;2847001;2847189;456;*;
;comp;tRNA;2847646;2847722;68;*;tgg
;comp;tRNA;2847791;2847867;30;*;gac
;comp;rRNA;2847898;2848013;91;*;116
;comp;rRNA;2848105;2850995;265;*;2891
;comp;tRNA;2851261;2851336;89;*;gaa
;comp;rRNA;2851426;2852978;575;*;1553
fin;comp;CDS;2853554;2854333;;;
deb;;CDS;2985737;2986864;620;*;
;comp;tRNA;2987485;2987561;56;*;atgf
;comp;tRNA;2987618;2987693;18;*;ggc
;comp;tRNA;2987712;2987788;35;*;atgf
;comp;tRNA;2987824;2987899;50;*;ggc
;comp;tRNA;2987950;2988025;49;*;ggc
;comp;tRNA;2988075;2988150;49;*;ggc
;comp;tRNA;2988200;2988275;30;*;ggc
;comp;tRNA;2988306;2988382;55;*;atgf
;comp;tRNA;2988438;2988513;30;*;ggc
;comp;tRNA;2988544;2988620;39;*;atgf
;comp;tRNA;2988660;2988735;19;*;ggc
;comp;tRNA;2988755;2988831;35;*;atgf
;comp;tRNA;2988867;2988942;156;*;ggc
fin;comp;CDS;2989099;2989644;;0;
deb;;CDS;3060116;3060827;96;*;
;comp;tRNA;3060924;3061000;68;*;tgg
;comp;tRNA;3061069;3061145;30;*;gac
;comp;rRNA;3061176;3061291;91;*;116
;comp;rRNA;3061383;3064273;264;*;2891
;comp;tRNA;3064538;3064613;14;*;gta
;comp;tRNA;3064628;3064703;32;*;gca
;comp;tRNA;3064736;3064811;2;*;aaa
;comp;tRNA;3064814;3064889;89;*;gaa
;comp;rRNA;3064979;3066531;319;*;1553
;comp;rRNA;3066851;3066966;91;*;116
;comp;rRNA;3067058;3069948;277;*;2891
;comp;rRNA;3070226;3071778;817;*;1553
fin;comp;CDS;3072596;3074731;;;
deb;comp;CDS;3103806;3104990;103;*;
;comp;tRNA;3105094;3105169;13;*;acc
;comp;tRNA;3105183;3105257;35;*;gga
;comp;tRNA;3105293;3105377;36;*;tac
;comp;tRNA;3105414;3105489;206;*;aca
fin;;CDS;3105696;3106619;;0;
deb;;CDS;3109235;3110575;497;*;
;comp;tRNA;3111073;3111149;30;*;gac
;comp;rRNA;3111180;3111295;91;*;116
;comp;rRNA;3111387;3114277;277;*;2891
;comp;rRNA;3114555;3116107;317;*;1553
;comp;rRNA;3116425;3116540;91;*;116
;comp;rRNA;3116632;3119522;277;*;2891
;comp;rRNA;3119800;3121352;556;*;1553
fin;;CDS;3121909;3122364;;1;
deb;comp;CDS;3123914;3125749;55;*;
;comp;regulatory;3125805;3126005;184;*;
fin;;CDS;3126190;3127299;;0;
deb;;CDS;3173798;3174979;964;*;
;comp;tRNA;3175944;3176034;69;*;tca
;comp;rRNA;3176104;3176219;91;*;116
;comp;rRNA;3176311;3179204;264;*;2894
;comp;tRNA;3179469;3179544;41;*;gca
;comp;tRNA;3179586;3179662;65;*;atc
;comp;rRNA;3179728;3181280;472;*;1553
fin;comp;CDS;3181753;3182466;;;
deb;comp;CDS;3213224;3215164;168;*;
;comp;regulatory;3215333;3215431;61;*;
fin;comp;CDS;3215493;3215876;;0;
deb;;CDS;3216111;3217093;93;*;
;comp;tRNA;3217187;3217263;30;*;gac
;comp;rRNA;3217294;3217409;91;*;116
;comp;rRNA;3217501;3220391;319;*;2891
;comp;tRNA;3220711;3220786;30;*;gta
;comp;tRNA;3220817;3220892;2;*;aaa
;comp;tRNA;3220895;3220970;89;*;gaa
;comp;rRNA;3221060;3222612;496;*;1553
fin;;CDS;3223109;3223657;;0;

vpb2 autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: vpb2 autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;vpb2;;;;;
deb;comp;CDS;126972;127829;96;*;
;comp;regulatory;127926;128033;312;*;
fin;;CDS;128346;129731;;;
deb;;CDS;131915;132439;468;*;
;;rRNA;132908;134460;89;*;1553
;;tRNA;134550;134625;2;*;gaa
;;tRNA;134628;134703;16;*;aaa
;;tRNA;134720;134795;14;*;gca
;;tRNA;134810;134885;263;*;gta
;;rRNA;135149;138041;91;*;2893
;;rRNA;138133;138248;69;*;116
;;tRNA;138318;138408;501;*;tca
fin;comp;CDS;138910;139266;;;
deb;comp;CDS;192242;192853;32;*;
;comp;tRNA;192886;192969;563;*;ctc
fin;;CDS;193533;194741;;0;
deb;;CDS;590953;591906;24;*;
;comp;tRNA;591931;592021;329;*;tca
fin;;CDS;592351;593031;;0;
deb;comp;CDS;1006811;1008613;843;*;
;comp;tRNA;1009457;1009530;73;*;tgc
;comp;tRNA;1009604;1009690;678;*;tta
fin;;CDS;1010369;1012618;;0;
deb;comp;CDS;1019688;1021211;356;*;
;comp;tRNA;1021568;1021641;73;*;tgc
;comp;tRNA;1021715;1021801;537;*;tta
fin;;CDS;1022339;1023970;;;
deb;comp;CDS;1028849;1029751;221;*;
;comp;tRNA;1029973;1030048;3;*;ggc
;comp;tRNA;1030052;1030125;222;*;tgc
fin;comp;CDS;1030348;1031802;;;
deb;comp;CDS;1124360;1124878;314;*;
;;tRNA;1125193;1125267;34;*;gga
fin;comp;CDS;1125302;1126159;;;
deb;;CDS;1291846;1292463;104;*;
;;regulatory;1292568;1292708;113;*;
fin;;CDS;1292822;1293478;;;
deb;;CDS;1311512;1311652;298;*;
;;regulatory;1311951;1312050;89;*;
fin;;CDS;1312140;1313153;;;
deb;;CDS;1632173;1633153;424;*;
;;regulatory;1633578;1633682;100;*;
fin;;CDS;1633783;1635246;;0;

Escherichia albertii[modifier | modifier le wikicode]

eal opérons[modifier | modifier le wikicode]

49.6%GC;10.3.19 Paris;16s   7;89;doubles;intercalaires
Escherichia albertii;;;;;
;219063..219144;;tac;+;212
;219357..219438;;tac;2 tac;
;;;;;
;413135..413219;;tcc;;
;;;;;
;462888..462972;;tca;;
;;;;;
comp;489120..489191;;gga;;6
comp;489198..489270;;aca;;
;;;;;
;615149..615233;;tcc;;
;;;;;
comp;756823..756895;;aaa;+;5
comp;756901..756973;;gta;3 aaa ;48
comp;757022..757094;;aaa;2 gta;5
comp;757100..757172;;gta;;48
comp;757221..757293;;aaa;;
;;;;;
;834529..834602;;atgj;+;10
;834613..834694;;cta;2atgj ;26
;834721..834792;;caa;2caa ;37
;834830..834901;;caa;2 cag;18
;834920..834993;;atgj;;51
;835045..835116;;cag;;35
;835152..835223;;cag;;
;;;;;
comp;968958..969031;;aga;;
;;;;;
comp;1192416..1192488;;acg;;
;;;;;
comp;1269526..1269599;;gac;;
;;;;;
comp;1277040..1277113;;gac;;52
comp;1277166..1277285;;5s;@1;169
comp;1277455..1280377;;23s;;186
comp;1280564..1280636;;gca;;45
comp;1280682..1280755;;atc;;70
comp;1280826..1282367;;16s;;
;;;;;
;1567231..1567314;;ctg;+;31
;1567346..1567429;;ctg;3 ctg;35
;1567465..1567548;;ctg;;
;;;;;
comp;1657309..1657390;;ttg;;
;;;;;
comp;1765401..1765473;;ggc;+;159
comp;1765633..1765705;;ggc;2 ggc;
;;;;;
;1795516..1795588;;ttc;;
;;;;;
comp;2006002..2006121;;5s;;169
comp;2006291..2009214;;23s;;186
comp;2009401..2009473;;gca;;45
comp;2009519..2009592;;atc;;70
comp;2009663..2011202;;16s;;
;;;;;
comp;2042057..2043241;;tuf1;CDS 1185pb;117
comp;2043359..2043431;;acc;;9
comp;2043441..2043512;;gga;;119
comp;2043632..2043713;;tac;;11
comp;2043725..2043797;;aca;@3;
;;;;;
comp;2047429..2047548;;5s;;169
comp;2047718..2050648;;23s;;186
comp;2050835..2050907;;gca;;45
comp;2050953..2051026;;atc;;68
comp;2051095..2052636;;16s;;
;;;;;
comp;2208305..2208424;;5s;@2;169
comp;2208594..2211517;;23s;;198
comp;2211716..2211788;;gaa;;85
comp;2211874..2213418;;16s;;
;;;;;
comp;2267554..2267627;;cca;;43
comp;2267671..2267754;;ctg;;23
comp;2267778..2267850;;cac;;61
comp;2267912..2267985;;cgg;;
;;;;;
comp;2305358..2305430;;tgg;;11
comp;2305442..2305515;;gac;;52
comp;2305568..2305687;;5s;;169
comp;2305857..2308779;;23s;;198
comp;2308978..2309050;;gaa;;85
comp;2309136..2310676;;16s;;
;;;;;
comp;2426158..2426248;;tga;;
;;;;;
;2556305..2556378;;ccg;;
;;;;;
;2810766..2812307;;16s;;85
;2812393..2812465;;gaa;;198
;2812664..2815586;;23s;;169
;2815756..2815875;;5s;;151
;2816027..2816099;;acc;;40
;2816140..2816259;;5s;;
;;;;;
;2911129..2911212;;ctc;;
;;;;;
; 2913088..2913161;;atgf;;
;;;;;
comp;3010332..3010404;;atgi;;
;;;;;
comp;3177717..3177789;;ttc;;
;;;;;
;3301617..3301687;;ggg;;
;;;;;
comp;3366868..3366941;;atgf;+;37
comp;3366979..3367052;;atgf;3 atgf;37
comp;3367090..3367163;;atgf;;
;;;;;
;3469914..3470003;;agc;;6
;3470010..3470083;;cgt;+;201
;3470285..3470358;;cgt;3 cgt;200
; 3470559..3470632;;cgt;;
;;;;;
;3505321..3505393;;atgi;;
;;;;;
;3563056..3564598;;16s;;85
;3564684..3564756;;gaa;;198
;3564955..3567876;;23s;;169
;3568046..3568165;;5s;;
;;;;;
comp;3779750..3779822;;aaa;;7
comp;3779830..3779902;;gta;+;47
comp;3779950..3780022;;gta;2 gta;
;;;;;
;3782718..3782790;;gcc;+;42
;3782833..3782905;;gcc;2 gcc;
;;;;;
comp;3810369..3810440;;agg;;
;;;;;
comp;3993500..3993573;;ccc;;
;;;;;
comp;4232176..4232248;;aac;;
;;;;;
;4233996..4234068;;aac;;
;;;;;
comp;4242952..4243024;;aac;;
;;;;;
comp;4248342..4248414;;aac;;
;;;;;
;4249406..4249492;;tcg;;
;;;;;
;4256696..4256768;;atgi;;100
;4256869..4256942;;aga;;
;;;;;
;4317980..4318052;;ggc;;56
;4318109..4318179;;tgc;;14
;4318194..4318277;;tta;;
;;;;;
comp;4556753..4556826;;gtc;+;7
comp;4556834..4556907;;gtc;2 gtc;

eal cumuls[modifier | modifier le wikicode]

eal cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;8;;100;;40;;300;
;16 23 5s a;0;60;7;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;1;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;13;140;0;;350;;140;;800;
sans ;opérons;38;160;1;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;1;;500;;200;;1100;
;a doubles;10;;2;;;;;;;
;total aas;71;;33;0;;0;;0;;0
total aas;;84;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;53;;;;;;;
;;;variance;59;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eal blocs[modifier | modifier le wikicode]

eal blocs;;;
16s;70;70;68
atc;45;45;45
gca;186;186;186
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;85;85
gaa;198;198;198
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;;
gaa;198;;
23s;169;;
5s;151;;
acc;40;;
5s;;;

eal distribution[modifier | modifier le wikicode]

atgi;2;tct;;tat;;atgf;1;atgi 2a+>a;atgi;1;tct;;tat;;atgf;;atgi 2a+>a;atgi;;tct;;tat;;atgf;3;atgi 2a+>a;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;;tgc;;gta2;ttc;;tcc;;tac;1;tgc;1;gta2;ttc;;tcc;;tac;2;tgc;;gta2;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;4;agc;;ctg3;atc;;acc;1;aac;;agc;1;ctg3;atc;;acc;;aac;;agc;;ctg3;atc;;acc;1;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;gcc2;ctc;;ccc;;cac;1;cgt;;gcc2;ctc;;ccc;;cac;;cgt;3;gcc2;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;tac2;gtc;;gcc;;gac;;ggc;1;tac2;gtc;2;gcc;2;gac;;ggc;2;tac2;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;1;caa2;tta;1;tca;;taa;;tga;;caa2;tta;;tca;;taa;;tga;;caa2;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;cag2;ata;;aca;2;aaa;4;aga;1;cag2;ata;;aca;;aaa;;aga;;cag2;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;atgf3;cta;1;cca;1;caa;;cga;;atgf3;cta;;cca;;caa;2;cga;;atgf3;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;cgt3;gta;2;gca;;gaa;;gga;2;cgt3;gta;2;gca;;gaa;;gga;;cgt3;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;;atgj;2;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;3;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;aaa (gta aaa)2;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
eal;;23;;;;;23;;eal;25;;;;;;25;;eal;23;;;;;;23;;eal;;;;4;;;4

eal données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: eal données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA tRNA;;tRNA tRNA;;CDS-CDS;;400-600;Sup 600;Sup 600;Sup 1000
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;;frequence;effectif;;long;long;long
fxt;fct;eal;fx;fc;eal;fx40;fc40;eal;x-;c-;c;x;c;x;c;aa;c;aa;eal;fx;fc;fx;fc;fc
;0;0;12;18;0;12;18;-1;0;157;158;376;CDS 16s;;23s 5s;;tRNA tRNA;hors bloc;400;1063;2148;609;601;1034
;0;10;45;323;1;5;35;-2;4;0;294;233;364;339;7* 169;;212;tac;410;5;5;616;602;1050
1;1;20;26;264;2;8;39;-3;0;0;162;276;370;477;16s tRNA;;**;tac;420;6;8;621;604;1065
;0;30;28;126;3;10;50;-4;39;250;479;441;161;467;2* 70;atc;6;gga;430;3;3;621;609;1073
1;0;40;60;94;4;4;29;-5;0;0;284;601;;264;68;atc;**;aca;440;5;7;622;609;1077
2;1;50;80;91;5;1;17;-6;2;0;170;156;5s CDS;;4* 85;gaa;5;aaa;450;3;3;629;610;1119
3;0;60;55;106;6;4;15;-7;2;13;164;256;300;113;tRNA 23s;;48;gta;460;3;10;635;614;1169
;0;70;43;83;7;2;18;-8;1;58;223;248;56;98;3* 186;gca;5;aaa;470;4;4;637;622;1226
2;1;80;31;75;8;3;18;-9;3;0;114;17;;460;4* 198;gaa;48;gta;480;4;6;638;629;1268
;0;90;42;75;9;3;47;-10;2;6;437;41;;;5s tRNA;;**;aaa;490;3;3;645;632;1421
2;3;100;38;74;10;5;55;-11;0;37;132;195;;;2* 52;gac;10;atgj;500;7;6;646;636;1595
1;3;110;40;77;11;2;42;-12;1;0;165;272;;;151;acc;26;cta;510;2;3;654;645;1637
1;3;120;27;61;12;2;36;-13;0;2;189;120;;;tRNA 5s;;37;caa;520;6;3;655;657;1689
1;1;130;37;57;13;2;19;-14;10;17;189;37;;;40;acc;18;caa;530;4;1;670;665;1791
1;1;140;33;55;14;1;47;-15;1;0;210;92;;;tRNA tRNA;intra;51;atgj;540;3;4;672;665;2324
;3;150;34;50;15;6;26;-16;2;2;106;184;;;3* 45;atc gca;35;cag;550;3;3;684;666;
1;2;160;38;45;16;3;25;-17;3;8;117;347;;;tRNA contig;contig;**;cag;560;4;2;692;680;
1;5;170;26;31;17;3;18;-18;2;0;150;59;;;11;tgg;31;ctg;570;1;2;693;680;
;0;180;24;37;18;4;14;-19;1;5;102;125;;;**;gac;35;ctg;580;5;3;694;684;
1;2;190;43;31;19;1;17;-20;2;10;167;78;;;;;**;ctg;590;1;2;707;685;
1;2;200;21;30;20;2;20;-21;0;0;398;237;;;;;159;ggc;600;5;4;714;690;
;2;210;24;30;21;2;18;-22;1;1;91;510;;;;;**;ggc;;45;56;721;700;
;0;220;36;33;22;3;18;-23;1;7;408;367;;;;;9;acc;;;;725;714;
;1;230;21;23;23;0;11;-24;3;0;14;235;;;;;119;gga;;;;729;738;
3;0;240;13;19;24;3;17;-25;2;4;203;135;;;;;11;tac;;;;732;742;
2;0;250;15;25;25;4;9;-26;4;6;200;243;;;;;**;aca;;;;736;745;
1;0;260;19;27;26;5;7;-27;1;0;105;102;;;;;43;cca;;;;737;761;
;0;270;18;25;27;2;12;-28;1;3;144;58;;;;;23;ctc;;;;738;806;
2;0;280;14;22;28;5;4;-29;2;6;345;162;;CDS-CDS;inf 50;;61;cac;;;;748;843;
;2;290;10;23;29;3;8;-30;3;0;315;71;;intercalaire;;;**;cgg;;;;762;865;
1;1;300;7;19;30;1;22;-31;1;2;283;324;;c-;x-;;37;atgf;;;;765;878;
;0;310;11;16;31;6;8;-32;0;5;150;41;;-310;-189;;37;atgf;;;;810;891;
;1;320;15;10;32;4;7;-33;2;0;123;93;;-95;-167;;**;atgf;;;;852;942;
1;0;330;13;12;33;3;11;-34;1;0;192;55;;-71;-129;;6;agc;;;;859;947;
;0;340;9;5;34;5;10;-35;1;5;74;298;;-53;-98;;201;cgt;;;;869;952;
1;1;350;3;12;35;3;8;-36;0;0;100;;;;-78;;200;cgt;;;;878;953;
;0;360;6;14;36;6;11;-37;0;0;655;;;;-66;;**;cgt;;;;923;954;
1;0;370;13;8;37;5;11;-38;1;2;100;;;;-51;;7;aaa;;;;925;958;
1;0;380;15;10;38;11;9;-39;2;0;49;;;total;intercalaires;;47;gta;;;;1115;960;
;0;390;10;3;39;14;9;-40;0;1;502;;;;594,081;;**;gta;;;;1117;967;
;1;400;8;9;40;3;10;-41;2;2;151;;;ADN long;4,701,875;;42;gcc;;;;1145;977;
3;5;reste;122;138;reste;1014;1461;-42;0;0;111;;;%;12.6;;**;gcc;;;;1156;;
35;42;total;1185;2286;total;1185;2286;-43;0;2;;;;;;;100;atgi;;;;1621;;
32;37;diagr;1051;2130;diagr;159;807;-44;0;1;;;;non RNA;386;;**;aga;;;;1660;;
1;1;t30;99;713;;;;-45;0;0;;;;;;;56;ggc;;;;1882;;
;;;;;;;;-46;1;1;;;;;;;14;tgc;;;;;;
;Récapitulatif des effectifs;;;;;;;-47;2;0;;;;;;;**;tta;;;;;;
;;>0;<0;zéro;total;*;;-48;3;0;;;;;;;7;gtc;;;;;;
;x;1173;119;12;1304;;;-49;2;0;;;;;;;**;gtc;;;;;;
;c;2268;617;18;2903;;;-50;1;0;;;;;;;;;;;;;;
;;;;;4207;537;;reste;7;4;;;;;;;;;;;;;;
;;;;;;4744;;total;119;617;;;;;;;;;;;;;;

eal autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: eal autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
autres intercalaires;;eal;;;;;
deb;;CDS;1006;1392;99;*;
;comp;gene;1492;5941;-3070;*;
fin;;CDS;2872;2988;;;
deb;;CDS;3611;3976;-366;*;
;;mobile_el;3611;4839;-906;*;
fin;;CDS;3934;4839;;;
deb;;CDS;14985;15332;-348;*;
;;mobile_el;14985;16921;-1540;*;
;;gene;15382;16569;549;*;
fin;;CDS;17119;18501;;;
deb;comp;CDS;34568;34681;26;*;
;;gene;34708;38448;-4;*;
fin;;CDS;38445;39989;;;
deb;comp;CDS;99647;99793;-25;*;
;;gene;99769;99909;51;*;
fin;;CDS;99961;100896;;0;
deb;comp;CDS;102850;103833;195;*;
;;gene;104029;105320;30;*;
fin;comp;CDS;105351;105914;;0;
deb;;CDS;191840;192184;85;*;
;comp;gene;192270;193340;282;*;
fin;comp;CDS;193623;194339;;0;
deb;;CDS;199369;199794;-426;*;
;;mobile_el;199369;201785;-1995;*;
fin;;CDS;199791;200141;;;
deb;;CDS;218062;218904;158;*;
;;tRNA;219063;219144;212;*;tac
;;tRNA;219357;219438;376;*;tac
fin;comp;CDS;219815;220912;;;
deb;comp;CDS;239027;239722;104;*;
;comp;gene;239827;239964;271;*;
fin;;CDS;240236;241336;;0;
deb;comp;CDS;242534;244144;22;*;
;comp;gene;244167;244856;122;*;
deb;;CDS;244979;245305;-327;*;
;;mobile_el;244979;246192;-891;*;
fin;;CDS;245302;246192;;0;
deb;;CDS;277602;278456;130;*;
;;gene;278587;280453;49;*;
fin;comp;CDS;280503;280757;;0;
deb;comp;CDS;285209;286279;9;*;
;comp;gene;286289;287587;329;*;
fin;;CDS;287917;289449;;0;
deb;comp;CDS;297458;298864;-1407;*;
;comp;mobile_el;297458;299261;-348;*;
fin;comp;CDS;298914;299261;;;
deb;comp;CDS;300053;300712;71;*;
;comp;gene;300784;300984;220;*;
fin;;CDS;301205;301894;;;
deb;comp;CDS;303386;307822;-3485;*;
;;repeat_reg;304338;304360;-23;*;
;;misc_f;304338;304432;-72;*;
;;repeat_reg;304361;304409;0;*;
;;repeat_reg;304410;304432;3985;*;
fin;;CDS;308418;308762;;;
deb;;CDS;309802;310167;-366;*;
;;mobile_el;309802;311030;-906;*;
fin;;CDS;310125;311030;;;
deb;;CDS;313323;313712;-232;*;
;;repeat_reg;313481;313501;-21;*;
;;misc_f;313481;313581;-93;*;
;;repeat_reg;313489;313509;-13;*;
;;repeat_reg;313497;313517;-16;*;
;;repeat_reg;313502;313520;-11;*;
;;repeat_reg;313510;313528;276;*;
fin;comp;CDS;313805;314563;;;
deb;comp;CDS;316137;316262;245;*;
;;gene;316508;316948;113;*;
fin;comp;CDS;317062;318312;;1;
deb;;CDS;332934;333359;-426;*;
;;mobile_el;332934;335350;-1995;*;
fin;;CDS;333356;333706;;;
deb;comp;CDS;411963;412901;233;*;
;;tRNA;413135;413219;276;*;tcc
fin;comp;CDS;413496;414182;;;
deb;;CDS;422060;426022;39;*;
;comp;gene;426062;426701;264;*;
fin;;CDS;426966;427097;;;
deb;comp;CDS;461328;462446;441;*;
;;tRNA;462888;462972;601;*;tca
fin;comp;CDS;463574;463717;;0;
deb;;CDS;463890;464255;-366;*;
;;mobile_el;463890;465118;-906;*;
fin;;CDS;464213;465118;;;
deb;comp;CDS;488610;488825;294;*;
;comp;tRNA;489120;489191;6;*;gga
;comp;tRNA;489198;489270;162;*;aca
fin;comp;CDS;489433;489567;;;
deb;comp;CDS;522240;523853;-1614;*;
;comp;mobile_el;522240;524454;-605;*;
;comp;gene;523850;524032;-4;*;
fin;comp;CDS;524029;524454;;;
deb;comp;CDS;545508;546056;180;*;
;comp;gene;546237;548084;260;*;
fin;comp;CDS;548345;552805;;;
deb;;CDS;590349;590696;-348;*;
;;mobile_el;590349;592284;-1539;*;
fin;;CDS;590746;592284;;0;
deb;comp;CDS;603716;607669;-1361;*;
;;repeat_reg;606309;606328;-20;*;
;;misc_f;606309;606445;-117;*;
;;repeat_reg;606329;606347;0;*;
;;repeat_reg;606348;606367;0;*;
;;repeat_reg;606368;606386;0;*;
;;repeat_reg;606387;606406;0;*;
;;repeat_reg;606407;606425;0;*;
;;repeat_reg;606426;606445;1358;*;
fin;comp;CDS;607804;608298;;0;
deb;;CDS;614451;614669;479;*;
;;tRNA;615149;615233;284;*;tcc
fin;;CDS;615518;615646;;0;
deb;;CDS;625353;625628;-276;*;
;;mobile_el;625353;626050;-504;*;
fin;;CDS;625547;626050;;;
deb;comp;CDS;660139;661350;273;*;
;;gene;661624;662214;34;*;
fin;comp;CDS;662249;662533;;0;
deb;;CDS;664227;664940;-14;*;
;comp;gene;664927;666254;7;*;
fin;comp;CDS;666262;668610;;;
deb;comp;CDS;730722;731225;-504;*;
;comp;mobile_el;730722;731371;-228;*;
fin;comp;CDS;731144;731419;;0;
deb;comp;CDS;747736;748551;79;*;
;comp;gene;748631;749979;68;*;
fin;comp;CDS;750048;750362;;0;
deb;comp;CDS;756185;756652;170;*;
;comp;tRNA;756823;756895;5;*;aaa
;comp;tRNA;756901;756973;48;*;gta
;comp;tRNA;757022;757094;5;*;aaa
;comp;tRNA;757100;757172;48;*;gta
;comp;tRNA;757221;757293;164;*;aaa
fin;comp;CDS;757458;758249;;;
deb;;CDS;782199;782768;47;*;
;;gene;782816;785265;13;*;
fin;;CDS;785279;786010;;;
deb;comp;CDS;797253;797513;3;*;
;comp;gene;797517;798173;1830;*;
fin;comp;CDS;800004;803876;;;
deb;;CDS;832389;834305;223;*;
;;tRNA;834529;834602;10;*;atgj
;;tRNA;834613;834694;26;*;cta
;;tRNA;834721;834792;37;*;caa
;;tRNA;834830;834901;18;*;caa
;;tRNA;834920;834993;51;*;atgj
;;tRNA;835045;835116;35;*;cag
;;tRNA;835152;835223;156;*;cag
fin;comp;CDS;835380;836555;;0;
deb;comp;CDS;849004;850455;-4;*;
;comp;gene;850452;851159;103;*;
fin;;CDS;851263;851817;;0;
deb;comp;CDS;957178;958083;-906;*;
;comp;mobile_el;957178;958406;-366;*;
fin;comp;CDS;958041;958406;;;
deb;comp;CDS;958518;960056;-1539;*;
;comp;mobile_el;958518;960453;-348;*;
deb;comp;CDS;960106;960453;867;*;
;;gene;961321;961434;545;*;
fin;;CDS;961980;962675;;;
deb;;CDS;966714;967040;-327;*;
;;mobile_el;966714;967930;-894;*;
;;gene;967037;967156;84;*;
;;gene;967241;967930;273;*;
fin;;CDS;968204;968368;;;
deb;;CDS;968555;968701;256;*;
;comp;tRNA;968958;969031;248;*;aga
fin;;CDS;969280;969912;;0;
deb;;CDS;1004964;1006640;32;*;
;;repeat_reg;1006673;1006697;-25;*;
;;misc_f;1006673;1006819;-122;*;
;;repeat_reg;1006698;1006733;0;*;
;;repeat_reg;1006734;1006758;0;*;
;;repeat_reg;1006759;1006794;0;*;
;;repeat_reg;1006795;1006819;21;*;
fin;comp;CDS;1006841;1008145;;0;
deb;comp;CDS;1031529;1033142;-1614;*;
;comp;mobile_el;1031529;1033944;-772;*;
fin;comp;CDS;1033173;1033523;;;
deb;;CDS;1122706;1123071;-366;*;
;;mobile_el;1122706;1123934;-906;*;
fin;;CDS;1123029;1123934;;1;
deb;;CDS;1143090;1144676;107;*;
;comp;gene;1144784;1144987;240;*;
fin;comp;CDS;1145228;1145341;;0;
deb;;CDS;1146049;1146696;709;*;
;comp;gene;1147406;1148787;9;*;
fin;comp;CDS;1148797;1149747;;;
deb;;CDS;1172631;1172978;-348;*;
;;mobile_el;1172631;1174566;-1539;*;
fin;;CDS;1173028;1174566;;;
deb;;CDS;1177520;1178338;1243;*;
;;gene;1179582;1179752;41;*;
deb;comp;CDS;1179794;1180537;535;*;
;;gene;1181073;1182912;-1531;*;
deb;;CDS;1181382;1181747;-366;*;
;;mobile_el;1181382;1182610;-906;*;
fin;;CDS;1181705;1182610;;;
deb;;CDS;1183247;1186789;359;*;
;comp;gene;1187149;1187571;12;*;
deb;comp;CDS;1187584;1188423;-840;*;
;comp;mobile_el;1187584;1188752;-303;*;
fin;comp;CDS;1188450;1188752;;;
deb;;CDS;1191235;1192398;17;*;
;comp;tRNA;1192416;1192488;114;*;acg
fin;comp;CDS;1192603;1193856;;;
deb;comp;CDS;1206541;1207404;12;*;
;comp;gene;1207417;1208120;20;*;
fin;comp;CDS;1208141;1208605;;;
deb;comp;CDS;1220100;1220765;82;*;
;comp;gene;1220848;1221270;186;*;
fin;;CDS;1221457;1222881;;0;
deb;comp;CDS;1268423;1269088;437;*;
;comp;tRNA;1269526;1269599;132;*;gac
fin;comp;CDS;1269732;1270472;;0;
deb;comp;CDS;1276071;1276874;165;*;
;comp;tRNA;1277040;1277113;52;*;gac
;comp;rRNA;1277166;1277285;169;*;120
;comp;rRNA;1277455;1280377;186;*;2923
;comp;tRNA;1280564;1280636;45;*;gca
;comp;tRNA;1280682;1280755;70;*;atc
;comp;rRNA;1280826;1282367;364;*;1542
fin;comp;CDS;1282732;1283304;;0;
deb;comp;CDS;1465720;1466553;419;*;
;;gene;1466973;1468487;30;*;
fin;;CDS;1468518;1469660;;;
deb;comp;CDS;1480677;1481042;22;*;
;comp;gene;1481065;1481979;65;*;
fin;comp;CDS;1482045;1482995;;;
deb;;CDS;1544994;1546253;128;*;
;comp;gene;1546382;1546600;181;*;
fin;comp;CDS;1546782;1547699;;;
deb;;CDS;1554556;1554981;-426;*;
;;mobile_el;1554556;1556972;-1995;*;
fin;;CDS;1554978;1555328;;;
deb;comp;CDS;1561637;1562476;-840;*;
;comp;mobile_el;1561637;1562805;-303;*;
fin;comp;CDS;1562503;1562805;;;
deb;;CDS;1566010;1567041;189;*;
;;tRNA;1567231;1567314;31;*;ctg
;;tRNA;1567346;1567429;35;*;ctg
;;tRNA;1567465;1567548;41;*;ctg
fin;comp;CDS;1567590;1567892;;0;
deb;;CDS;1589588;1591177;-4;*;
;;gene;1591174;1592536;227;*;
fin;;CDS;1592764;1593105;;0;
deb;;CDS;1595539;1595655;142;*;
;comp;gene;1595798;1596613;86;*;
fin;;CDS;1596700;1598196;;;
deb;comp;CDS;1617593;1617817;51;*;
;comp;gene;1617869;1619230;24;*;
deb;comp;CDS;1619255;1620574;15;*;
;comp;gene;1620590;1621672;318;*;
fin;;CDS;1621991;1623061;;;
deb;;CDS;1643482;1644588;269;*;
;;gene;1644858;1645271;9;*;
fin;comp;CDS;1645281;1645400;;0;
deb;;CDS;1646137;1646484;-348;*;
;;mobile_el;1646137;1648072;-1539;*;
fin;;CDS;1646534;1648072;;;
deb;;CDS;1648204;1648569;-366;*;
;;mobile_el;1648204;1649432;-906;*;
fin;;CDS;1648527;1649432;;;
deb;;CDS;1652275;1652700;434;*;
;;gene;1653135;1653353;-219;*;
;;mobile_el;1653135;1654347;-891;*;
fin;;CDS;1653457;1654347;;0;
deb;comp;CDS;1655857;1657119;189;*;
;comp;tRNA;1657309;1657390;195;*;ttg
fin;;CDS;1657586;1658605;;;
deb;;CDS;1714928;1715590;61;*;
;comp;gene;1715652;1717169;32;*;
fin;comp;CDS;1717202;1718458;;;
deb;;CDS;1726606;1728678;122;*;
;;gene;1728801;1730049;101;*;
fin;comp;CDS;1730151;1730600;;;
deb;comp;CDS;1737392;1737697;15;*;
;comp;gene;1737713;1739111;348;*;
fin;;CDS;1739460;1740182;;0;
deb;comp;CDS;1740186;1741799;-1614;*;
;comp;mobile_el;1740186;1742601;-772;*;
fin;comp;CDS;1741830;1742180;;;
deb;;CDS;1763989;1765128;272;*;
;comp;tRNA;1765401;1765473;159;*;ggc
;comp;tRNA;1765633;1765705;210;*;ggc
fin;comp;CDS;1765916;1766473;;0;
deb;;CDS;1794834;1795409;106;*;
;;tRNA;1795516;1795588;120;*;ttc
fin;comp;CDS;1795709;1795831;;0;
deb;;CDS;1851873;1852316;38;*;
;;gene;1852355;1852567;267;*;
fin;comp;CDS;1852835;1853443;;;
deb;comp;CDS;1859763;1861121;141;*;
;comp;gene;1861263;1862016;-24;*;
fin;;CDS;1861993;1862127;;;
deb;;CDS;1865164;1868547;84;*;
;comp;gene;1868632;1868922;48;*;
fin;comp;CDS;1868971;1869240;;;
deb;;CDS;1870491;1870619;0;*;
;comp;gene;1870620;1871063;79;*;
fin;comp;CDS;1871143;1871403;;;
deb;;CDS;1949708;1953091;84;*;
;comp;gene;1953176;1953466;48;*;
fin;comp;CDS;1953515;1953784;;;
deb;comp;CDS;1981727;1981849;173;*;
;;gene;1982023;1983165;229;*;
fin;;CDS;1983395;1983667;;0;
deb;;CDS;2005445;2005888;113;*;
;comp;rRNA;2006002;2006121;169;*;120
;comp;rRNA;2006291;2009214;186;*;2924
;comp;tRNA;2009401;2009473;45;*;gca
;comp;tRNA;2009519;2009592;70;*;atc
;comp;rRNA;2009663;2011202;339;*;1540
fin;;CDS;2011542;2011730;;;
deb;comp;CDS;2042057;2043241;117;*;
;comp;tRNA;2043359;2043431;9;*;acc
;comp;tRNA;2043441;2043512;119;*;gga
;comp;tRNA;2043632;2043713;11;*;tac
;comp;tRNA;2043725;2043797;37;*;aca
fin;;CDS;2043835;2043948;;;
deb;comp;CDS;2046100;2047128;300;*;
;comp;rRNA;2047429;2047548;169;*;120
;comp;rRNA;2047718;2050648;186;*;2931
;comp;tRNA;2050835;2050907;45;*;gca
;comp;tRNA;2050953;2051026;68;*;atc
;comp;rRNA;2051095;2052636;370;*;1542
fin;comp;CDS;2053007;2053795;;;
deb;comp;CDS;2158974;2159807;829;*;
;;gene;2160637;2163051;12;*;
fin;;CDS;2163064;2163966;;;
deb;comp;CDS;2172591;2173211;77;*;
;comp;gene;2173289;2173546;55;*;
deb;comp;CDS;2173602;2175140;-1539;*;
;comp;mobile_el;2173602;2177495;-2306;*;
deb;comp;CDS;2175190;2175537;554;*;
;comp;gene;2176092;2177495;1659;*;
fin;;CDS;2179155;2182946;;0;
deb;comp;CDS;2183410;2185023;-1614;*;
;comp;mobile_el;2183410;2185826;-773;*;
fin;comp;CDS;2185054;2185404;;;
deb;comp;CDS;2185401;2185826;543;*;
;comp;gene;2186370;2186657;-7;*;
deb;comp;CDS;2186651;2187490;-840;*;
;comp;mobile_el;2186651;2187819;-303;*;
fin;comp;CDS;2187517;2187819;;;
deb;;CDS;2207679;2208206;98;*;
;comp;rRNA;2208305;2208424;169;*;120
;comp;rRNA;2208594;2211517;198;*;2924
;comp;tRNA;2211716;2211788;85;*;gaa
;comp;rRNA;2211874;2213418;161;*;1545
fin;comp;CDS;2213580;2213693;;;
deb;comp;CDS;2266168;2267403;150;*;
;comp;tRNA;2267554;2267627;43;*;cca
;comp;tRNA;2267671;2267754;23;*;ctc
;comp;tRNA;2267778;2267850;61;*;cac
;comp;tRNA;2267912;2267985;102;*;cgg
fin;comp;CDS;2268088;2269473;;;
deb;;CDS;2293318;2294019;382;*;
;;gene;2294402;2294677;293;*;
fin;comp;CDS;2294971;2295189;;;
deb;;CDS;2304426;2305265;92;*;
;comp;tRNA;2305358;2305430;11;*;tgg
;comp;tRNA;2305442;2305515;52;*;gac
;comp;rRNA;2305568;2305687;169;*;120
;comp;rRNA;2305857;2308779;198;*;2923
;comp;tRNA;2308978;2309050;85;*;gaa
;comp;rRNA;2309136;2310676;477;*;1541
fin;;CDS;2311154;2311846;;;
deb;;CDS;2321389;2322882;-1;*;
;;gene;2322882;2324333;2;*;
fin;comp;CDS;2324336;2325328;;0;
deb;comp;CDS;2378811;2380424;-1614;*;
;comp;mobile_el;2378811;2381212;-773;*;
fin;comp;CDS;2380440;2380790;;;
deb;comp;CDS;2417229;2418767;-1539;*;
;comp;mobile_el;2417229;2419164;-348;*;
fin;comp;CDS;2418817;2419164;;;
deb;comp;CDS;2425190;2425990;167;*;
;comp;tRNA;2426158;2426248;398;*;tga
fin;comp;CDS;2426647;2428356;;;
deb;comp;CDS;2540679;2541338;152;*;
;;gene;2541491;2543825;-32;*;
fin;comp;CDS;2543794;2544234;;;
deb;;CDS;2552319;2552645;-327;*;
;;mobile_el;2552319;2553532;-891;*;
fin;;CDS;2552642;2553532;;;
deb;;CDS;2554522;2556213;91;*;
;;tRNA;2556305;2556378;408;*;ccg
fin;;CDS;2556787;2556942;;;
deb;comp;CDS;2565469;2566089;104;*;
;;mobile_el;2566194;2566559;-43;*;
fin;;CDS;2566517;2567422;;;
deb;comp;CDS;2570300;2570803;-504;*;
;comp;mobile_el;2570300;2570949;-228;*;
fin;comp;CDS;2570722;2570949;;0;
deb;comp;CDS;2604958;2605884;679;*;
;;gene;2606564;2608547;48;*;
fin;;CDS;2608596;2609624;;0;
deb;;CDS;2686914;2689361;116;*;
;;gene;2689478;2691108;12;*;
fin;;CDS;2691121;2692248;;;
deb;comp;CDS;2809744;2810298;467;*;
;;rRNA;2810766;2812307;85;*;1542
;;tRNA;2812393;2812465;198;*;gaa
;;rRNA;2812664;2815586;169;*;2923
;;rRNA;2815756;2815875;151;*;120
;;tRNA;2816027;2816099;40;*;acc
;;rRNA;2816140;2816259;460;*;120
deb;comp;CDS;2816720;2816941;263;*;
;;gene;2817205;2817393;-189;*;
;;mobile_el;2817205;2818470;-906;*;
fin;;CDS;2817565;2818470;;0;
deb;;CDS;2831862;2832113;17;*;
;comp;gene;2832131;2832961;36;*;
fin;comp;CDS;2832998;2833972;;0;
deb;;CDS;2841214;2845062;-2103;*;
;;repeat_reg;2842960;2842988;-29;*;
;;misc_f;2842960;2843036;-48;*;
;;repeat_reg;2842989;2843007;0;*;
;;repeat_reg;2843008;2843036;0;*;
;;repeat_reg;2843037;2843055;2162;*;
fin;;CDS;2845218;2846663;;0;
deb;;CDS;2910782;2911114;14;*;
;;tRNA;2911129;2911212;184;*;ctc
deb;comp;CDS;2911397;2912740;347;*;
;;tRNA;2913088;2913161;203;*;atgf
fin;;CDS;2913365;2913823;;;
deb;comp;CDS;2990833;2991525;76;*;
;comp;gene;2991602;2992141;48;*;
fin;;CDS;2992190;2993326;;;
deb;;CDS;3009508;3010272;59;*;
;comp;tRNA;3010332;3010404;125;*;atgi
fin;;CDS;3010530;3011036;;0;
deb;;CDS;3031527;3032243;-55;*;
;comp;gene;3032189;3032860;26;*;
fin;comp;CDS;3032887;3033516;;;
deb;comp;CDS;3035820;3036635;73;*;
;;gene;3036709;3037523;45;*;
fin;comp;CDS;3037569;3038243;;;
deb;comp;CDS;3065231;3066241;10;*;
;comp;gene;3066252;3067268;-4;*;
fin;comp;CDS;3067265;3068737;;;
deb;;CDS;3086093;3087694;56;*;
;;gene;3087751;3088983;21;*;
deb;;CDS;3089005;3089826;-4;*;
;;gene;3089823;3091840;-1174;*;
deb;;CDS;3090667;3090942;-276;*;
;;mobile_el;3090667;3091364;-504;*;
fin;;CDS;3090861;3091364;;;
deb;;CDS;3154197;3154562;-366;*;
;;mobile_el;3154197;3155425;-906;*;
fin;;CDS;3154520;3155425;;;
deb;;CDS;3170182;3170481;-300;*;
;;mobile_el;3170182;3172472;-1995;*;
fin;;CDS;3170478;3170828;;;
deb;comp;CDS;3174727;3175593;-867;*;
;comp;mobile_el;3174727;3175889;-300;*;
deb;comp;CDS;3175590;3175889;27;*;
;comp;gene;3175917;3176090;163;*;
deb;comp;CDS;3176254;3177516;200;*;
;comp;tRNA;3177717;3177789;105;*;ttc
fin;comp;CDS;3177895;3178602;;0;
deb;;CDS;3178713;3178841;78;*;
;;gene;3178920;3180233;39;*;
deb;comp;CDS;3180273;3181160;-888;*;
;comp;mobile_el;3180273;3181486;-343;*;
;comp;gene;3181144;3181344;-23;*;
;comp;gene;3181322;3181486;84;*;
fin;;CDS;3181571;3182452;;0;
deb;;CDS;3261760;3262185;-426;*;
;;mobile_el;3261760;3264176;-1995;*;
fin;;CDS;3262182;3262532;;;
deb;;CDS;3265955;3267892;218;*;
;;gene;3268111;3268275;-165;*;
;;mobile_el;3268111;3269324;-1072;*;
;;gene;3268253;3268453;-20;*;
deb;;CDS;3268434;3269324;174;*;
;;gene;3269499;3269690;34;*;
fin;comp;CDS;3269725;3271092;;;
deb;comp;CDS;3294722;3295600;10;*;
;comp;gene;3295611;3297883;647;*;
deb;;CDS;3298531;3298878;-348;*;
;;mobile_el;3298531;3300466;-1539;*;
fin;;CDS;3298928;3300466;;;
deb;;CDS;3300717;3301472;144;*;
;;tRNA;3301617;3301687;345;*;ggg
fin;;CDS;3302033;3303649;;;
deb;;CDS;3307842;3309902;88;*;
;;gene;3309991;3310143;-153;*;
;;mobile_el;3309991;3311221;-1002;*;
fin;;CDS;3310220;3311221;;;
deb;comp;CDS;3324385;3325824;1352;*;
;;gene;3327177;3327602;141;*;
fin;comp;CDS;3327744;3328226;;;
deb;;CDS;3365536;3366789;78;*;
;comp;tRNA;3366868;3366941;37;*;atgf
;comp;tRNA;3366979;3367052;37;*;atgf
;comp;tRNA;3367090;3367163;237;*;atgf
fin;;CDS;3367401;3368468;;;
deb;;CDS;3389488;3390033;623;*;
;;gene;3390657;3390986;-1;*;
fin;;CDS;3390986;3391768;;;
deb;;CDS;3469413;3469598;315;*;
;;tRNA;3469914;3470003;6;*;agc
;;tRNA;3470010;3470083;201;*;cgt
;;tRNA;3470285;3470358;200;*;cgt
;;tRNA;3470559;3470632;283;*;cgt
fin;;CDS;3470916;3471482;;;
deb;comp;CDS;3502585;3504810;510;*;
;;tRNA;3505321;3505393;150;*;atgi
fin;;CDS;3505544;3505669;;;
deb;;CDS;3510006;3510353;-348;*;
;;mobile_el;3510006;3511941;-1539;*;
deb;;CDS;3510403;3511941;125;*;
;;gene;3512067;3512513;14;*;
deb;;CDS;3512528;3512791;-264;*;
;;mobile_el;3512528;3514954;-2150;*;
;;gene;3512805;3512963;-4;*;
fin;;CDS;3512960;3513310;;;
deb;comp;CDS;3562657;3562791;264;*;
;;rRNA;3563056;3564598;85;*;1543
;;tRNA;3564684;3564756;198;*;gaa
;;rRNA;3564955;3567876;169;*;2922
;;rRNA;3568046;3568165;56;*;120
fin;;CDS;3568222;3568401;;;
deb;comp;CDS;3571648;3574308;31;*;
;comp;gene;3574340;3575038;68;*;
fin;comp;CDS;3575107;3575526;;0;
deb;comp;CDS;3576849;3577406;-11;*;
;comp;gene;3577396;3578786;243;*;
fin;comp;CDS;3579030;3579959;;;
deb;comp;CDS;3579980;3580744;-4;*;
;comp;gene;3580741;3581900;447;*;
fin;;CDS;3582348;3583577;;;
deb;;CDS;3664297;3664512;210;*;
;;gene;3664723;3665750;612;*;
fin;comp;CDS;3666363;3667598;;;
deb;comp;CDS;3679102;3680115;55;*;
;comp;gene;3680171;3680824;126;*;
deb;comp;CDS;3680951;3682564;-1614;*;
;comp;mobile_el;3680951;3683367;-773;*;
fin;comp;CDS;3682595;3682945;;;
deb;comp;CDS;3689955;3690845;-891;*;
;comp;mobile_el;3689955;3691168;-327;*;
deb;comp;CDS;3690842;3691168;71;*;
;;gene;3691240;3691808;37;*;
fin;comp;CDS;3691846;3693387;;;
deb;;CDS;3750210;3751109;57;*;
;comp;gene;3751167;3752154;2;*;
fin;comp;CDS;3752157;3753581;;;
deb;;CDS;3771968;3772186;-4;*;
;comp;gene;3772183;3773181;622;*;
fin;;CDS;3773804;3775057;;;
deb;;CDS;3778498;3779382;367;*;
;comp;tRNA;3779750;3779822;7;*;aaa
;comp;tRNA;3779830;3779902;47;*;gta
;comp;tRNA;3779950;3780022;123;*;gta
fin;comp;CDS;3780146;3780277;;0;
deb;comp;CDS;3782138;3782482;235;*;
;;tRNA;3782718;3782790;42;*;gcc
;;tRNA;3782833;3782905;192;*;gcc
fin;;CDS;3783098;3785287;;0;
deb;;CDS;3809220;3810233;135;*;
;comp;tRNA;3810369;3810440;243;*;agg
fin;;CDS;3810684;3810854;;;
deb;;CDS;3943453;3943722;1059;*;
;comp;gene;3944782;3944997;275;*;
fin;comp;CDS;3945273;3946595;;0;
deb;;CDS;3947187;3951791;0;*;
;;gene;3951792;3953441;4;*;
fin;;CDS;3953446;3954222;;0;
deb;comp;CDS;3954296;3955480;30;*;
;comp;gene;3955511;3956833;-4;*;
fin;comp;CDS;3956830;3957480;;;
deb;comp;CDS;3958338;3959723;-4;*;
;comp;gene;3959720;3961554;154;*;
fin;;CDS;3961709;3964558;;0;
deb;;CDS;3990809;3993397;102;*;
;comp;tRNA;3993500;3993573;74;*;ccc
fin;comp;CDS;3993648;3995408;;;
deb;;CDS;4039907;4041427;15;*;
;;gene;4041443;4042454;126;*;
fin;comp;CDS;4042581;4043816;;;
deb;;CDS;4049805;4051163;11;*;
;;gene;4051175;4052214;15;*;
fin;;CDS;4052230;4052931;;;
deb;comp;CDS;4055684;4056187;-504;*;
;comp;mobile_el;4055684;4056381;-276;*;
fin;comp;CDS;4056106;4056381;;0;
deb;comp;CDS;4073428;4073901;118;*;
;comp;gene;4074020;4077331;-1736;*;
;;gene;4075596;4075760;-23;*;
;;gene;4075738;4075938;-201;*;
;;mobile_el;4075738;4076809;-891;*;
fin;;CDS;4075919;4076809;;0;
deb;comp;CDS;4086440;4090207;12;*;
;comp;gene;4090220;4094026;140;*;
fin;comp;CDS;4094167;4096200;;0;
deb;;CDS;4106672;4107397;256;*;
;;mobile_el;4107654;4107956;103;*;
deb;;CDS;4108060;4108407;-348;*;
;;mobile_el;4108060;4109996;-1540;*;
;;gene;4108457;4108705;1;*;
;;gene;4108707;4109996;890;*;
fin;comp;CDS;4110887;4111405;;0;
deb;;CDS;4112562;4112927;-366;*;
;;mobile_el;4112562;4113790;-906;*;
fin;;CDS;4112885;4113790;;;
deb;comp;CDS;4130212;4131216;-4;*;
;comp;gene;4131213;4131569;60;*;
deb;;CDS;4131630;4131905;-276;*;
;;mobile_el;4131630;4132327;-504;*;
fin;;CDS;4131824;4132327;;;
deb;;CDS;4134472;4134771;-300;*;
;;mobile_el;4134472;4135634;-867;*;
fin;;CDS;4134768;4135634;;0;
deb;comp;CDS;4135825;4136019;307;*;
;;gene;4136327;4137226;90;*;
deb;comp;CDS;4137317;4138369;255;*;
;;gene;4138625;4139629;-66;*;
deb;comp;CDS;4139564;4140067;-504;*;
;comp;mobile_el;4139564;4140261;-276;*;
fin;comp;CDS;4139986;4140261;;;
deb;;CDS;4155516;4155818;-303;*;
;;mobile_el;4155516;4156684;-840;*;
deb;;CDS;4155845;4156684;8;*;
;;gene;4156693;4156833;772;*;
fin;comp;CDS;4157606;4159459;;0;
deb;comp;CDS;4217020;4217574;2;*;
;comp;gene;4217577;4218935;-4;*;
fin;comp;CDS;4218932;4219480;;;
deb;;CDS;4231182;4232117;58;*;
;comp;tRNA;4232176;4232248;100;*;aac
deb;comp;CDS;4232349;4233833;162;*;
;;tRNA;4233996;4234068;71;*;aac
fin;comp;CDS;4234140;4235642;;;
deb;comp;CDS;4238007;4242296;655;*;
;comp;tRNA;4242952;4243024;324;*;aac
fin;;CDS;4243349;4243624;;;
deb;comp;CDS;4244552;4246090;-1539;*;
;comp;mobile_el;4244552;4246433;-294;*;
;comp;gene;4246140;4246433;4;*;
;;gene;4246438;4246626;-189;*;
;;mobile_el;4246438;4247675;-1072;*;
;;gene;4246604;4246804;-20;*;
fin;;CDS;4246785;4247675;;;
deb;;CDS;4247983;4248300;41;*;
;comp;tRNA;4248342;4248414;100;*;aac
deb;comp;CDS;4248515;4249312;93;*;
;;tRNA;4249406;4249492;55;*;tcg
fin;comp;CDS;4249548;4250573;;;
deb;;CDS;4255597;4256646;49;*;
;;tRNA;4256696;4256768;100;*;atgi
;;tRNA;4256869;4256942;502;*;aga
deb;;CDS;4257445;4257576;916;*;
;;mobile_el;4258493;4258858;-43;*;
fin;;CDS;4258816;4260225;;0;
deb;;CDS;4261965;4262312;-348;*;
;;mobile_el;4261965;4263900;-1539;*;
fin;;CDS;4262362;4263900;;;
deb;;CDS;4278068;4278370;12;*;
;;gene;4278383;4279027;137;*;
fin;;CDS;4279165;4280583;;;
deb;comp;CDS;4287685;4287954;8;*;
;comp;gene;4287963;4288700;-1;*;
fin;comp;CDS;4288700;4289068;;;
deb;comp;CDS;4304648;4305058;24;*;
;comp;gene;4305083;4306483;264;*;
fin;;CDS;4306748;4308007;;;
deb;;CDS;4317280;4317828;151;*;
;;tRNA;4317980;4318052;56;*;ggc
;;tRNA;4318109;4318179;14;*;tgc
;;tRNA;4318194;4318277;712;*;tta
;;gene;4318990;4319154;-165;*;
;;mobile_el;4318990;4320203;-1072;*;
;;gene;4319132;4319332;-20;*;
fin;;CDS;4319313;4320203;;0;
deb;;CDS;4377172;4377537;-366;*;
;;mobile_el;4377172;4378400;-906;*;
fin;;CDS;4377495;4378400;;;
deb;;CDS;4378416;4378562;151;*;
;;gene;4378714;4380770;-4;*;
fin;comp;CDS;4380767;4381429;;;
deb;comp;CDS;4437118;4437621;42;*;
;comp;gene;4437664;4439143;179;*;
fin;comp;CDS;4439323;4440657;;;
deb;;CDS;4448284;4448556;1106;*;
;;gene;4449663;4450085;305;*;
fin;;CDS;4450391;4451527;;;
deb;;CDS;4461624;4462049;-426;*;
;;mobile_el;4461624;4464040;-1995;*;
fin;;CDS;4462046;4462396;;;
deb;comp;CDS;4483177;4484004;198;*;
;;gene;4484203;4484540;298;*;
fin;;CDS;4484839;4485159;;;
deb;comp;CDS;4556336;4556641;111;*;
;comp;tRNA;4556753;4556826;7;*;gtc
;comp;tRNA;4556834;4556907;298;*;gtc
fin;;CDS;4557206;4558462;;0;
deb;;CDS;4580951;4581385;46;*;
;comp;gene;4581432;4581897;273;*;
fin;;CDS;4582171;4583292;;;
deb;;CDS;4603717;4604412;51;*;
;;gene;4604464;4604628;-165;*;
;;mobile_el;4604464;4605677;-1072;*;
;;gene;4604606;4604806;-20;*;
fin;;CDS;4604787;4605677;;0;
deb;comp;CDS;4657614;4658519;-906;*;
;comp;mobile_el;4657614;4658842;-366;*;
fin;comp;CDS;4658477;4658842;;;
deb;comp;CDS;4660407;4662020;-1614;*;
;comp;mobile_el;4660407;4662823;-773;*;
fin;comp;CDS;4662051;4662401;;;
deb;;CDS;4681148;4681423;-276;*;
;;mobile_el;4681148;4681845;-504;*;
fin;;CDS;4681342;4681845;;0;
deb;comp;CDS;4698147;4698425;-27;*;
;;gene;4698399;4698569;7;*;
;;gene;4698577;4699832;109;*;
fin;;CDS;4699942;4701063;;0;

Escherichia coli[modifier | modifier le wikicode]

eco opérons[modifier | modifier le wikicode]

Escherichia coli str. K-12 substr. MG1655;;;;;;;
50.6%GC;10.3.19 Paris;16s 7 ;89;doubles;interca;EcoCyc;adIP
;223771..225312;;16s;;68;opéron;
;225381..225457;;atc;;42;ileV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30045]
;225500..225575;;gca;;183;« ;
;225759..228662;;23s;;93;« ;
;228756..228875;;5s;@1;52;« ;
;228928..229004;;gac;;;aspU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30024]
;;;;;;;
;236931..237007;;gac;;;;
;;;;;;;
;262871..262946;;acg;;;;
;;;;;;;
;564723..564799;;aga;;;;
;;;;;;;
comp;696430..696504;;cag;+;37;opéron;
comp;696542..696616;;cag;2 cag;47;glnT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30029]
comp;696664..696740;;atg;2 atg;15;« ;
comp;696756..696830;;caa;2 caa;34;« ;
comp;696865..696939;;caa;;23;« ;
comp;696963..697047;;cta;;9;« ;
comp;697057..697133;;atg;;;;
;;;;;;;
;780554..780629;;aaa;+;135;lysT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30055]
;780765..780840;;gta;5 aaa;2;opéron;
;780843..780918;;aaa;2 gta;149;« ;
;781068..781143;;gta;;3;valZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6389]
;781147..781222;;aaa;;146;opéron;
;781369..781444;;aaa;;132;lysZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6391]
;781577..781652;;aaa;;;lysQ;[https://biocyc.org/gene?orgid=ECOLI&id=G6392]
;;;;;;EcoCyc;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30055&chromosome=COLI-K12]
comp;925884..925971;;tcc;;;InfA-serW;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
;;;;;;;
comp;1031625..1031712;;tca;;;;
;;;;;;;
comp;1097565..1097652;;tcc;;;;
;;;;;;;
comp;1287087..1287176;;tpr ;cds 90pb;67;tpr;
comp;1287244..1287328;;tac;+;209;opéron;
comp;1287538..1287622;;tac;2 tac;;tyrT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30106]
;;;;;;;
; 1746435..1746511;;gtc;+;4;valV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30111]
; 1746516..1746592;;gtc;2 gtc;;opéron;
;;;;;;«RNA 67pb;
comp;1991815..1991901;;tta;;12;leuZ;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1983402/2000314]
comp;1991914..1991987;;tgc;;54;« ;
comp;1992042..1992117;;ggc;;;opéron;
;;;;;;;
comp;2043468..2043557;;tcg;;;;
;;;;;;;
;2044549..2044624;;aac;;;;
;;;;;;;
comp;2058027..2058102;;aac;;;;
;;;;;;;
; 2059851..2059926;;aac;;;;
;;;;;;;
;2062260..2062335;;aac;;;;
;;;;;;;
;2286211..2286287;;ccc;;;;
;;;;;;;
;2466309..2466383;;agg;;;;
;;;;;;;
comp;2518041..2518116;;gcc;+;39;alaX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30012]
comp;2518156..2518231;;gcc;2 gcc;;opéron;
;;;;;;;
;2520931..2521006;;gta;+;44;valU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30110]
;2521051..2521126;;gta;3gta;46;opéron;
;2521173..2521248;;gta;;4;« ;
;2521253..2521328;;aaa;;;« ;
;;;;;;;
comp;2726069..2726188;;5s;@2;92;opéron;
comp;2726281..2729184;;23s;;184;;
comp;2729369..2729444;;gaa;;171;;
comp;2729616..2731157;;16s;;;;
;;;;;;;
comp;2785762..2785837;;atgi;;;;
;;;;;;;
comp;2817784..2817860;;cgt;+;198;« ;
comp;2818059..2818135;;cgt;4 cgt;62;« ;
comp;2818198..2818274;;cgt;;198;« ;
comp;2818473..2818549;;cgt;;3;opéron;
comp;2818553..2818645;;agc;;;serV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30013]
;;;;;;;
;2947387..2947463;;atgf;+;33;opéron;
;2947497..2947573;;atgf;3 atgf;33;metW;[https://biocyc.org/gene?orgid=ECOLI&id=EG31117]
;2947607..2947683;;atgf;;;« ;
;;;;;;;
comp;2998984..2999057;;ggg;;;;
;;;;;;;
;3110366..3110441;;ttc;;;;
;;;;;;;
;3215598..3215673;;atgi;;;;
;;;;;;;
comp;3318213..3318289;;atgf;;;;
;;;;;;;
comp;3322072..3322158;;ctc;;;;
;;;;;;;
comp;3423423..3423542;;5s;;37;« ;
comp;3423580..3423655;;acc;;12;« ;
comp;3423668..3423787;;5s;;92;« ;
comp;3423880..3426783;;23s;;174;« ;
comp;3426958..3427033;;gca;;42;« ;
comp;3427076..3427152;;atc;;68;ileU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30044]
comp;3427221..3428762;;16s;;;opéron;
;;;;;;;
comp;3708616..3708692;;ccg;;;;
;;;;;;;
;3836222..3836316;;tga;;;;
;;;;;;ecoliwiki;[https://ecoliwiki.org/colipedia/index.php/Category:rRNA_operons]
;3941808..3943349;;16s;;85;gltU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30033]
;3943435..3943510;;gaa;;193;opéron;
;3943704..3946607;;23s;;92;« ;
;3946700..3946819;;5s;;52;« ;
;3946872..3946948;;gac;;8;aspT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30023]
;3946957..3947032;;tgg;;;trpT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30105]
;;;;;;;
;3982375..3982451;;cgg;;57;argX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30017]
;3982509..3982585;;cac;;20;opéron;
;3982606..3982692;;ctg;;42;« ;
;3982735..3982811;;cca;;;« ;
;;;;;;;
;4035531..4037072;;16s;;68;opéron;
;4037141..4037217;;atc;;42;ileT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30043]
;4037260..4037335;;gca;;183;« ;
;4037519..4040423;;23s;;93;« ;
;4040517..4040636;;5s;;;« ;
;;;;;;;
;4166659..4168200;;16s;;171;opéron;
;4168372..4168447;;gaa;;193;;
;4168641..4171544;;23s;;92;;
;4171637..4171756;;5s;;;;
;;;;;;;
;4175388..4175463;;aca;@3;8;thrU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30101]
;4175472..4175556;;tac;;116;opéron;
;4175673..4175747;;gga;;6;« ;
;4175754..4175829;;acc;;114;« ;
;4175944..4177128;;tufb;cds 1185 pb;;« ;
;;;;;;;
;4208147..4209688;;16s;;85;opéron;
;4209774..4209849;;gaa;;193;;
;4210043..4212946;;23s;;93;;
;4213040..4213159;;5s;;;;
;;;;;;;
comp;4362551..4362626;;ttc;;;;
;;;;;;;
;4392360..4392435;;ggc;+;36;opéron;
;4392472..4392547;;ggc;3 ggc;35;glyX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30040]
;4392583..4392658;;ggc;;;« ;
;;;;;;;
;4496405..4496489;;ttg;;;;
;;;;;;;
comp;4606079..4606165;;ctg;+;34;opéron;
comp;4606200..4606286;;ctg;3 ctg;28;leuV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30051]
comp;4606315..4606401;;ctg;;;« ;

eco cumuls[modifier | modifier le wikicode]

eco cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;10;;100;;40;;300;
;16 23 5s a;0;60;6;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;0;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;14;140;2;;350;;140;;800;
sans ;opérons;36;160;2;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;2;;500;;200;;1100;
;a doubles;10;;1;;;;;;;
;total aas;72;;36;0;;0;;0;;0
total aas;;86;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;57;;;;;;;
;;;variance;60;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eco cds[modifier | modifier le wikicode]

les CDS eco pour opérons;;;;;;;;;
clusters;6.8.19 Paris ;;;interca;cdsa;promoteur;terminateur;notes;
;222833..223408;;cds;362;192;sigma FIS;;;
;223771..225312;;16s;68;;;;;
;225381..225457;;atc;42;;;;;
;225500..225575;;gca;183;;;;;
;225759..228662;;23s;93;;;;;
;228756..228875;;5s;52;;;;;
;228928..229004;;gac;162;;Terminateur;+ sigma;;
;229167..229970;;cds;;268;;;;
;;;;;;;;;
comp;2724448..2725746;;cds;322;433;rien;début opéron ;rien;
comp;2726069..2726188;;5s;92;;;;;
comp;2726281..2729184;;23s;184;;;;;
comp;2729369..2729444;;gaa;171;;;;;
comp;2729616..2731157;;16s;442;;sigma FIS;;;
comp;2731600..2734173;;cds;;858;;;;
;;;;;;;;;
;3422436..3423194;;cds;228;253;Terminateur;fin opéron ;rien;
comp;3423423..3423542;;5s;37;;;;;
comp;3423580..3423655;;acc;12;;;;;
comp;3423668..3423787;;5s;92;;;;;
comp;3423880..3426783;;23s;174;;;;;
comp;3426958..3427033;;gca;42;;;;;
comp;3427076..3427152;;atc;68;;;;;
comp;3427221..3428762;;16s;473;;sigma FIS;;;
;3429236..3429790;;cds;;185;;;;
;;;;;;;;;
comp;3940635..3941327;;cds;480;231;sigma FIS;;;
;3941808..3943349;;16s;85;;;;;
;3943435..3943510;;gaa;193;;;;;
;3943704..3946607;;23s;92;;;;;
;3946700..3946819;;5s;52;;;;;
;3946872..3946948;;gac;8;;;;;
;3946957..3947032;;tgg;95;;Terminateur;fin opéron ;rien;
comp;3947128..3947967;;cds;;280;;;;
;;;;;;;;;
;4034608..4035153;;cds;377;182;Sigma Lrp-leu;;;
;4035531..4037072;;16s;68;;;;;
;4037141..4037217;;atc;42;;;;;
;4037260..4037335;;gca;183;;;;;
;4037519..4040423;;23s;93;;;;;
;4040517..4040636;;5s;228;;;;;
;4040865..4040900;;rprg;5;;pas de Term;fin opéron ;rien;
comp;4040906..4041433;;cds;;176;;;;
;;;;;;;;;
;4165428..4166285;;cds;373;286;Sigma Lrp-leu;;;
;4166659..4168200;;16s;171;;;;;
;4168372..4168447;;gaa;193;;;;;
;4168641..4171544;;23s;92;;;;;
;4171637..4171756;;5s;300;;Terminateur;début opéron ;rien;
;4172057..4173085;;cds;;343;;;;
;;;;;;;;;
comp;4205943..4207532;;cds;614;530;sigma FIS;;;
;4208147..4209688;;16s;85;;;;;
;4209774..4209849;;gaa;193;;;;;
;4210043..4212946;;23s;93;;;;;
;4213040..4213159;;5s;74;;Terminateur;début opéron ;rien;
;4213234..4213617;;cds;;128;;;;
;;;;;;;;;
;695101..696276;;cds;31;392;;;;
comp;696308..696378;;rprg;51;;Terminateur;fin opéron;rien;
comp;696430..696504;;cag;37;;;;;
comp;696542..696616;;cag;47;;;;;
comp;696664..696740;;atg;15;;;;;
comp;696756..696830;;caa;34;;;;;
comp;696865..696939;;caa;23;;;;;
comp;696963..697047;;cta;9;;;;;
comp;697057..697133;;atg;379;;sigma FIS;fin opéron;rien;
comp;697513..699177;;cds;;555;;;;
;;;;;;;;;
;779598..780389;;cds;164;264;sigma FIS;fin opéron;rien;
;780554..780629;;aaa;135;;;;;
;780765..780840;;gta;2;;;;;
;780843..780918;;aaa;149;;;;;
;781068..781143;;gta;3;;;;;
;781147..781222;;aaa;146;;;;;
;781369..781444;;aaa;132;;;;;
;781577..781652;;aaa;432;;Terminateur;début opéron;NadR pas sigma;
;782085..783128;;cds;;348;;;;
;;;;;;;;;
;1286709..1286984;;cds;81;92;Terminateur;;;
comp;1287066..1287236;;ncRNA;-150;;;;;
comp;1287087..1287176;;tpr ;67;30;;;;
comp;1287244..1287328;;tac;209;;;;;
comp;1287538..1287622;;tac;159;;sigma FIS;;;
comp;1287782..1288624;;cds;;281;;;;
;;;;;;;;;
solitaires;;;;promoteur;terminateur;interc avant;interc après;protéines;lien
;236931..237007;;gac;sigma FIS;Term 1;133;328;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=228513/245425]
;262871..262946;;acg;sigma FIS;rien;115;204;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=262297/263521]
;564723..564799;;aga;sigma FIS;rien;243;16;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=564149/565373]
comp;925884..925971;;InfA-tcc;sigma FIS;Term 1;344;254;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
comp;1031625..1031712;;tca;sigma FIS;Term 2;207;427;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1023213/1040125]
comp;1097565..1097652;;tcc;sigma FIS;Term 4;736;234;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1089153/1106065]
comp;2043468..2043557;;tcg;sigma -;Term 1;570;94;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2035057/2051969]
;2044549..2044624;;aac;sigma -;Term 1;101;314;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2036131/2053043]
comp;2058027..2058102;;aac;sigma -;Term 1;453;101;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2049609/2066521]
; 2059851..2059926;;aac;sigma -;Term 1;5;38;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2051433/2068345]
;2062260..2062335;;aac;sigma NtrC;rien;327;56;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2053842/2070754]
;2286211..2286287;;ccc;sigma FIS;Term 1;75;103;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2277793/2294705]
;2466309..2466383;;agg;sigma -;Term 1;76;162;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2457890/2474802]
comp;2785762..2785837;;atgi;rien;rien;410;-37;évidence faible1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2777344/2794256]
comp;2998984..2999057;;ggg;sigma FIS;rien;156;79;évidence faible;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2990565/3007477]
;3110366..3110441;;ttc;sigma FIS;Term 1;106;149;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3101948/3118860]
;3215598..3215673;;atgi;sigma -;Term 1;125;54;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3207180/3224092]
comp;3318213..3318289;;atgf;sigma FIS;Term 2;207;348;protéines1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3309795/3326707]
comp;3322072..3322158;;ctc;sigma -;Term 1;459;15;protéine2;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3313659/3330571]
comp;3708616..3708692;;ccg;sigma FIS;Term 2;911;92;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3700198/3717110]
;3836222..3836316;;tga;sigma -;rien;293;109;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3827813/3844725]
comp;4362551..4362626;;ttc;sigma FIS;Term 1;198;107;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4354133/4371045]
;4496405..4496489;;ttg;sigma FIS;Term 1;196;261;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4487991/4504903]

eco blocs[modifier | modifier le wikicode]

eco blocs;;;;
16s;68;16s;68;68
atc;42;atc;42;42
gca;174;gca;183;183
23s;92;23s;93;93
5s;12;5s;52;
acc;37;gac;;
5s;;;;
;;;;
16s;85;171;171;85
gaa;193;184;193;193
23s;92;92;92;93
5s;52;;;
gac;;;;

eco distribution[modifier | modifier le wikicode]

atgi;2;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;;tgc;;gta3;ttc;;tcc;;tac;1;tgc;1;gta3;ttc;;tcc;;tac;2;tgc;;gta3;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;4;agc;;ctg3;atc;;acc;1;aac;;agc;1;ctg3;atc;;acc;;aac;;agc;;ctg3;atc;;acc;1;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;gcc2;ctc;;ccc;;cac;1;cgt;;gcc2;ctc;;ccc;;cac;;cgt;4;gcc2;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;tac2;gtc;;gcc;;gac;;ggc;1;tac2;gtc;2;gcc;2;gac;;ggc;3;tac2;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;1;aaa3;tta;1;tca;;taa;;tga;;aaa3;tta;;tca;;taa;;tga;;aaa3;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;caa2;ata;;aca;1;aaa;3;aga;;caa2;ata;;aca;;aaa;3;aga;;caa2;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;cag2;cta;1;cca;1;caa;;cga;;cag2;cta;;cca;;caa;2;cga;;cag2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;atgf3;gta;2;gca;;gaa;;gga;1;atgf3;gta;3;gca;;gaa;;gga;;atgf3;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;ggc3;atgj;2;acg;;aag;;agg;;ggc3;atgj;;acg;;aag;;agg;;ggc3;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;3;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;(aaa gta)2 aaa3;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;(aaa gta)2 aaa3;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
eco;;23;;;;;23;;eco;20;;;;;;20;;eco;;23;;4;;;29;;eco;;;;4;;;4

eco données intercalaires[modifier | modifier le wikicode]

  • Lien tableau: eco données intercalaires
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
CDS-tRNA;;CDS-CDS;;;CDS-CDS;;;CDS-CDS;;;tRNA CDS;;rRNA CDS;;rRNA bloc;;tRNA tRNA;;Sup 400;Sup 400;Sup 600;Sup 500
effectif;;frequence;effectif;;frequence;effectif;;frequence;effectif;;intercalaire;;intercalaire;;intercalaire;;intercalaire;eco22;long;long;long;long
fxt;fct;eco;fx;fc;eco;fx40;fc40;eco;c-;x-;c;x;c;x;c;aa;c;aa;fx;;fx;
0;0;0;13;16;0;13;16;-1;162;0;162;242;CDS 16s ;;23s 5s;;tRNA tRNA;hors bloc;401;fc;604;512
1;0;10;35;345;1;4;43;-2;0;2;132;153;362;473;3* 93;;37;cag;403;401;611;513
0;1;20;10;265;2;6;51;-3;0;0;327;343;442;480;4* 92;;47;cag;405;403;615;526
0;0;30;18;135;3;10;44;-4;260;43;114;426;377;614;16s tRNA;;15;atgj;406;405;618;544
2;0;40;63;79;4;5;27;-5;0;0;379;735;373;;2* 171;gaa;34;caa;407;406;626;545
0;0;50;78;73;5;1;14;-6;0;0;164;233;5s CDS;;3* 68;atc;23;caa;417;410;641;556
2;0;60;51;104;6;3;13;-7;14;1;432;307;300;81;2* 85;gaa;9;cta;417;411;658;559
0;1;70;37;89;7;3;24;-8;59;1;253;569;74;228;tRNA 23s;;**;atgj;419;412;659;570
1;3;80;21;88;8;1;15;-9;0;2;206;93;;269;184;gaa;135;aaa;423;412;668;577
0;0;90;29;67;9;2;56;-10;6;0;67;452;;;174;gca;2;gta;424;414;674;578
2;3;100;34;82;10;0;58;-11;34;0;159;4;;;3* 193;gaa;149;aaa;425;421;714;597
0;4;110;36;83;11;2;48;-12;0;1;107;37;;;2* 183;gca;3;gta;429;422;728;601
0;2;120;32;58;12;3;39;-13;3;0;151;326;;;5s tRNA;;146;aaa;432;423;754;602
1;0;130;33;52;13;0;23;-14;14;5;100;55;;;12;acc;132;aaa;433;423;775;610
0;1;140;39;51;14;0;37;-15;0;0;313;235;;;2* 52;gac;**;aaa;434;424;796;616
1;1;150;28;50;15;1;23;-16;2;1;100;258;;;tRNA 5s;;209;tac;435;425;919;620
1;3;160;39;41;16;2;20;-17;10;0;74;264;;;37;acc;**;tac;435;428;950;630
0;2;170;32;41;17;1;19;-18;0;2;75;208;;;tRNA tRNA;intra;4;gtc;436;429;1372;634
0;0;180;22;41;18;0;19;-19;4;1;208;73;;;3* 42;atc gca;**;gtc;445;430;1455;657
0;0;190;30;37;19;0;14;-20;9;1;750;148;;;;;12;tta;453;434;;669
1;0;200;29;31;20;1;23;-21;0;2;280;124;;CDS-CDS;inf 50;;54;tgc;457;439;;680
1;4;210;35;36;21;1;17;-22;3;0;315;53;;intercalaire;;;**;ggc;462;450;;768
0;0;220;29;37;22;0;18;-23;6;1;155;347;;c-;x-;;39;ggc;470;451;;846
0;0;230;20;20;23;1;13;-24;0;2;78;292;;-2400;-723;;**;ggc;471;454;;852
2;1;240;24;18;24;6;19;-25;2;2;105;95;;-2202;-530;;44;gta;475;455;;
1;0;250;24;17;25;0;10;-26;7;1;206;361;;-2181;-527;;46;gta;482;456;;
1;1;260;22;26;26;1;14;-27;0;1;458;195;;-2130;-495;;4;gta;501;459;;
1;1;270;14;14;27;0;14;-28;3;1;14;38;;-1674;-436;;**;aaa;519;459;;
0;1;280;21;16;28;4;8;-29;4;1;910;;;-1295;-210;;198;cgt;519;464;;
0;0;290;17;21;29;2;9;-30;0;1;91;;;-897;-129;;62;cgt;523;469;;
1;0;300;9;17;30;3;13;-31;1;0;102;;;-729;-113;;198;cgt;524;473;;
1;0;310;9;13;31;3;6;-32;5;1;146;;;-448;-105;;3;cgt;536;473;;
0;2;320;16;12;32;3;7;-33;0;1;114;;;-242;-102;;**;agc;537;474;;
1;1;330;7;11;33;2;7;-34;0;0;106;;;-212;-86;;33;atgf;540;477;;
0;0;340;11;6;34;7;8;-35;1;3;210;;;-153;-82;;33;atgf;544;481;;
2;0;350;2;9;35;5;7;-36;0;0;233;;;-110;-63;;**;atgf;546;484;;
0;0;360;11;10;36;4;15;-37;1;0;267;;;-89;;;8;gac;586;494;;
1;0;370;7;12;37;11;7;-38;1;1;;;;-85;;;**;tgg;588;494;;
0;1;380;18;4;38;6;7;-39;0;1;;;;-82;;;57;cgg;;495;;
0;0;390;6;3;39;14;8;-40;0;0;;;;-82;;;20;cac;;498;;
0;0;400;6;10;40;8;7;-41;0;1;;;;-82;;;42;ctg;;498;;
4;4;reste;57;64;reste;935;1364;-42;0;0;;;;-82;;;**;cca;;;;
28;37;total;1074;2204;total;1074;2204;-43;8;0;;;;-82;;;8;aca;;;;
24;33;diagr;1004;2124;diagr;126;824;-44;1;1;;;;-82;;;116;tac;;;;
1;1;t30;63;745;;;;-45;0;0;;;;-82;;;6;gga;;;;
;;;;;;;;-46;0;0;;;;-75;;;**;acc;;;;
;Récapitulatif des effectifs;;;;;;;-47;0;0;;;;-66;;;36;ggc;;;;
;;>0;<0;zéro;total;*;;-48;0;1;;;;-56;;;35;ggc;;;;
;x;1061;95;13;1169;;;-49;1;0;;;;total;intercalaires;;**;ggc;;;;
;c;2188;647;16;2851;;;-50;1;0;;;;;501,283;;34;ctg;;;;
;;;;;4020;712;;reste;25;13;;;;ADN long;4,641,652;;28;ctg;;;;
;;;;;;4732;;total;647;95;;;;%;10.8;;**;ctg;;;;
;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;non RNA;570;;;;;;;

eco autres intercalaires aas[modifier | modifier le wikicode]

  • Lien tableau: eco autres intercalaires aas
  • Note: Ne contient que les données en effectifs des fréquences CDS-CDS et les autres intercalaires. Pour refaire les courbes il faut copier dans un tableur et formater.
;autres intercalaires;;eco27622;;;;
deb fin;comp;gene;adresse1;adresse2;intercalaire;autre inter;aas
deb;;CDS;14168;15298;88;;
;;mobile_el;15387;16731;-1287;*;
fin;;CDS;15445;16557;;;
deb;comp;CDS;16751;16960;-9;;
;;ncRNA;16952;17010;478;*;
fin;;CDS;17489;18655;;;
deb;;CDS;18715;19620;175;;
;comp;mobile_el;19796;20563;-753;*;
fin;comp;CDS;19811;20314;;;
deb;comp;CDS;74497;75480;35;;
;comp;ncRNA;75516;75608;35;*;
deb;comp;CDS;75644;77299;67;;
;;ncRNA;77367;77593;-206;*;
fin;;CDS;77388;77519;;;
deb;;CDS;91413;93179;-695;;
;;ncRNA;92485;92658;507;*;
fin;;CDS;93166;94653;;;
deb;comp;CDS;188712;189506;205;;
;;ncRNA;189712;189847;26;*;
fin;;CDS;189874;190599;;;
deb;;CDS;193521;194717;66;;
;;ncRNA;194784;194844;58;*;
fin;;CDS;194903;195664;;;
deb;;CDS;222833;223408;362;;
16s;;rRNA;223771;225312;68;*;
;;tRNA;225381;225457;42;*;atc
23s;;tRNA;225500;225575;183;*;gca
5s;;rRNA;225759;228662;93;*;
;;rRNA;228756;228875;52;*;
;;tRNA;228928;229004;162;*;gac
fin;;CDS;229167;229970;;;
deb;;CDS;236067;236798;132;;
;;tRNA;236931;237007;327;*;gac
fin;;CDS;237335;238120;;;
deb;comp;CDS;238257;238736;9;;
;comp;gene;238746;239084;105;*;
;;gene;239190;239378;40;*;
fin;comp;CDS;239419;240189;;;
deb;;CDS;247637;248134;223;;
;comp;gene;248358;250070;1;*;
;;gene;250072;250827;70;*;
fin;;CDS;250898;251953;;;
deb;;CDS;252709;253161;305;;
;;gene;253467;253733;-32;*;
;;gene;253702;254202;56;*;
fin;comp;CDS;254259;255716;;;
deb;;CDS;256527;257771;57;;
;;misc_f;257829;257899;8;*;
;comp;mobile_el;257908;258675;-753;*;
fin;comp;CDS;257923;258426;;;
deb;comp;CDS;258345;258620;55;;
;;misc_f;258676;259006;38;*;
fin;comp;CDS;259045;260100;;;
deb;;CDS;261503;262756;114;;
;;tRNA;262871;262946;-49;*;acg
;;misc_f;262898;297205;-34056;*;
;comp;gene;263150;263212;115;*;
fin;comp;CDS;263328;263669;;;
deb;comp;CDS;266110;266553;-1;;
;comp;gene;266553;266774;1;*;
;comp;gene;266776;266967;216;*;
fin;comp;CDS;267184;268005;;;
deb;comp;CDS;269289;270182;23;;
;;mobile_el;270206;270540;-263;*;
;;misc_f;270278;270540;0;*;
;;mobile_el;270541;271761;-1159;*;
deb;;CDS;270603;271754;7;;
;;mobile_el;271762;272190;-427;*;
;;misc_f;271764;272190;389;*;
;;ncRNA;272580;272654;192;*;
deb;;CDS;272847;273992;-38;;
;comp;mobile_el;273955;275149;-1049;*;
fin;comp;CDS;274101;275081;;;
deb;comp;CDS;277756;278802;11;;
;comp;gene;278814;279162;0;*;
;comp;mobile_el;279163;279930;-753;*;
fin;comp;CDS;279178;279681;;;
deb;comp;CDS;279600;279875;55;;
;;gene;279931;280104;-174;*;
;;mobile_el;279931;280111;2;*;
;comp;gene;280114;280362;-249;*;
;comp;mobile_el;280114;280425;-41;*;
fin;comp;CDS;280385;280735;;;
deb;;CDS;290510;290638;-5;;
;comp;mobile_el;290634;291401;-753;*;
fin;comp;CDS;290649;291152;;;
deb;comp;CDS;313141;313242;473;;
;comp;gene;313716;313805;551;*;
;;gene;314357;315244;-16;*;
;;mobile_el;315229;316483;-1193;*;
fin;;CDS;315291;315590;;;
deb;;CDS;315587;316453;-4;;
;comp;gene;316450;317136;302;*;
;;gene;317439;317567;158;*;
fin;comp;CDS;317726;318319;;;
deb;comp;CDS;380069;380842;1;;
;comp;misc_f;380844;381260;-1;*;
;;mobile_el;381260;382590;-1240;*;
fin;;CDS;381351;381716;;;
deb;;CDS;381674;382579;11;;
;comp;misc_f;382591;382872;-134;*;
fin;comp;CDS;382739;383935;;;
deb;comp;CDS;388753;389727;523;;
;;misc_f;390251;391708;-117;*;
deb;comp;CDS;391592;391648;60;;
;comp;mobile_el;391709;392966;-1228;*;
fin;comp;CDS;391739;392605;;;
deb;comp;CDS;392602;392901;68;;
;;misc_f;392970;394418;87;*;
fin;;CDS;394506;395129;;;
deb;;CDS;408177;408461;147;;
;;gene;408609;408950;-4;*;
fin;;CDS;408947;409030;;;
deb;comp;CDS;475982;476371;76;;
;;ncRNA;476448;476561;110;*;
fin;;CDS;476672;477025;;;
deb;comp;CDS;506603;507082;121;;
;;ncRNA;507204;507287;-2;*;
fin;comp;CDS;507286;508080;;;
deb;;CDS;527581;527949;-1;;
;;gene;527949;528659;-20;*;
;;gene;528640;529130;366;*;
;;gene;529497;529592;52;*;
fin;comp;CDS;529645;530016;;;
deb;;CDS;533011;533826;-198;;
;;ncRNA;533629;533863;52;*;
fin;;CDS;533916;535697;;;
deb;comp;CDS;563848;564480;242;;
;;tRNA;564723;564799;-45;*;aga
;;misc_f;564755;586056;-21242;*;
deb;comp;CDS;564815;565978;-121;;
;comp;gene;565858;566079;18;*;
;comp;gene;566098;566361;14;*;
;;gene;566376;566687;-4;*;
;;misc_f;566684;566776;0;*;
;;mobile_el;566777;568034;-1193;*;
fin;;CDS;566842;567141;;;
deb;;CDS;567138;568004;30;;
;;misc_f;568035;568247;67;*;
fin;;CDS;568315;568647;;;
deb;;CDS;573956;574339;189;;
;comp;misc_f;574529;574586;4;*;
;comp;mobile_el;574591;575785;-1049;*;
deb;comp;CDS;574737;575717;68;;
;comp;misc_f;575786;576825;572;*;
fin;;CDS;577398;577613;;;
deb;;CDS;580834;581379;-26;;
;;gene;581354;581662;-129;*;
deb;;CDS;581534;582097;54;;
;comp;gene;582152;582806;68;*;
fin;;CDS;582875;583060;;;
deb;comp;CDS;606265;607383;349;;
;comp;ncRNA;607733;607792;43;*;
deb;;CDS;607836;607988;18;;
;;mobile_el;608007;609351;-1287;*;
fin;;CDS;608065;609177;;;
deb;comp;CDS;657555;657938;92;;
;;gene;658031;658818;128;*;
fin;;CDS;658947;659150;;;
deb;comp;CDS;685929;686669;11;;
;comp;ncRNA;686681;686843;-5;*;
deb;comp;CDS;686839;687747;103;;
;comp;mobile_el;687851;689045;-1049;*;
fin;comp;CDS;687997;688977;;;
deb;;CDS;695101;696276;153;;
;comp;tRNA;696430;696504;37;*;cag
;comp;tRNA;696542;696616;47;*;cag
;comp;tRNA;696664;696740;15;*;atgj
;comp;tRNA;696756;696830;34;*;caa
;comp;tRNA;696865;696939;23;*;caa
;comp;tRNA;696963;697047;9;*;cta
;comp;tRNA;697057;697133;379;*;atgj
fin;comp;CDS;697513;699177;;;
deb;;CDS;706093;707757;478;;
;;ncRNA;708236;708333;0;*;
fin;;CDS;708334;709740;;;
deb;;CDS;715412;715906;40;;
;comp;gene;715947;716597;123;*;
;comp;gene;716721;716870;75;*;
fin;comp;CDS;716946;718265;;;
deb;;CDS;733776;734102;117;;
;;gene;734220;735653;-4;*;
fin;;CDS;735650;736219;;;
deb;;CDS;736445;736699;200;;
;;gene;736900;737961;130;*;
fin;;CDS;738092;738853;;;
deb;;CDS;764180;765049;0;;
;;ncRNA;765050;765150;2;*;
fin;comp;CDS;765153;765875;;;
deb;;CDS;779598;780389;164;;
;;tRNA;780554;780629;135;*;aaa
;;tRNA;780765;780840;2;*;gta
;;tRNA;780843;780918;149;*;aaa
;;tRNA;781068;781143;3;*;gta
;;tRNA;781147;781222;146;*;aaa
;;tRNA;781369;781444;132;*;aaa
;;tRNA;781577;781652;432;*;aaa
fin;;CDS;782085;783128;;;
deb;;CDS;836351;837436;-2;;
;comp;ncRNA;837435;837531;-29;*;
fin;;CDS;837503;837562;;;
deb;comp;CDS;851014;852597;127;;
;comp;ncRNA;852725;853064;-196;*;
fin;comp;CDS;852869;852997;;;
deb;;CDS;887423;887959;19;;
;comp;ncRNA;887979;888057;76;*;
fin;comp;CDS;888134;889819;;;
deb;;CDS;923264;925540;343;;
;comp;tRNA;925884;925971;253;*;tcc
fin;comp;CDS;926225;926443;;;
deb;comp;CDS;1030759;1031418;206;;
;comp;tRNA;1031625;1031712;426;*;tca
fin;;CDS;1032139;1033257;;;
deb;comp;CDS;1049439;1049744;33;;
;;mobile_el;1049778;1050545;-713;*;
fin;;CDS;1049833;1050108;;;
deb;;CDS;1079305;1080813;542;;
;;gene;1081356;1082185;57;*;
fin;;CDS;1082243;1083370;;;
deb;;CDS;1092876;1094234;10;;
;comp;mobile_el;1094245;1095502;-1228;*;
fin;comp;CDS;1094275;1095141;;;
deb;comp;CDS;1095138;1095437;106;;
;;gene;1095544;1095846;-4;*;
deb;;CDS;1095843;1096829;735;;
;comp;tRNA;1097565;1097652;233;*;tcc
fin;;CDS;1097886;1098824;;;
deb;;CDS;1140033;1140986;-1;;
;;ncRNA;1140986;1141063;118;*;
fin;comp;CDS;1141182;1144367;;;
deb;comp;CDS;1146011;1146595;-7;;
;;ncRNA;1146589;1146757;36;*;
fin;;CDS;1146794;1147315;;;
deb;;CDS;1169073;1169330;-28;;
;;ncRNA;1169303;1169402;9;*;
fin;comp;CDS;1169412;1170374;;;
deb;;CDS;1195123;1196373;-165;;
;;misc_f;1196209;1211412;-14702;*;
;;ncRNA;1196711;1196782;84;*;
fin;comp;CDS;1196867;1197532;;;
deb;;CDS;1203822;1204160;9;;
;;gene;1204170;1204403;-234;*;
deb;;CDS;1204170;1205537;-1137;;
;;gene;1204401;1205537;11;*;
fin;;CDS;1205549;1205731;;;
deb;;CDS;1205731;1206204;-74;;
;;gene;1206131;1206922;-10;*;
fin;;CDS;1206913;1207497;;;
deb;comp;CDS;1208517;1209119;-1;;
;comp;gene;1209119;1209655;29;*;
fin;;CDS;1209685;1210239;;;
deb;;CDS;1210346;1211179;233;;
;;gene;1211413;1211577;102;*;
fin;comp;CDS;1211680;1212003;;;
deb;;CDS;1218983;1219201;399;;
;;gene;1219601;1222248;56;*;
fin;comp;CDS;1222305;1222634;;;
deb;;CDS;1223264;1223449;114;;
;;gene;1223564;1223907;371;*;
fin;comp;CDS;1224279;1224545;;;
deb;;CDS;1238879;1239949;238;;
;;mobile_el;1240188;1240289;-30;*;
fin;;CDS;1240260;1240463;;;
deb;comp;CDS;1269168;1269275;47;;
;;ncRNA;1269323;1269389;313;*;
deb;comp;CDS;1269703;1269810;47;;
;;ncRNA;1269858;1269923;314;*;
deb;comp;CDS;1270238;1270345;47;;
;;ncRNA;1270393;1270460;288;*;
fin;comp;CDS;1270749;1271849;;;
deb;;CDS;1277957;1279348;-12;;
;;ncRNA;1279337;1279520;343;*;
fin;;CDS;1279864;1283607;;;
deb;;CDS;1286709;1286984;81;;
;comp;ncRNA;1287066;1287236;-150;*;
deb;comp;CDS;1287087;1287176;67;;
;comp;tRNA;1287244;1287328;209;*;tac
;comp;tRNA;1287538;1287622;159;*;tac
fin;comp;CDS;1287782;1288624;;;
deb;;CDS;1293527;1294144;281;;
;comp;gene;1294426;1295322;-897;*;
;comp;mobile_el;1294426;1295405;40;*;
fin;comp;CDS;1295446;1298121;;;
deb;;CDS;1298598;1299245;253;;
;;mobile_el;1299499;1300693;-1127;*;
fin;;CDS;1299567;1300547;;;
deb;;CDS;1380148;1380807;13;;
;;gene;1380821;1381789;-1;*;
;;gene;1381789;1381902;44;*;
fin;;CDS;1381947;1382852;;;
deb;comp;CDS;1394891;1395922;121;;
;;mobile_el;1396044;1397238;-1127;*;
fin;;CDS;1396112;1397092;;;
deb;;CDS;1404741;1405649;8;;
;comp;ncRNA;1405658;1405751;227;*;
fin;;CDS;1405979;1406542;;;
deb;;CDS;1408050;1409033;95;;
;;ncRNA;1409129;1409250;57;*;
fin;;CDS;1409308;1409481;;;
deb;comp;CDS;1411013;1411948;-50;;
;;misc_f;1411899;1434958;-22959;*;
fin;comp;CDS;1412000;1413235;;;
deb;comp;CDS;1413531;1413740;-185;;
;;ncRNA;1413556;1413734;-2;*;
fin;comp;CDS;1413733;1413927;;;
deb;comp;CDS;1418008;1418229;175;;
;comp;ncRNA;1418405;1418502;168;*;
fin;;CDS;1418671;1419159;;;
deb;;CDS;1422752;1423312;32;;
;;gene;1423345;1423644;-245;*;
fin;;CDS;1423400;1423585;;;
deb;;CDS;1426454;1427482;-94;;
;;misc_f;1427389;1427598;0;*;
;comp;mobile_el;1427599;1428794;-1049;*;
deb;comp;CDS;1427746;1428726;69;;
;;misc_f;1428796;1428984;64;*;
fin;;CDS;1429049;1432411;;;
deb;comp;CDS;1434293;1434406;551;;
;comp;gene;1434958;1435008;176;*;
fin;comp;CDS;1435185;1435619;;;
deb;comp;CDS;1435760;1436893;227;;
;;ncRNA;1437121;1437231;28;*;
fin;comp;CDS;1437260;1440784;;;
deb;comp;CDS;1465165;1465230;161;;
;;misc_f;1465392;1467909;0;*;
;comp;mobile_el;1467910;1469240;-1320;*;
fin;comp;CDS;1467921;1468826;;;
deb;comp;CDS;1468784;1469149;96;;
;;misc_f;1469246;1469295;0;*;
;;mobile_el;1469296;1470516;-1159;*;
deb;;CDS;1469358;1470509;9;;
;;misc_f;1470519;1474013;207;*;
fin;;CDS;1474221;1475081;;;
deb;;CDS;1488232;1489671;41;;
;comp;gene;1489713;1490713;188;*;
deb;;CDS;1490902;1491432;9;;
;comp;ncRNA;1491442;1491506;170;*;
fin;;CDS;1491677;1491850;;;
deb;comp;CDS;1491962;1492129;-11;;
;;ncRNA;1492119;1492175;294;*;
fin;;CDS;1492470;1494110;;;
deb;;CDS;1502457;1503125;35;;
;;mobile_el;1503161;1504908;-1691;*;
;comp;gene;1503218;1503649;7;*;
fin;;CDS;1503657;1504865;;;
deb;;CDS;1526940;1527152;737;;
;;gene;1527890;1529938;-17;*;
fin;;CDS;1529922;1530404;;;
deb;comp;CDS;1530319;1530504;81;;
;;gene;1530586;1531639;176;*;
fin;;CDS;1531816;1532952;;;
deb;comp;CDS;1542672;1544060;323;;
;comp;gene;1544384;1544719;38;*;
fin;comp;CDS;1544758;1545714;;;
deb;comp;CDS;1588853;1590001;332;;
;comp;gene;1590334;1590536;317;*;
fin;comp;CDS;1590854;1592176;;;
deb;comp;CDS;1592176;1592442;222;;
;comp;gene;1592665;1598086;530;*;
fin;comp;CDS;1598617;1600209;;;
deb;;CDS;1622741;1622845;-29;;
;comp;ncRNA;1622817;1622914;45;*;
fin;comp;CDS;1622960;1623850;;;
deb;comp;CDS;1631002;1632285;-9;;
;;misc_f;1632277;1652745;-19856;*;
fin;;CDS;1632890;1633003;;;
deb;;CDS;1648823;1649041;340;;
;;ncRNA;1649382;1649434;174;*;
fin;;CDS;1649609;1649797;;;
deb;;CDS;1649794;1649985;92;;
;;gene;1650078;1650998;-156;*;
;;mobile_el;1650843;1651548;-668;*;
;;gene;1650881;1651537;-26;*;
;;gene;1651512;1652708;19;*;
fin;comp;CDS;1652728;1652838;;;
deb;comp;CDS;1744871;1746127;307;;
;;tRNA;1746435;1746511;4;*;gtc
;;tRNA;1746516;1746592;107;*;gtc
fin;;CDS;1746700;1747005;;;
deb;comp;CDS;1764018;1764386;326;;
;comp;ncRNA;1764713;1764780;153;*;
fin;comp;CDS;1764934;1765122;;;
deb;;CDS;1769074;1770186;185;;
;;ncRNA;1770372;1770477;137;*;
fin;;CDS;1770615;1770971;;;
deb;comp;CDS;1800642;1802570;523;;
;;gene;1803094;1804993;171;*;
fin;;CDS;1805165;1805272;;;
deb;comp;CDS;1922313;1922969;96;;
;;ncRNA;1923066;1923337;-234;*;
;comp;ncRNA;1923104;1923207;157;*;
fin;comp;CDS;1923365;1923706;;;
deb;comp;CDS;1957032;1958132;308;;
;comp;ncRNA;1958441;1958520;-1;*;
fin;comp;CDS;1958520;1959266;;;
deb;comp;CDS;1976252;1977139;68;;
;comp;ncRNA;1977208;1977302;-37;*;
fin;comp;CDS;1977266;1977844;;;
deb;comp;CDS;1977847;1978197;305;;
;comp;mobile_el;1978503;1979270;-753;*;
fin;comp;CDS;1978518;1979021;;;
deb;comp;CDS;1990954;1991619;128;;
;comp;ncRNA;1991748;1991814;0;*;
;comp;tRNA;1991815;1991901;12;*;tta
;comp;tRNA;1991914;1991987;54;*;tgc
;comp;tRNA;1992042;1992117;151;*;ggc
fin;comp;CDS;1992269;1992817;;;
deb;comp;CDS;1996110;1996832;88;;
;;ncRNA;1996921;1997057;4;*;
fin;comp;CDS;1997062;1997814;;;
deb;comp;CDS;2001070;2001789;122;;
;comp;ncRNA;2001912;2002106;3;*;
fin;comp;CDS;2002110;2003606;;;
deb;;CDS;2010600;2011079;143;;
;comp;gene;2011223;2012351;150;*;
;;misc_f;2012502;2012663;-162;*;
;;gene;2012502;2012780;-81;*;
fin;comp;CDS;2012700;2013014;;;
deb;;CDS;2024986;2025213;9;;
;comp;ncRNA;2025223;2025313;197;*;
fin;;CDS;2025511;2026326;;;
deb;comp;CDS;2033119;2033421;227;;
;;ncRNA;2033649;2033739;311;*;
;;gene;2034051;2035243;591;*;
fin;;CDS;2035835;2036686;;;
deb;;CDS;2042368;2042898;569;;
;comp;tRNA;2043468;2043557;93;*;tcg
deb;;CDS;2043651;2044448;100;;
;;tRNA;2044549;2044624;313;*;aac
deb;;CDS;2044938;2052014;261;;
;comp;gene;2052276;2053328;314;*;
fin;;CDS;2053643;2054959;;;
deb;;CDS;2056858;2057574;452;;
;comp;tRNA;2058027;2058102;100;*;aac
deb;comp;CDS;2058203;2059846;4;;
;;tRNA;2059851;2059926;37;*;aac
fin;comp;CDS;2059964;2060914;;;
deb;comp;CDS;2061016;2061933;326;;
;;tRNA;2062260;2062335;55;*;aac
fin;comp;CDS;2062391;2063323;;;
deb;comp;CDS;2065219;2065764;255;;
;;misc_f;2066020;2078748;-12681;*;
;comp;gene;2066068;2066154;4;*;
;comp;mobile_el;2066159;2067353;-1049;*;
deb;comp;CDS;2066305;2067285;74;;
;comp;gene;2067360;2067892;368;*;
;comp;gene;2068261;2068419;215;*;
;;misc_f;2068635;2068940;0;*;
;comp;mobile_el;2068941;2070271;-1320;*;
fin;comp;CDS;2068952;2069857;;;
deb;comp;CDS;2069815;2070180;96;;
;;misc_f;2070277;2070474;311;*;
;;gene;2070786;2071211;105;*;
;;ncRNA;2071317;2071511;27;*;
fin;;CDS;2071539;2074658;;;
deb;;CDS;2077940;2078134;414;;
;comp;gene;2078549;2078677;-103;*;
fin;;CDS;2078575;2078931;;;
deb;comp;CDS;2099862;2101268;127;;
;comp;misc_f;2101396;2101744;4;*;
;comp;mobile_el;2101749;2102943;-1049;*;
deb;comp;CDS;2101895;2102875;68;;
;comp;misc_f;2102944;2103389;1;*;
fin;comp;CDS;2103391;2104509;;;
deb;comp;CDS;2152469;2153128;182;;
;;ncRNA;2153311;2153454;-106;*;
deb;comp;CDS;2153349;2153408;237;;
;;ncRNA;2153646;2153781;-101;*;
fin;comp;CDS;2153681;2153737;;;
deb;;CDS;2165668;2167029;84;;
;;ncRNA;2167114;2167200;-18;*;
;;misc_f;2167183;2167811;-510;*;
deb;comp;CDS;2167302;2167520;81;;
;comp;gene;2167602;2167820;168;*;
fin;comp;CDS;2167989;2168306;;;
deb;;CDS;2168712;2169611;81;;
;comp;misc_f;2169693;2170167;3;*;
;;mobile_el;2170171;2171428;-1193;*;
fin;;CDS;2170236;2170535;;;
deb;;CDS;2170532;2171398;30;;
;comp;misc_f;2171429;2171727;105;*;
deb;comp;CDS;2171833;2172873;47;;
;comp;gene;2172921;2174278;3;*;
fin;comp;CDS;2174282;2174566;;;
deb;;CDS;2196474;2197298;111;;
;;gene;2197410;2200269;9;*;
fin;;CDS;2200279;2203911;;;
deb;comp;CDS;2226509;2227270;52;;
;comp;gene;2227323;2228758;223;*;
fin;;CDS;2228982;2229065;;;
deb;;CDS;2284376;2286136;74;;
;;tRNA;2286211;2286287;102;*;ccc
;comp;misc_f;2286390;2288914;4;*;
;comp;mobile_el;2288919;2290113;-1049;*;
deb;comp;CDS;2289065;2290045;68;;
;comp;misc_f;2290114;2290180;319;*;
fin;;CDS;2290500;2291147;;;
deb;comp;CDS;2311646;2312749;334;;
;;ncRNA;2313084;2313176;311;*;
fin;;CDS;2313488;2316160;;;
deb;comp;CDS;2328148;2329797;0;;
;comp;gene;2329798;2334402;-67;*;
fin;comp;CDS;2334336;2334959;;;
deb;comp;CDS;2348822;2349472;214;;
;;gene;2349687;2349893;41;*;
fin;comp;CDS;2349935;2351011;;;
deb;;CDS;2356904;2357803;12;;
;;gene;2357816;2358001;40;*;
fin;comp;CDS;2358042;2358845;;;
deb;comp;CDS;2451584;2452336;19;;
;comp;gene;2452356;2455001;81;*;
fin;comp;CDS;2455083;2455646;;;
deb;;CDS;2465301;2466233;75;;
;;tRNA;2466309;2466383;-15;*;agg
;;misc_f;2466369;2476583;-10039;*;
fin;;CDS;2466545;2467702;;;
deb;comp;CDS;2470497;2470643;159;;
;;gene;2470803;2471105;-29;*;
deb;comp;CDS;2471077;2471517;26;;
;comp;gene;2471544;2472062;49;*;
fin;comp;CDS;2472112;2472387;;;
deb;;CDS;2476310;2476510;73;;
;;gene;2476584;2476598;95;*;
fin;comp;CDS;2476694;2477629;;;
deb;;CDS;2513042;2514244;28;;
;;mobile_el;2514273;2515617;-1287;*;
fin;;CDS;2514331;2515443;;;
deb;comp;CDS;2515643;2517832;208;;
;comp;tRNA;2518041;2518116;39;*;ggc
;comp;tRNA;2518156;2518231;235;*;ggc
fin;;CDS;2518467;2518811;;;
deb;comp;CDS;2519257;2520672;258;;
;;tRNA;2520931;2521006;44;*;gta
;;tRNA;2521051;2521126;46;*;gta
;;tRNA;2521173;2521248;4;*;gta
;;tRNA;2521253;2521328;264;*;aaa
fin;comp;CDS;2521593;2522477;;;
deb;comp;CDS;2557318;2558679;11;;
;;misc_f;2558691;2565480;-6623;*;
fin;;CDS;2558858;2560066;;;
deb;comp;CDS;2639301;2640575;19;;
;comp;ncRNA;2640595;2640686;-1;*;
fin;comp;CDS;2640686;2641804;;;
deb;;CDS;2652494;2653339;16;;
;comp;ncRNA;2653356;2653455;399;*;
;;ncRNA;2653855;2654158;-158;*;
fin;;CDS;2654001;2654126;;;
deb;comp;CDS;2689671;2691098;58;;
;comp;ncRNA;2691157;2691340;315;*;
fin;comp;CDS;2691656;2695543;;;
deb;comp;CDS;2700117;2700197;322;;
;;ncRNA;2700520;2700598;19;*;
fin;comp;CDS;2700618;2700998;;;
deb;;CDS;2725925;2725987;81;;
5s;comp;rRNA;2726069;2726188;92;*;
23s;comp;rRNA;2726281;2729184;184;*;
;comp;tRNA;2729369;2729444;171;*;gaa
16s;comp;rRNA;2729616;2731157;442;*;
fin;comp;CDS;2731600;2733729;;;
deb;comp;CDS;2731600;2734173;-21;;
;comp;ncRNA;2734153;2734295;7;*;
fin;comp;CDS;2734303;2735034;;;
deb;;CDS;2737154;2737495;-115;;
;;ncRNA;2737381;2737542;56;*;
fin;;CDS;2737599;2737646;;;
deb;;CDS;2754896;2755378;214;;
;;ncRNA;2755593;2755955;-15;*;
;;misc_f;2755941;2777971;-21813;*;
fin;;CDS;2756159;2757400;;;
deb;comp;CDS;2771840;2772154;12;;
;comp;gene;2772167;2773182;135;*;
deb;;CDS;2773318;2775021;523;;
;;gene;2775545;2775816;102;*;
fin;;CDS;2775919;2776377;;;
deb;;CDS;2777453;2777782;189;;
;;gene;2777972;2777985;160;*;
deb;comp;CDS;2778146;2782726;338;;
;comp;gene;2783065;2783304;333;*;
fin;comp;CDS;2783638;2784429;;;
deb;comp;CDS;2784529;2785011;750;;
;comp;tRNA;2785762;2785837;559;*;atgi
;;gene;2786397;2788649;335;*;
fin;;CDS;2788985;2789962;;;
deb;;CDS;2807132;2808124;191;;
;;gene;2808316;2809493;123;*;
fin;;CDS;2809617;2810354;;;
deb;comp;CDS;2814218;2814733;68;;
;;ncRNA;2814802;2814874;8;*;
fin;comp;CDS;2814883;2816439;;;
deb;comp;CDS;2816937;2817503;280;;
;comp;tRNA;2817784;2817860;198;*;cgt
;comp;tRNA;2818059;2818135;62;*;cgt
;comp;tRNA;2818198;2818274;198;*;cgt
;comp;tRNA;2818473;2818549;3;*;cgt
;comp;tRNA;2818553;2818645;315;*;agc
fin;comp;CDS;2818961;2819146;;;
deb;comp;CDS;2884553;2887219;133;;
;;ncRNA;2887353;2887411;166;*;
fin;comp;CDS;2887578;2888312;;;
deb;comp;CDS;2923784;2924113;42;;
;comp;ncRNA;2924156;2924524;210;*;
fin;comp;CDS;2924735;2925280;;;
deb;comp;CDS;2941650;2942567;128;;
;;ncRNA;2942696;2942901;16;*;
fin;comp;CDS;2942918;2943145;;;
deb;comp;CDS;2946081;2947178;208;;
;;tRNA;2947387;2947463;33;*;atgf
;;tRNA;2947497;2947573;33;*;atgf
;;tRNA;2947607;2947683;73;*;atgf
fin;comp;CDS;2947757;2949010;;;
deb;comp;CDS;2973855;2976014;87;;
;comp;ncRNA;2976102;2976189;114;*;
;comp;ncRNA;2976304;2976385;213;*;
fin;;CDS;2976599;2977630;;;
deb;comp;CDS;2989935;2990360;193;;
;;gene;2990554;2991043;224;*;
fin;;CDS;2991268;2991759;;;
deb;;CDS;2993638;2993856;82;;
;;gene;2993939;2994441;18;*;
;comp;gene;2994460;2994903;33;*;
;comp;gene;2994937;2995092;221;*;
;comp;gene;2995314;2996020;-59;*;
;comp;gene;2995962;2996360;0;*;
;comp;mobile_el;2996361;2997691;-1320;*;
fin;comp;CDS;2996372;2997277;;;
deb;comp;CDS;2997235;2997600;88;;
;comp;gene;2997689;2997988;45;*;
deb;comp;CDS;2998034;2998828;155;;
;comp;tRNA;2998984;2999057;78;*;ggg
fin;comp;CDS;2999136;2999891;;;
deb;;CDS;3055612;3055941;41;;
;;ncRNA;3055983;3056165;75;*;
deb;;CDS;3056241;3056789;61;;
;;ncRNA;3056851;3056991;-102;*;
fin;comp;CDS;3056890;3056949;;;
deb;comp;CDS;3058666;3059325;55;;
;comp;gene;3059381;3059611;141;*;
fin;;CDS;3059753;3060646;;;
deb;;CDS;3109553;3110260;105;;
;;tRNA;3110366;3110441;148;*;ttc
fin;comp;CDS;3110590;3111126;;;
deb;comp;CDS;3129043;3130215;-70;;
;;mobile_el;3130146;3131340;-1127;*;
fin;;CDS;3130214;3131194;;;
deb;comp;CDS;3146450;3146737;118;;
;comp;gene;3146856;3147691;-95;*;
fin;comp;CDS;3147597;3147740;;;
deb;;CDS;3185414;3185965;59;;
;;misc_f;3186025;3186095;0;*;
;;mobile_el;3186096;3187426;-1240;*;
fin;;CDS;3186187;3186552;;;
deb;;CDS;3186510;3187415;16;;
;;misc_f;3187432;3189865;15;*;
fin;;CDS;3189881;3190630;;;
deb;;CDS;3192864;3194525;195;;
;comp;ncRNA;3194721;3194865;-100;*;
deb;;CDS;3194766;3194825;271;;
;comp;ncRNA;3195097;3195240;-100;*;
fin;;CDS;3195141;3195200;;;
deb;comp;CDS;3214967;3215473;124;;
;;tRNA;3215598;3215673;53;*;atgi
fin;comp;CDS;3215727;3216491;;;
deb;;CDS;3268415;3269602;613;;
;comp;ncRNA;3270216;3270592;32;*;
fin;comp;CDS;3270625;3271770;;;
deb;;CDS;3280217;3280690;10;;
;;gene;3280701;3281102;19;*;
;;gene;3281122;3281625;350;*;
fin;;CDS;3281976;3283130;;;
deb;comp;CDS;3309033;3311168;14;;
;;ncRNA;3311183;3311398;16;*;
fin;comp;CDS;3311415;3311684;;;
deb;comp;CDS;3317554;3318006;206;;
;comp;tRNA;3318213;3318289;347;*;atgf
fin;;CDS;3318637;3319980;;;
deb;comp;CDS;3319988;3321613;458;;
;comp;tRNA;3322072;3322158;14;*;ctc
fin;comp;CDS;3322173;3322505;;;
deb;comp;CDS;3349806;3350459;117;;
;;ncRNA;3350577;3350697;-9;*;
fin;comp;CDS;3350689;3353025;;;
deb;;CDS;3362807;3365188;-4;;
;;misc_f;3365185;3365555;0;*;
;comp;mobile_el;3365556;3366750;-1049;*;
deb;comp;CDS;3365702;3366682;72;;
;;misc_f;3366755;3366929;-4;*;
fin;;CDS;3366926;3367642;;;
deb;;CDS;3403484;3404458;36;;
;;gene;3404495;3404637;0;*;
;;gene;3404638;3405031;404;*;
fin;;CDS;3405436;3405906;;;
deb;;CDS;3418390;3418611;430;;
;;gene;3419042;3420066;67;*;
fin;;CDS;3420134;3421315;;;
deb;;CDS;3422436;3423194;228;;
5s;comp;rRNA;3423423;3423542;37;*;
;comp;tRNA;3423580;3423655;12;*;acc
5s;comp;rRNA;3423668;3423787;92;*;
23s;comp;rRNA;3423880;3426783;174;*;
;comp;tRNA;3426958;3427033;42;*;gca
;comp;tRNA;3427076;3427152;68;*;atc
16s;comp;rRNA;3427221;3428762;473;*;
fin;;CDS;3429236;3429790;;;
deb;;CDS;3558268;3559866;-19;;
;comp;gene;3559848;3560605;16;*;
fin;comp;CDS;3560622;3561452;;;
deb;comp;CDS;3579768;3580805;116;;
;comp;ncRNA;3580922;3581016;121;*;
fin;;CDS;3581138;3581626;;;
deb;;CDS;3581863;3583041;-4;;
;;misc_f;3583038;3583427;0;*;
;;mobile_el;3583428;3584195;-713;*;
fin;;CDS;3583483;3583758;;;
deb;;CDS;3583677;3584180;24;;
;;misc_f;3584205;3584309;94;*;
fin;;CDS;3584404;3584559;;;
deb;;CDS;3623399;3623782;104;;
;;gene;3623887;3624132;245;*;
fin;;CDS;3624378;3625514;;;
deb;comp;CDS;3630968;3632590;261;;
;comp;gene;3632852;3634458;382;*;
fin;;CDS;3634841;3635893;;;
deb;comp;CDS;3647705;3647788;274;;
;;ncRNA;3648063;3648144;149;*;
;;ncRNA;3648294;3648375;152;*;
fin;;CDS;3648528;3648881;;;
deb;;CDS;3650237;3650662;628;;
;;misc_f;3651291;3652036;-1;*;
;comp;mobile_el;3652036;3653230;-1049;*;
deb;comp;CDS;3652182;3653162;73;;
;;misc_f;3653236;3653713;247;*;
fin;;CDS;3653961;3654527;;;
deb;;CDS;3656995;3657567;417;;
;comp;ncRNA;3657985;3658054;311;*;
deb;;CDS;3658366;3658893;98;;
;;ncRNA;3658992;3659082;149;*;
fin;;CDS;3659232;3660389;;;
deb;comp;CDS;3663890;3664618;245;;
;;ncRNA;3664864;3664969;16;*;
fin;comp;CDS;3664986;3665810;;;
deb;comp;CDS;3692618;3695236;-4;;
;comp;gene;3695233;3695985;11;*;
fin;comp;CDS;3695997;3696185;;;
deb;comp;CDS;3699980;3700087;48;;
;;ncRNA;3700136;3700199;363;*;
fin;;CDS;3700563;3701834;;;
deb;comp;CDS;3706098;3707705;910;;
;comp;tRNA;3708616;3708692;91;*;ccg
fin;comp;CDS;3708784;3710475;;;
deb;comp;CDS;3720448;3720600;-153;;
;comp;gene;3720448;3720632;0;*;
;;mobile_el;3720633;3722075;-1396;*;
fin;;CDS;3720680;3721201;;;
deb;;CDS;3721198;3722049;27;;
;;gene;3722077;3722111;216;*;
fin;comp;CDS;3722328;3724397;;;
deb;comp;CDS;3727917;3729371;14;;
;comp;ncRNA;3729386;3729545;-103;*;
fin;comp;CDS;3729443;3730765;;;
deb;;CDS;3750086;3750781;31;;
;comp;gene;3750813;3750914;3;*;
;;gene;3750918;3751109;18;*;
fin;comp;CDS;3751128;3751868;;;
deb;;CDS;3766337;3767179;41;;
;;gene;3767221;3767922;254;*;
deb;;CDS;3768177;3768638;0;;
;;gene;3768639;3768890;1;*;
;;gene;3768892;3769256;88;*;
deb;;CDS;3769345;3769680;267;;
;;gene;3769948;3770146;96;*;
fin;comp;CDS;3770243;3771379;;;
deb;comp;CDS;3807064;3808098;67;;
;comp;ncRNA;3808166;3808238;301;*;
fin;;CDS;3808540;3809817;;;
deb;comp;CDS;3834547;3835929;292;;
;;tRNA;3836222;3836316;108;*;tga
;;gene;3836425;3836556;396;*;
fin;;CDS;3836953;3838137;;;
deb;;CDS;3843964;3845730;-1;;
;comp;ncRNA;3845730;3845995;-220;*;
fin;comp;CDS;3845776;3847167;;;
deb;comp;CDS;3852890;3852988;129;;
;comp;ncRNA;3853118;3853190;-73;*;
;comp;ncRNA;3853118;3853257;295;*;
fin;;CDS;3853553;3853642;;;
deb;;CDS;3860283;3861176;-4;;
;comp;gene;3861173;3861987;-1;*;
fin;comp;CDS;3861987;3862472;;;
deb;comp;CDS;3923744;3925633;110;;
;;rep_origin;3925744;3925975;36;*;
fin;comp;CDS;3926012;3926455;;;
deb;;CDS;3936278;3937168;-124;;
;;ncRNA;3937045;3937278;15;*;
fin;;CDS;3937294;3938223;;;
deb;comp;CDS;3940635;3941327;480;;
;16s;rRNA;3941808;3943349;85;*;
;;tRNA;3943435;3943510;193;*;gaa
;23s;rRNA;3943704;3946607;92;*;
;5s;rRNA;3946700;3946819;52;*;
;;tRNA;3946872;3946948;8;*;gac
;;tRNA;3946957;3947032;95;*;tgg
fin;comp;CDS;3947128;3947967;;;
deb;;CDS;3950507;3950557;2;;
;;gene;3950560;3952204;-4;*;
fin;;CDS;3952201;3952464;;;
deb;comp;CDS;3959532;3959813;198;;
;comp;gene;3960012;3960460;216;*;
fin;;CDS;3960677;3962698;;;
deb;;CDS;3980887;3982272;102;;
;;tRNA;3982375;3982451;57;*;cgg
;;tRNA;3982509;3982585;20;*;cac
;;tRNA;3982606;3982692;42;*;ctg
;;tRNA;3982735;3982811;146;*;cca
fin;;CDS;3982958;3984193;;;
deb;comp;CDS;3984352;3986007;424;;
;;ncRNA;3986432;3986603;82;*;
fin;comp;CDS;3986686;3987882;;;
deb;;CDS;4019624;4020229;-252;;
;;ncRNA;4019978;4020229;-4;*;
fin;;CDS;4020226;4021866;;;
deb;;CDS;4034608;4035153;377;;
;16s;rRNA;4035531;4037072;68;*;
;;tRNA;4037141;4037217;42;*;atc
;;tRNA;4037260;4037335;183;*;gca
;23s;rRNA;4037519;4040423;93;*;
;5s;rRNA;4040517;4040636;269;*;
fin;comp;CDS;4040906;4041433;;;
deb;;CDS;4046966;4049752;146;;
;;ncRNA;4049899;4050009;123;*;
deb;comp;CDS;4050133;4050765;270;;
;;ncRNA;4051036;4051281;65;*;
fin;;CDS;4051347;4051856;;;
deb;;CDS;4105820;4106320;9;;
;;ncRNA;4106330;4106387;81;*;
fin;;CDS;4106469;4107371;;;
deb;;CDS;4156850;4158223;54;;
;comp;ncRNA;4158278;4158394;95;*;
fin;;CDS;4158490;4159407;;;
deb;;CDS;4165428;4166285;373;;
16s;;rRNA;4166659;4168200;171;*;
;;tRNA;4168372;4168447;193;*;gaa
23s;;rRNA;4168641;4171544;92;*;
5s;;rRNA;4171637;4171756;300;*;
fin;;CDS;4172057;4173085;;;
deb;comp;CDS;4174076;4175026;361;;
;;tRNA;4175388;4175463;8;*;aca
;;tRNA;4175472;4175556;116;*;tac
;;tRNA;4175673;4175747;6;*;gga
;;tRNA;4175754;4175829;114;*;acc
fin;;CDS;4175944;4177128;;;
deb;;CDS;4189786;4190325;1;;
;comp;ncRNA;4190327;4190487;247;*;
fin;comp;CDS;4190735;4191868;;;
deb;comp;CDS;4205943;4207532;614;;
16s;;rRNA;4208147;4209688;85;*;
;;tRNA;4209774;4209849;193;*;gaa
23s;;rRNA;4210043;4212946;93;*;
5s;;rRNA;4213040;4213159;74;*;
fin;;CDS;4213234;4213617;;;
deb;;CDS;4218596;4220332;-1454;;
;;ncRNA;4218879;4218963;1337;*;
fin;comp;CDS;4220301;4222487;;;
deb;comp;CDS;4240779;4242254;276;;
;comp;ncRNA;4242531;4242633;-8;*;
fin;comp;CDS;4242626;4243516;;;
deb;;CDS;4249554;4250474;228;;
;;gene;4250703;4252283;222;*;
fin;;CDS;4252506;4253003;;;
deb;;CDS;4262840;4263082;56;;
;;ncRNA;4263139;4263249;-2;*;
fin;comp;CDS;4263248;4264231;;;
deb;;CDS;4277469;4277933;-8;;
;comp;ncRNA;4277926;4278066;412;*;
fin;;CDS;4278479;4279828;;;
deb;comp;CDS;4321697;4322422;20;;
;comp;gene;4322443;4323281;54;*;
fin;comp;CDS;4323336;4324352;;;
deb;comp;CDS;4360396;4361934;256;;
;comp;gene;4362191;4362353;197;*;
;comp;tRNA;4362551;4362626;106;*;ttc
fin;comp;CDS;4362733;4363308;;;
deb;comp;CDS;4365472;4366773;65;;
;comp;ncRNA;4366839;4366951;-61;*;
fin;comp;CDS;4366891;4368327;;;
deb;;CDS;4391604;4392149;210;;
;;tRNA;4392360;4392435;36;*;ggc
;;tRNA;4392472;4392547;35;*;ggc
;;tRNA;4392583;4392658;233;*;ggc
fin;;CDS;4392892;4392945;;;
deb;comp;CDS;4426628;4427422;271;;
;;gene;4427694;4428095;-17;*;
fin;comp;CDS;4428079;4428717;;;
deb;;CDS;4457959;4459311;176;;
;;gene;4459488;4459855;44;*;
fin;comp;CDS;4459900;4460364;;;
deb;comp;CDS;4495190;4496209;195;;
;;tRNA;4496405;4496489;185;*;ttg
;;misc_f;4496675;4497940;-1191;*;
;;gene;4496750;4497940;240;*;
;;mobile_el;4498181;4499511;-1240;*;
fin;;CDS;4498272;4498637;;;
deb;;CDS;4498595;4499500;92;;
;comp;gene;4499593;4500791;468;*;
deb;;CDS;4501260;4501589;500;;
;comp;mobile_el;4502090;4503515;-1413;*;
fin;comp;CDS;4502103;4503431;;;
deb;;CDS;4506448;4506573;52;;
;comp;gene;4506626;4506856;4;*;
;;gene;4506861;4507109;15;*;
;;mobile_el;4507125;4507458;-262;*;
;;misc_f;4507197;4507451;7;*;
;comp;mobile_el;4507459;4508679;-1214;*;
deb;comp;CDS;4507466;4508617;62;;
;comp;mobile_el;4508680;4509006;-323;*;
;comp;gene;4508684;4508942;64;*;
;;mobile_el;4509007;4509801;-793;*;
;;misc_f;4509009;4509479;-1;*;
;;misc_f;4509479;4509793;10;*;
;;gene;4509804;4510133;556;*;
fin;comp;CDS;4510690;4511457;;;
deb;;CDS;4518372;4518440;31;;
;;mobile_el;4518472;4519239;-713;*;
deb;;CDS;4518527;4518802;-82;;
;;gene;4518721;4519224;113;*;
fin;comp;CDS;4519338;4520324;;;
deb;comp;CDS;4527549;4527980;-4;;
;;ncRNA;4527977;4528066;44;*;
fin;comp;CDS;4528111;4528917;;;
deb;comp;CDS;4530530;4531651;398;;
;comp;gene;4532050;4532310;126;*;
fin;comp;CDS;4532437;4533183;;;
deb;comp;CDS;4533796;4534053;376;;
;comp;gene;4534430;4534675;339;*;
;;gene;4535015;4536031;565;*;
fin;;CDS;4536597;4536695;;;
deb;comp;CDS;4568692;4568727;270;;
;;gene;4568998;4569918;243;*;
fin;comp;CDS;4570162;4571574;;;
deb;;CDS;4572414;4573931;203;;
;;gene;4574135;4576855;56;*;
fin;comp;CDS;4576912;4577958;;;
deb;comp;CDS;4579499;4579840;-6;;
;;ncRNA;4579835;4579911;156;*;
fin;comp;CDS;4580068;4581462;;;
deb;;CDS;4605804;4606040;38;;
;comp;tRNA;4606079;4606165;34;*;ctg
;comp;tRNA;4606200;4606286;28;*;ctg
;comp;tRNA;4606315;4606401;267;*;ctg
fin;comp;CDS;4606669;4607700;;;

Intergen51. eco. Les différents types d'intercalaires[modifier | modifier le wikicode]

eco. Les types d’intercalaires;;;;;;;;
intercalaires CDS-CDS;;;;;;* autres intercalaires;;
continu;S+;S-;S0;total;c/x;RNA-RNA;CDS-rRNA;total
c;2 188;647;16;2 851;2,4;65;6;71
x;1 061;95;13;1 169;;0;6;6
t;3 249;742;29;4 020;;65;12;77
%;80,8;18,5;0,7;;;;;
Détail des * autres intercalaires;;;;;;;;
intercalaires tRNA-CDS;;;;;;récapitulatif des * autres intercalaires;;
continu;R+;R-;R0;total;c/x;* autres;total;%
c;37;0;0;37;1,3;tRNA-CDS;65;9
x;28;0;0;28;;RNA-RNA;65;9
t;65;0;0;65;;CDS-rRNA;12;2
%;100,0;0,0;0,0;;;non RNA;570;80
-;;;;;;total;712;100
Les taux remarquables;;;;;;;;
taux;%reste;;;%t30;;%t5;%0;
gamme;400;400;6-50;-;-;-;-;-
type;S+;R+;S-;S+;R+;S-;S+;R+
c;2,9;10,8;13,7;33,8;2,7;47;0,6;0,0
x;5,3;14,3;3,9;5,9;3,6;65;1,1;0,0

Intergen51. eco. Les intercalaires tRNA-tRNA extra bloc[modifier | modifier le wikicode]

;;;correl;;;;;
;179;233;0,324;;;;;
CDS-CDS;;% total;publié;26/11/22;;;;
frequence;;;effectif;;;;;
eco;fx%;fc%;fx;fc;eco;fc40;;tRNA h eco
0;12;7;13;16;0;16;5;5
10;33;157;35;345;1;43;10;4
20;9;120;10;265;2;51;15;2
30;17;61;18;135;3;44;20;1
40;59;36;63;79;4;27;25;1
50;73;33;78;73;5;14;30;1
60;47;47;51;104;6;13;35;5
70;34;40;37;89;7;24;40;3
80;20;40;21;88;8;15;45;2
90;27;30;29;67;9;56;50;2
100;32;37;34;82;10;58;55;1
110;34;38;36;83;11;48;60;1
120;30;26;32;58;12;39;65;1
130;31;24;33;52;13;23;70;0
140;36;23;39;51;14;37;75;0
150;26;23;28;50;15;23;80;0
160;36;19;39;41;16;20;85;0
170;30;19;32;41;17;19;90;0
180;20;19;22;41;18;19;95;0
190;28;17;30;37;19;14;100;0
200;27;14;29;31;20;23;105;0
210;33;16;35;36;21;17;110;0
220;27;17;29;37;22;18;115;0
230;19;9;20;20;23;13;120;1
240;22;8;24;18;24;19;;7
250;22;8;24;17;25;10;;37
260;20;12;22;26;26;14;;
270;13;6;14;14;27;14;;
280;20;7;21;16;28;8;;
290;16;10;17;21;29;9;;
300;8;8;9;17;30;13;;
310;8;6;9;13;31;6;;
320;15;5;16;12;32;7;;
330;7;5;7;11;33;7;;
340;10;3;11;6;34;8;;
350;2;4;2;9;35;7;;
360;10;5;11;10;36;15;;
370;7;5;7;12;37;7;;
380;17;2;18;4;38;7;;
390;6;1;6;3;39;8;;
400;6;5;6;10;40;7;;
reste;53;29;57;64;;;;
total;1000;1000;1074;2204;;;;
diagr;;;1004;2124;;;;
t30;;;63;745;;;;

eco intercalaires entre cds[modifier | modifier le wikicode]

eco intercalaires positifs S+[modifier | modifier le wikicode]

eco Sx+ Sc+ Les diagrammes 400. Corrélations et fréquences faibles 1-30;;;;;;;;;;;;;;
;;effectifs diagramme;;;corrélation x+ c+, 41-n;;;;corrélation x+ c+, 1-n;;;;;
gen;minima;x+;c+;total;400;200;250;diff;200;250;400;;;
cbn;min20;489;1701;2190;731;543;505;-38;-222;-114;271;;;
eco;min20;1003;2130;3133;735;296;440;144;-178;-64;287;;;
bsu;min10;1028;2444;3472;659;8;282;274;152;257;470;;;
1-30  ‰ ;;;effectifs;;0  ‰;;<0  ‰;;effectifs 1-40;;corel;;;
1-30 x+;1-30 c+;x+/c+;x;c;x;c;x-;c-;x+;c+;x+/c+;;;
65;312;0.21;553;1940;2;5;17;86;56;620;-382;;;
63;348;0.18;1169;2855;11;6;80;226;126;821;-119;;;
140;333;0.42;1125;3091;2;8;31;186;302;936;-432;;;
;;;;;;;;;;;;;;
Diagrammes 400;;;;;;;;;;;;;;
eco;Sx+;;;;;;;Sc+;;;;;;
Poly3;-7;-5;-3;1;R2;flex x+;comment.;-7;-5;-3;1;R2;flex c+;comment.
1 à 400;22;-151;195;32;532;230;max50;-74;565;-1405;124;805;255;min50
31 à 400;;;;;;;;7.6;-18;-162;50;934;79;2 parties
droite;-a;cste;-;R2;note;R2’;2 parties;-a;cste;-;R2;note;R2’;
1 à 400;94;44;-;489;dte;43;tm;197;65;-;540;poly;265;SF
31 à 400;;;;;;;;117;43;-;873;poly;61;tm
  • Effectifs et pourcentages par rapport au total du diagramme, diagr. Total des pourcentages des fréquences 10 20 30 40 50 60, t30 t60.
  • Corrélations et fréquences faibles
25.1.22 Paris;;;;;;;;;;;;;
;400;200;250;;corrélation;;;;;;;;
;coefficient de corrélation fx fc;;;;-0.119;;;;;;;;
41-n;0.735;0.296;0.440;;;;;;;;;;
1-n;0.287;-0.178;-0.064;;;;;;;;25.1.22 Paris;;
eco;fx;fc;;fx40;fc40;eco;fx%;fc%;;x;eco;Sx-;Sc-
0;13;16;0;13;16;0;13;8;>0;1062;-1;0;163
10;36;341;1;4;43;10;36;160;<0;94;-2;2;0
20;11;264;2;6;51;20;11;124;zéro;13;-3;0;0
30;16;136;3;10;44;30;16;64;total;1169;-4;43;260
40;63;80;4;5;26;40;63;38;;c;-5;0;0
50;79;73;5;1;13;50;79;34;>0;2195;-6;0;0
60;51;103;6;4;12;60;51;48;<0;644;-7;1;14
70;37;89;7;3;23;70;37;42;zéro;16;-8;1;59
80;20;89;8;1;15;80;20;42;total;2855;-9;2;0
90;30;69;9;2;56;90;30;32;;;-10;0;6
100;32;82;10;0;58;100;32;38;total;4024;-11;0;34
110;36;84;11;2;48;110;36;39;;;-12;1;0
120;32;59;12;3;39;120;32;28;;;-13;0;3
130;34;53;13;1;22;130;34;25;;;-14;5;15
140;39;51;14;0;37;140;39;24;;;-15;0;0
150;29;49;15;1;23;150;29;23;;;-16;1;2
160;39;42;16;2;20;160;39;20;;;-17;0;10
170;32;40;17;1;19;170;32;19;;;-18;2;0
180;22;40;18;0;19;180;22;19;;;-19;1;4
190;30;38;19;0;14;190;30;18;;;-20;1;8
200;29;32;20;1;23;200;29;15;;;-21;2;0
210;35;37;21;1;17;210;35;17;;;-22;0;3
220;29;37;22;0;18;220;29;17;;;-23;1;6
230;21;19;23;1;13;230;21;9;;;-24;2;0
240;23;18;24;6;19;240;23;8;;;-25;2;2
250;24;17;25;0;10;250;24;8;;;-26;1;7
260;22;25;26;1;14;260;22;12;;;-27;1;0
270;12;15;27;0;14;270;12;7;;;-28;1;3
280;20;17;28;4;8;280;20;8;;;-29;1;4
290;17;21;29;2;9;290;17;10;;;-30;1;0
300;9;17;30;1;14;300;9;8;;;-31;0;1
310;9;13;31;2;7;310;9;6;;;-32;2;5
320;16;13;32;3;7;320;16;6;;;-33;1;0
330;8;10;33;3;7;330;8;5;;;-34;0;0
340;12;6;34;7;8;340;12;3;;;-35;3;1
350;2;9;35;5;7;350;2;4;;;-36;0;0
360;10;10;36;4;15;360;10;5;;;-37;0;1
370;6;13;37;11;7;370;6;6;;;-38;1;1
380;18;5;38;6;7;380;18;2;;;-39;1;0
390;6;3;39;14;8;390;6;1;;;-40;0;0
400;7;11;40;8;7;400;7;5;;;-41;1;0
reste;59;65;reste;936;1374;;;;;;-42;0;0
total;1075;2211;total;1075;2211;t30;63;348;;;-43;0;8
diagr;1003;2130;diagr;126;821;t60;218;302;;;-44;1;1
 - t30;940;1389;;;;;;;;;-45;0;0
 - t60;747;1133;;;;;;;;;-46;0;0
;;;;;;;;;;;-47;0;0
;;;;;;;;;;;-48;1;0
;;;;;;;;;;;-49;0;0
;;;;;;;;;;;-50;0;2
;;;;;;;;;;;reste;11;21
;;;;;;;;;;;total;94;644

eco intercalaires négatifs S-[modifier | modifier le wikicode]

eco;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;-51;-52;-53;-54;-55;-56;-57;-58;-59;-60;-61;-62;-63;-64;-65;-66;-67;-68;-69;-70;-71;-72;-73;-74;-75;-76;-77;-78;-79;-80;-81;-82;-83;-84;-85;-86;-87;-88;-89;-90;-91;-92;-93;-94;-95;-96;-97;-98;-99;-100;;;
comp’;0;2;0;42;0;0;1;1;2;0;0;1;0;5;0;1;0;2;1;1;2;0;1;2;2;1;0;1;1;1;0;2;1;0;3;0;0;1;0;0;1;0;0;1;0;0;0;1;;;;;;;;;;;;;;;1;;;;;;;;;;;;;;;;;;;1;;;;1;;;;;;;;;;;;;;;8;91;11
continu;163;0;0;261;0;0;14;59;0;6;34;0;3;15;0;2;10;0;4;8;0;3;6;0;2;7;1;3;4;0;1;5;0;0;1;0;1;1;1;0;0;0;8;1;0;0;0;0;0;1;0;0;0;0;0;1;0;0;0;0;0;0;0;0;0;1;0;0;0;0;0;0;0;0;1;0;0;0;0;0;0;7;0;0;1;0;0;0;1;;;;;;;;;;;;10;647;22
  • 14.8.21
14.8.21 Paris;eco;-1;-2;-3;-4;-5;-6;-7;-8;-9;-10;-11;-12;-13;-14;-15;-16;-17;-18;-19;-20;-21;-22;-23;-24;-25;-26;-27;-28;-29;-30;-31;-32;-33;-34;-35;-36;-37;-38;-39;-40;-41;-42;-43;-44;-45;-46;-47;-48;-49;-50;reste;total
;Sx-;0;2;0;43;0;0;1;1;2;0;0;1;0;5;0;1;0;2;1;1;2;0;1;2;2;1;1;1;1;1;0;2;1;0;3;0;0;1;1;0;1;0;0;1;0;0;0;1;0;0;11;94
;Sc-;163;0;0;260;0;0;14;59;0;6;34;0;3;15;0;2;10;0;4;8;0;3;6;0;2;7;0;3;4;0;1;5;0;0;1;0;1;1;0;0;0;0;8;1;0;0;0;0;0;1;22;644

eco autres intercalaires[modifier | modifier le wikicode]

eco;autres intercalaires;;adresses1;;;eco;autres intercalaires;;adresses2;;;eco;autres intercalaires;;adresses3;;;eco;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;14168;88;;;deb;°CDS;1205731;-74;;;deb;°CDS;2170532;30;;;deb;°CDS;3579768;116;
;mobile;15387;-1287;;;;gene;1206131;-10;;;;misc_f;2171429;105;;;;ncRNA;3580922;121;
fin;°CDS;15445;;;;fin;°CDS;1206913;;;;deb;°CDS;2171833;47;;;fin;°CDS;3581138;;
deb;°CDS;16751;-9;;;deb;°CDS;1208517;-1;;;;gene;2172921;3;;;deb;°CDS;3581863;-4;
;ncRNA;16952;482;;;;gene;1209119;29;;;fin;°CDS;2174282;;;;;misc_f;3583038;0;
fin;°CDS;17489;;;;fin;°CDS;1209685;;;;deb;°CDS;2196474;111;;;;mobile;3583428;-713;
deb;°CDS;18715;175;;;deb;°CDS;1210346;233;;;;gene;2197410;9;;;fin;°CDS;3583483;;
;mobile;19796;-753;;;;gene;1211413;102;;;fin;°CDS;2200279;;;;deb;°CDS;3583677;24;
fin;°CDS;19811;;;;fin;°CDS;1211680;;;;deb;°CDS;2226509;52;;;;misc_f;3584205;94;
deb;°CDS;74497;35;;;deb;°CDS;1218983;399;;;;gene;2227323;223;;;fin;°CDS;3584404;;
;ncRNA;75516;35;;;;gene;1219601;56;;;fin;°CDS;2228982;;;;deb;°CDS;3623399;104;
deb;°CDS;75644;67;;;fin;°CDS;1222305;;;;deb;°CDS;2284376;74;;;;gene;3623887;245;
;ncRNA;77367;-206;;;deb;°CDS;1223264;114;;;;&tRNA;2286211;102;;;fin;°CDS;3624378;;
fin;°CDS;77388;;;;;gene;1223564;371;;;;misc_f;2286390;4;;;deb;°CDS;3630968;261;
deb;°CDS;188712;205;;;fin;°CDS;1224279;;;;;mobile;2288919;-1049;;;;gene;3632852;382;
;ncRNA;189712;26;;;deb;°CDS;1238879;238;;;deb;°CDS;2289065;68;;;fin;°CDS;3634841;;
fin;°CDS;189874;;;;;mobile;1240188;-30;;;;misc_f;2290114;319;;;deb;°CDS;3647705;274;
deb;°CDS;222833;362;;;fin;°CDS;1240260;;;;fin;°CDS;2290500;;;;;ncRNA;3648063;149;
;$rRNA;223771;68;;;deb;°CDS;1269168;47;;;deb;°CDS;2311646;334;;;;ncRNA;3648294;152;
;&tRNA;225381;42;;;;ncRNA;1269323;313;;;;ncRNA;2313084;311;;;fin;°CDS;3648528;;
;&tRNA;225500;183;;;deb;°CDS;1269703;47;;;fin;°CDS;2313488;;;;deb;°CDS;3650237;628;
;$rRNA;225759;93;;;;ncRNA;1269858;314;;;deb;°CDS;2328148;0;;;;misc_f;3651291;-1;
;$rRNA;228756;52;;;deb;°CDS;1270238;47;;;;gene;2329798;-67;;;;mobile;3652036;-1049;
;&tRNA;228928;162;;;;ncRNA;1270393;288;;;fin;°CDS;2334336;;;;deb;°CDS;3652182;73;
fin;°CDS;229167;;;;fin;°CDS;1270749;;;;deb;°CDS;2348822;214;;;;misc_f;3653236;247;
deb;°CDS;236067;132;;;deb;°CDS;1286709;81;;;;gene;2349687;41;;;fin;°CDS;3653961;;
;&tRNA;236931;327;;;;ncRNA;1287066;-150;;;fin;°CDS;2349935;;;;deb;°CDS;3656995;417;
fin;°CDS;237335;;;;deb;°CDS;1287087;67;comp;;deb;°CDS;2356904;12;;;;ncRNA;3657985;311;
deb;°CDS;238257;9;;;;&tRNA;1287244;209;comp;;;gene;2357816;40;;;deb;°CDS;3658366;98;
;gene;238746;105;;;;&tRNA;1287538;159;comp;;fin;°CDS;2358042;;;;;ncRNA;3658992;149;
;gene;239190;40;;;fin;°CDS;1287782;;comp;;deb;°CDS;2451584;19;;;fin;°CDS;3659232;;
fin;°CDS;239419;;;;deb;°CDS;1293527;281;;;;gene;2452356;81;;;deb;°CDS;3663890;245;
deb;°CDS;247637;223;;;;gene;1294426;-897;;;fin;°CDS;2455083;;;;;ncRNA;3664864;16;
;gene;248358;1;;;;mobile;1294426;40;;;deb;°CDS;2465301;75;;;fin;°CDS;3664986;;
;gene;250072;70;;;fin;°CDS;1295446;;;;;&tRNA;2466309;-15;;;deb;°CDS;3692618;-4;
fin;°CDS;250898;;;;deb;°CDS;1298598;253;;;;misc_f;2466369;-10039;;;;gene;3695233;11;
deb;°CDS;252709;305;;;;mobile;1299499;-1127;;;fin;°CDS;2466545;;;;fin;°CDS;3695997;;
;gene;253467;-32;;;fin;°CDS;1299567;;;;deb;°CDS;2470497;159;;;deb;°CDS;3699980;48;
;gene;253702;56;;;deb;°CDS;1380148;13;;;;gene;2470803;-29;;;;ncRNA;3700136;363;
fin;°CDS;254259;;;;;gene;1380821;-1;;;deb;°CDS;2471077;26;;;fin;°CDS;3700563;;
deb;°CDS;256527;57;;;;gene;1381789;44;;;;gene;2471544;49;;;deb;°CDS;3706098;910;comp
;misc_f;257829;8;;;fin;°CDS;1381947;;;;fin;°CDS;2472112;;;;;&tRNA;3708616;91;comp
;mobile;257908;-753;;;deb;°CDS;1394891;121;;;deb;°CDS;2476310;73;;;fin;°CDS;3708784;;comp
fin;°CDS;257923;;;;;mobile;1396044;-1127;;;;gene;2476584;95;;;deb;°CDS;3720448;-153;
deb;°CDS;258345;55;;;fin;°CDS;1396112;;;;fin;°CDS;2476694;;;;;gene;3720448;0;
;misc_f;258676;38;;;deb;°CDS;1404741;8;;;deb;°CDS;2513042;28;;;;mobile;3720633;-1396;
fin;°CDS;259045;;;;;ncRNA;1405658;227;;;;mobile;2514273;-1287;;;fin;°CDS;3720680;;
deb;°CDS;261503;114;;;fin;°CDS;1405979;;;;fin;°CDS;2514331;;;;deb;°CDS;3721198;26;
;&tRNA;262871;-49;;;deb;°CDS;1408050;95;;;deb;°CDS;2515643;208;;;;gene;3722076;222;
;misc_f;262898;-34056;;;;ncRNA;1409129;57;;;;&tRNA;2518041;39;comp;;fin;°CDS;3722328;;
;gene;263150;115;;;fin;°CDS;1409308;;;;;&tRNA;2518156;235;comp;;deb;°CDS;3750086;31;
fin;°CDS;263328;;;;deb;°CDS;1411013;-50;;;fin;°CDS;2518467;;comp;;;gene;3750813;3;
deb;°CDS;266110;-1;;;;misc_f;1411899;-22959;;;deb;°CDS;2519257;258;comp;;;gene;3750918;18;
;gene;266553;1;;;fin;°CDS;1412000;;;;;&tRNA;2520931;44;;;fin;°CDS;3751128;;
;gene;266776;216;;;deb;°CDS;1413531;-185;;;;&tRNA;2521051;46;;;deb;°CDS;3766337;41;
fin;°CDS;267184;;;;;ncRNA;1413556;-2;;;;&tRNA;2521173;4;;;;gene;3767221;254;
deb;°CDS;269289;23;;;fin;°CDS;1413733;;;;;&tRNA;2521253;264;;;deb;°CDS;3768177;0;
;mobile;270206;-263;;;deb;°CDS;1422752;32;;;fin;°CDS;2521593;;comp;;;gene;3768639;1;
;misc_f;270278;0;;;;gene;1423345;-245;;;deb;°CDS;2557318;11;;;;gene;3768892;88;
;mobile;270541;-1159;;;fin;°CDS;1423400;;;;;misc_f;2558691;-6623;;;deb;°CDS;3769345;267;
deb;°CDS;270603;7;;;deb;°CDS;1426454;-94;;;fin;°CDS;2558858;;;;;gene;3769948;96;
;mobile;271762;-427;;;;misc_f;1427389;0;;;deb;°CDS;2639301;19;;;fin;°CDS;3770243;;
;misc_f;271764;389;;;;mobile;1427599;-1049;;;;ncRNA;2640595;-1;;;deb;°CDS;3807064;67;
;ncRNA;272580;192;;;deb;°CDS;1427746;69;;;fin;°CDS;2640686;;;;;ncRNA;3808166;301;
deb;°CDS;272847;-38;;;;misc_f;1428796;64;;;deb;°CDS;2652494;515;;;fin;°CDS;3808540;;
;mobile;273955;-1049;;;fin;°CDS;1429049;;;;;ncRNA;2653855;-2;;;deb;°CDS;3834547;292;comp
fin;°CDS;274101;;;;deb;°CDS;1434293;551;;;fin;°CDS;2654157;;;;;&tRNA;3836222;108;
deb;°CDS;277756;11;;;;gene;1434958;176;;;deb;°CDS;2689671;58;;;;gene;3836425;396;
;gene;278814;0;;;fin;°CDS;1435185;;;;;ncRNA;2691157;315;;;fin;°CDS;3836953;;
;mobile;279163;-753;;;deb;°CDS;1435760;227;;;fin;°CDS;2691656;;;;deb;°CDS;3852890;129;
fin;°CDS;279178;;;;;ncRNA;1437121;28;;;deb;°CDS;2700117;322;;;;ncRNA;3853118;-73;
deb;°CDS;279600;55;;;fin;°CDS;1437260;;;;;ncRNA;2700520;19;;;;ncRNA;3853118;295;
;gene;279931;-174;;;deb;°CDS;1465165;161;;;fin;°CDS;2700618;;;;fin;°CDS;3853553;;
;mobile;279931;2;;;;misc_f;1465392;0;;;deb;°CDS;2725925;81;;;deb;°CDS;3860283;-4;
;gene;280114;-249;;;;mobile;1467910;-1320;;;;$rRNA;2726069;92;comp;;;gene;3861173;-1;
;mobile;280114;-41;;;fin;°CDS;1467921;;;;;$rRNA;2726281;184;comp;;fin;°CDS;3861349;;
fin;°CDS;280385;;;;deb;°CDS;1468784;96;;;;&tRNA;2729369;171;comp;;deb;°CDS;3923744;110;
deb;°CDS;290510;-5;;;;misc_f;1469246;0;;;;$rRNA;2729616;442;comp;;;rep_o;3925744;36;
;mobile;290634;-753;;;;mobile;1469296;-1159;;;fin;°CDS;2731600;;comp;;fin;°CDS;3926012;;
fin;°CDS;290649;;;;deb;°CDS;1469358;9;;;deb;°CDS;2731600;-21;;;deb;°CDS;3940635;480;comp
deb;°CDS;313141;473;;;;misc_f;1470519;207;;;;ncRNA;2734153;7;;;;$rRNA;3941808;85;
;gene;313716;551;;;fin;°CDS;1474221;;;;fin;°CDS;2734303;;;;;&tRNA;3943435;193;
;gene;314357;-16;;;deb;°CDS;1488232;41;;;deb;°CDS;2754896;214;;;;$rRNA;3943704;92;
;mobile;315229;-1193;;;;gene;1489713;188;;;;ncRNA;2755593;-15;;;;$rRNA;3946700;52;
fin;°CDS;315291;;;;deb;°CDS;1490902;9;;;;misc_f;2755941;-21813;;;;&tRNA;3946872;8;
deb;°CDS;315587;-4;;;;ncRNA;1491442;170;;;fin;°CDS;2756159;;;;;&tRNA;3946957;95;
;gene;316450;302;;;fin;°CDS;1491677;;;;deb;°CDS;2771840;12;;;fin;°CDS;3947128;;comp
;gene;317439;158;;;deb;°CDS;1491962;-11;;;;gene;2772167;135;;;deb;°CDS;3950507;2;
fin;°CDS;317726;;;;;ncRNA;1492119;295;;;deb;°CDS;2773318;523;;;;gene;3950560;-4;
deb;°CDS;380069;1;;;fin;°CDS;1492470;;;;;gene;2775545;102;;;fin;°CDS;3952201;;
;misc_f;380844;-1;;;deb;°CDS;1502457;35;;;fin;°CDS;2775919;;;;deb;°CDS;3959532;198;
;mobile;381260;-1240;;;;mobile;1503161;-1691;;;deb;°CDS;2777453;189;;;;gene;3960012;216;
fin;°CDS;381351;;;;;gene;1503218;67;;;;gene;2777972;160;;;fin;°CDS;3960677;;
deb;°CDS;381674;11;;;fin;°CDS;1503717;;;;deb;°CDS;2778146;338;;;deb;°CDS;3980887;102;
;misc_f;382591;-134;;;deb;°CDS;1526940;737;;;;gene;2783065;333;;;;&tRNA;3982375;57;
fin;°CDS;382739;;;;;gene;1527890;-17;;;fin;°CDS;2783638;;;;;&tRNA;3982509;20;
deb;°CDS;388753;523;;;fin;°CDS;1529922;;;;deb;°CDS;2784529;750;comp;;;&tRNA;3982606;42;
;misc_f;390251;-117;;;deb;°CDS;1530319;81;;;;&tRNA;2785762;559;comp;;;&tRNA;3982735;146;
deb;°CDS;391592;60;;;;gene;1530586;176;;;;gene;2786397;335;;;fin;°CDS;3982958;;
;mobile;391709;-1228;;;fin;°CDS;1531816;;;;fin;°CDS;2788985;;;;deb;°CDS;3984352;424;
fin;°CDS;391739;;;;deb;°CDS;1542672;323;;;deb;°CDS;2807132;191;;;;ncRNA;3986432;82;
deb;°CDS;392602;68;;;;gene;1544384;38;;;;gene;2808316;123;;;fin;°CDS;3986686;;
;misc_f;392970;87;;;fin;°CDS;1544758;;;;fin;°CDS;2809617;;;;deb;°CDS;4019624;-252;
fin;°CDS;394506;;;;deb;°CDS;1588853;332;;;deb;°CDS;2814218;68;;;;ncRNA;4019978;-4;
deb;°CDS;408177;147;;;;gene;1590334;317;;;;ncRNA;2814802;8;;;fin;°CDS;4020226;;
;gene;408609;-4;;;fin;°CDS;1590854;;;;fin;°CDS;2814883;;;;deb;°CDS;4034608;377;
fin;°CDS;408947;;;;deb;°CDS;1592176;222;;;deb;°CDS;2816937;280;comp;;;$rRNA;4035531;68;
deb;°CDS;475982;76;;;;gene;1592665;530;;;;&tRNA;2817784;198;comp;;;&tRNA;4037141;42;
;ncRNA;476448;110;;;fin;°CDS;1598617;;;;;&tRNA;2818059;62;comp;;;&tRNA;4037260;183;
fin;°CDS;476672;;;;deb;°CDS;1622741;-29;;;;&tRNA;2818198;198;comp;;;$rRNA;4037519;93;
deb;°CDS;506603;121;;;;ncRNA;1622817;45;;;;&tRNA;2818473;3;comp;;;$rRNA;4040517;269;
;ncRNA;507204;-2;;;fin;°CDS;1622960;;;;;&tRNA;2818553;315;comp;;fin;°CDS;4040906;;
fin;°CDS;507286;;;;deb;°CDS;1631002;-9;;;fin;°CDS;2818961;;comp;;deb;°CDS;4046966;146;
deb;°CDS;527581;-1;;;;misc_f;1632277;-19856;;;deb;°CDS;2884553;133;;;;ncRNA;4049899;123;
;gene;527949;-20;;;fin;°CDS;1632890;;;;;ncRNA;2887353;169;;;deb;°CDS;4050133;270;
;gene;528640;366;;;deb;°CDS;1648823;340;;;fin;°CDS;2887578;;;;;ncRNA;4051036;65;
;gene;529497;52;;;;ncRNA;1649382;174;;;deb;°CDS;2923784;42;;;fin;°CDS;4051347;;
fin;°CDS;529645;;;;fin;°CDS;1649609;;;;;ncRNA;2924156;210;;;deb;°CDS;4105820;9;
deb;°CDS;563848;242;comp;;deb;°CDS;1649794;92;;;fin;°CDS;2924735;;;;;ncRNA;4106330;81;
;&tRNA;564723;-45;;;;gene;1650078;-156;;;deb;°CDS;2941650;128;;;fin;°CDS;4106469;;
;misc_f;564755;-21242;;;;mobile;1650843;-668;;;;ncRNA;2942696;16;;;deb;°CDS;4156850;54;
deb;°CDS;564815;-121;;;;gene;1650881;-26;;;fin;°CDS;2942918;;;;;ncRNA;4158278;95;
;gene;565858;18;;;;gene;1651512;19;;;deb;°CDS;2946081;208;comp;;fin;°CDS;4158490;;
;gene;566098;14;;;fin;°CDS;1652728;;;;;&tRNA;2947387;33;;;deb;°CDS;4165428;373;
;gene;566376;-4;;;deb;°CDS;1744871;307;comp;;;&tRNA;2947497;33;;;;$rRNA;4166659;171;
;misc_f;566684;0;;;;&tRNA;1746435;4;;;;&tRNA;2947607;73;;;;&tRNA;4168372;193;
;mobile;566777;-1193;;;;&tRNA;1746516;107;;;fin;°CDS;2947757;;comp;;;$rRNA;4168641;92;
fin;°CDS;566842;;;;fin;°CDS;1746700;;;;deb;°CDS;2973855;87;;;;$rRNA;4171637;300;
deb;°CDS;567138;30;;;deb;°CDS;1764018;326;;;;ncRNA;2976102;114;;;fin;°CDS;4172057;;
;misc_f;568035;67;;;;ncRNA;1764713;153;;;;ncRNA;2976304;213;;;deb;°CDS;4174076;361;comp
fin;°CDS;568315;;;;fin;°CDS;1764934;;;;fin;°CDS;2976599;;;;;&tRNA;4175388;8;
deb;°CDS;573956;189;;;deb;°CDS;1769074;185;;;deb;°CDS;2989935;193;;;;&tRNA;4175472;116;
;misc_f;574529;4;;;;ncRNA;1770372;137;;;;gene;2990554;224;;;;&tRNA;4175673;6;
;mobile;574591;-1049;;;fin;°CDS;1770615;;;;fin;°CDS;2991268;;;;;&tRNA;4175754;114;
deb;°CDS;574737;68;;;deb;°CDS;1800642;523;;;deb;°CDS;2993638;82;;;fin;°CDS;4175944;;
;misc_f;575786;572;;;;gene;1803094;171;;;;gene;2993939;18;;;deb;°CDS;4189786;1;
fin;°CDS;577398;;;;fin;°CDS;1805165;;;;;gene;2994460;33;;;;ncRNA;4190327;247;
deb;°CDS;580834;-26;;;deb;°CDS;1922313;96;;;;gene;2994937;221;;;fin;°CDS;4190735;;
;gene;581354;-129;;;;ncRNA;1923066;-234;;;;gene;2995314;-59;;;deb;°CDS;4205943;614;
deb;°CDS;581534;54;;;;ncRNA;1923104;157;;;;gene;2995962;0;;;;$rRNA;4208147;85;
;gene;582152;68;;;fin;°CDS;1923365;;;;;mobile;2996361;-1320;;;;&tRNA;4209774;193;
fin;°CDS;582875;;;;deb;°CDS;1957032;308;;;fin;°CDS;2996372;;;;;$rRNA;4210043;93;
deb;°CDS;606265;350;;;;ncRNA;1958441;-1;;;deb;°CDS;2997235;88;;;;$rRNA;4213040;74;
;ncRNA;607734;43;;;fin;°CDS;1958520;;;;;gene;2997689;45;;;fin;°CDS;4213234;;
deb;°CDS;607836;18;;;deb;°CDS;1973360;-1674;;;deb;°CDS;2998034;155;comp;;deb;°CDS;4249554;228;
;mobile;608007;-1287;;;;gene;1973360;4;;;;&tRNA;2998984;78;comp;;;gene;4250703;222;
fin;°CDS;608065;;;;fin;°CDS;1975329;;;;fin;°CDS;2999136;;comp;;fin;°CDS;4252506;;
deb;°CDS;657555;92;;;deb;°CDS;1977847;305;;;deb;°CDS;3055612;41;;;deb;°CDS;4262840;56;
;gene;658031;128;;;;mobile;1978503;-753;;;;ncRNA;3055983;75;;;;ncRNA;4263139;-2;
fin;°CDS;658947;;;;fin;°CDS;1978518;;;;deb;°CDS;3056241;61;;;fin;°CDS;4263248;;
deb;°CDS;685929;11;;;deb;°CDS;1990954;128;comp;;;ncRNA;3056851;-102;;;deb;°CDS;4277469;-8;
;ncRNA;686681;-5;;;;ncRNA;1991748;0;comp;;fin;°CDS;3056890;;;;;ncRNA;4277926;412;
deb;°CDS;686839;103;;;;&tRNA;1991815;12;comp;;deb;°CDS;3058666;55;;;fin;°CDS;4278479;;
;mobile;687851;-1049;;;;&tRNA;1991914;54;comp;;;gene;3059381;141;;;deb;°CDS;4321697;20;
fin;°CDS;687997;;;;;&tRNA;1992042;151;comp;;fin;°CDS;3059753;;;;;gene;4322443;54;
deb;°CDS;695101;153;;;fin;°CDS;1992269;;comp;;deb;°CDS;3109553;105;;;fin;°CDS;4323336;;
;&tRNA;696430;37;comp;;deb;°CDS;1996110;88;;;;&tRNA;3110366;148;;;deb;°CDS;4360396;256;
;&tRNA;696542;47;comp;;;ncRNA;1996921;4;;;fin;°CDS;3110590;;comp;;;gene;4362191;197;
;&tRNA;696664;15;comp;;fin;°CDS;1997062;;;;deb;°CDS;3129043;-70;;;;&tRNA;4362551;106;comp
;&tRNA;696756;34;comp;;deb;°CDS;2010600;143;;;;mobile;3130146;-1127;;;fin;°CDS;4362733;;comp
;&tRNA;696865;23;comp;;;gene;2011223;150;;;fin;°CDS;3130214;;;;deb;°CDS;4391604;210;
;&tRNA;696963;9;comp;;;misc_f;2012502;-162;;;deb;°CDS;3146450;118;;;;&tRNA;4392360;36;
;&tRNA;697057;379;comp;;;gene;2012502;-81;;;;gene;3146856;-95;;;;&tRNA;4392472;35;
fin;°CDS;697513;;comp;;fin;°CDS;2012700;;;;fin;°CDS;3147597;;;;;&tRNA;4392583;233;
deb;°CDS;715412;40;;;deb;°CDS;2024986;9;;;deb;°CDS;3185414;59;;;fin;°CDS;4392892;;
;gene;715947;123;;;;ncRNA;2025223;197;;;;misc_f;3186025;0;;;deb;°CDS;4426628;271;
;gene;716721;75;;;fin;°CDS;2025511;;;;;mobile;3186096;-1240;;;;gene;4427694;-17;
fin;°CDS;716946;;;;deb;°CDS;2033119;164;;;fin;°CDS;3186187;;;;fin;°CDS;4428079;;
deb;°CDS;733776;117;;;;ncRNA;2033649;311;;;deb;°CDS;3186510;16;;;deb;°CDS;4457959;176;
;gene;734220;-4;;;;gene;2034051;591;;;;misc_f;3187432;15;;;;gene;4459488;44;
fin;°CDS;735650;;;;fin;°CDS;2035835;;;;fin;°CDS;3189881;;;;fin;°CDS;4459900;;
deb;°CDS;736445;200;;;deb;°CDS;2042368;569;;;deb;°CDS;3192864;195;;;deb;°CDS;4495190;195;comp
;gene;736900;130;;;;&tRNA;2043468;93;comp;;;ncRNA;3194721;-100;;;;&tRNA;4496405;185;
fin;°CDS;738092;;;;deb;°CDS;2043651;100;;;deb;°CDS;3194766;271;;;;misc_f;4496675;-1191;
deb;°CDS;764180;0;;;;&tRNA;2044549;313;;;;ncRNA;3195097;-100;;;;gene;4496750;240;
;ncRNA;765050;2;;;deb;°CDS;2044938;261;;;fin;°CDS;3195141;;;;;mobile;4498181;-1240;
fin;°CDS;765153;;;;;gene;2052276;314;;;deb;°CDS;3214967;124;comp;;fin;°CDS;4498272;;
deb;°CDS;779598;164;;;fin;°CDS;2053643;;;;;&tRNA;3215598;53;;;deb;°CDS;4498595;92;
;&tRNA;780554;135;;;deb;°CDS;2056858;452;;;fin;°CDS;3215727;;comp;;;gene;4499593;468;
;&tRNA;780765;2;;;;&tRNA;2058027;100;comp;;deb;°CDS;3268415;613;;;deb;°CDS;4501260;500;
;&tRNA;780843;149;;;deb;°CDS;2058203;4;comp;;;ncRNA;3270216;32;;;;mobile;4502090;-1413;
;&tRNA;781068;3;;;;&tRNA;2059851;37;;;fin;°CDS;3270625;;;;fin;°CDS;4502103;;
;&tRNA;781147;146;;;fin;°CDS;2059964;;comp;;deb;°CDS;3280217;10;;;deb;°CDS;4506448;52;
;&tRNA;781369;132;;;deb;°CDS;2061016;326;comp;;;gene;3280701;19;;;;gene;4506626;4;
;&tRNA;781577;432;;;;&tRNA;2062260;55;;;;gene;3281122;350;;;;gene;4506861;15;
fin;°CDS;782085;;;;fin;°CDS;2062391;;comp;;fin;°CDS;3281976;;;;;mobile;4507125;-262;
deb;°CDS;851014;127;;;deb;°CDS;2065219;255;;;deb;°CDS;3309033;14;;;;misc_f;4507197;7;
;ncRNA;852725;-196;;;;misc_f;2066020;-12681;;;;ncRNA;3311183;16;;;;mobile;4507459;-1214;
fin;°CDS;852869;;;;;gene;2066068;4;;;fin;°CDS;3311415;;;;deb;°CDS;4507466;62;
deb;°CDS;887423;19;;;;mobile;2066159;-1049;;;deb;°CDS;3317554;206;comp;;;mobile;4508680;-323;
;ncRNA;887979;76;;;deb;°CDS;2066305;74;;;;&tRNA;3318213;347;comp;;;gene;4508684;64;
fin;°CDS;888134;;;;;gene;2067360;368;;;fin;°CDS;3318637;;;;;mobile;4509007;-793;
deb;°CDS;923264;343;;;;gene;2068261;215;;;deb;°CDS;3319988;458;comp;;;misc_f;4509009;-1;
;&tRNA;925884;253;comp;;;misc_f;2068635;0;;;;&tRNA;3322072;14;comp;;;misc_f;4509479;10;
fin;°CDS;926225;;comp;;;mobile;2068941;-1320;;;fin;°CDS;3322173;;comp;;;gene;4509804;556;
deb;°CDS;1030759;206;comp;;fin;°CDS;2068952;;;;deb;°CDS;3349806;117;;;fin;°CDS;4510690;;
;&tRNA;1031625;426;comp;;deb;°CDS;2069815;96;;;;ncRNA;3350577;-9;;;deb;°CDS;4518372;31;
fin;°CDS;1032139;;;;;misc_f;2070277;311;;;fin;°CDS;3350689;;;;;mobile;4518472;-713;
deb;°CDS;1049439;33;;;;gene;2070786;105;;;deb;°CDS;3362807;-4;;;deb;°CDS;4518527;-82;
;mobile;1049778;-713;;;;ncRNA;2071317;27;;;;misc_f;3365185;0;;;;gene;4518721;113;
fin;°CDS;1049833;;;;fin;°CDS;2071539;;;;;mobile;3365556;-1049;;;fin;°CDS;4519338;;
deb;°CDS;1079305;542;;;deb;°CDS;2077940;414;;;deb;°CDS;3365702;72;;;deb;°CDS;4527549;-4;
;gene;1081356;57;;;;gene;2078549;-103;;;;misc_f;3366755;-4;;;;ncRNA;4527977;44;
fin;°CDS;1082243;;;;fin;°CDS;2078575;;;;fin;°CDS;3366926;;;;fin;°CDS;4528111;;
deb;°CDS;1092876;10;;;deb;°CDS;2099862;127;;;deb;°CDS;3403484;36;;;deb;°CDS;4530530;398;
;mobile;1094245;-1228;;;;misc_f;2101396;4;;;;gene;3404495;0;;;;gene;4532050;126;
fin;°CDS;1094275;;;;;mobile;2101749;-1049;;;;gene;3404638;404;;;fin;°CDS;4532437;;
deb;°CDS;1095138;106;;;deb;°CDS;2101895;68;;;fin;°CDS;3405436;;;;deb;°CDS;4533796;376;
;gene;1095544;-4;;;;misc_f;2102944;1;;;deb;°CDS;3418390;430;;;;gene;4534430;339;
deb;°CDS;1095843;735;;;fin;°CDS;2103391;;;;;gene;3419042;67;;;;gene;4535015;565;
;&tRNA;1097565;233;comp;;deb;°CDS;2152469;182;;;fin;°CDS;3420134;;;;fin;°CDS;4536597;;
fin;°CDS;1097886;;;;;ncRNA;2153311;-106;;;deb;°CDS;3422436;228;;;deb;°CDS;4567287;478;
deb;°CDS;1146011;-7;;;deb;°CDS;2153349;237;;;;$rRNA;3423423;37;;;;gene;4568998;243;
;ncRNA;1146589;36;;;;ncRNA;2153646;-101;;;;&tRNA;3423580;12;;;fin;°CDS;4570162;;
fin;°CDS;1146794;;;;fin;°CDS;2153681;;;;;$rRNA;3423668;92;;;deb;°CDS;4572414;203;
deb;°CDS;1195123;-165;;;deb;°CDS;2165668;84;;;;$rRNA;3423880;174;;;;gene;4574135;56;
;misc_f;1196209;-14546;;;;ncRNA;2167114;-18;;;;&tRNA;3426958;42;;;fin;°CDS;4576912;;
fin;°CDS;1196867;;;;;misc_f;2167183;-510;;;;&tRNA;3427076;68;;;deb;°CDS;4579499;-6;
deb;°CDS;1203822;9;;;deb;°CDS;2167302;81;;;;$rRNA;3427221;473;;;;ncRNA;4579835;156;
;gene;1204170;-234;;;;gene;2167602;168;;;fin;°CDS;3429236;;;;fin;°CDS;4580068;;
deb;°CDS;1204170;-1137;;;fin;°CDS;2167989;;;;deb;°CDS;3558268;-19;;;deb;°CDS;4605804;38;
;gene;1204401;11;;;deb;°CDS;2168712;81;;;;gene;3559848;16;;;;&tRNA;4606079;34;comp
fin;°CDS;1205549;;;;;misc_f;2169693;3;;;fin;°CDS;3560622;;;;;&tRNA;4606200;28;comp
;;;;;;;mobile;2170171;-1193;;;;;;;;;;&tRNA;4606315;267;comp
;;;;;;fin;°CDS;2170236;;;;;;;;;;fin;°CDS;4606669;;comp

eco intercalaires tRNA[modifier | modifier le wikicode]

eco;intercalaires tRNAs;;;;;;;;;
;;;;;;;;;;
comp’;aas;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;162;;67;14;;
;;;132;;327;;74;78;;
;;;114;;;;75;91;'''deb;
;;comp’;242;;;;100;100;<201;10
6 aas;37 47 15 34 23 9;comp’;153;;379;;102;106;total;17
6 aas;135 2 149 3 146 132;;164;;432;;105;107;taux;59%
;;comp’;343;;253;;114;114;;
;;;206;comp’;426;;128;146;'''fin;
;;comp’;735;comp’;233;;132;151;<201;11
;209;;67;;159;;155;159;total;20
;4;comp’;307;;107;;164;162;taux;55%
;12 54;;-;;151;;206;235;;
;;comp’;569;comp’;93;;206;253;'''total;
;;;100;;313;;210;267;<201;21
;;comp’;452;;100;;280;313;total;37
;;comp’;4;comp’;37;;458;315;taux;57%
;;comp’;326;comp’;55;;750;327;;
;;;74;;;;910;379;;
;;;75;;;;233;432;comp’;cumuls
;39;comp’;208;;235;;4;37;;
;44 46 4;comp’;258;comp’;264;;38;53;;
;;;750;;;;124;55;'''deb;
4 aas;198 62 198 3;;280;;315;;153;73;<201;5
;;comp’;208;comp’;73;;195;93;total;17
;33 33;;155;;78;;208;95;taux;29%
;;;105;comp’;148;;208;148;;
;;comp’;124;comp’;53;;242;233;'''fin;
;;;206;comp’;347;;258;264;<201;7
;;;458;;14;;292;347;total;11
;;;910;;91;;307;426;taux;64%
;;comp’;292;;;;326;'''-;;
;8;;;comp’;95;;343;'''-;'''total;
;57 20 42;;102;;146;;361;'''-;<201;12
;8 116 6;comp’;361;;114;;452;'''-;total;28
;;;;;106;;569;'''-;taux;43%
;36 35;;210;;233;;735;'''-;;
;;comp’;195;;;;;;;
;34 28;comp’;38;;267;;;;;
;;;;;;;;;;
;;;;;;;;deb;fin;total
;;;;;;;<201;15;18;33
;;;;;;;total;34;31;65
;;;;;;;taux;44%;58%;51%

Escherichia coli Nissle 1917[modifier | modifier le wikicode]

ecoN opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Esch_coli_Nissle_1917/eschColi_NISSLE_1917-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP007799.1;ecoN;;genome;;;;;;;;;
50%GC;21.8.19 Paris;16s  10 ;123 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;;
Escherichia coli Nissle 1917 ;;;;;;;;;;;;
;231864..232436;;CDS;;365;365;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
;232802..234321;;16s;;73;;;;1520;;;
;234395..234471;;gaa;;12;;;12;;;;
;234484..234557;;gca;;174;;;;;;;
;234732..237319;;23s;;83;;;;2588;;;
;237403..237518;;5s;;54;;;;116;;;
;237573..237649;;gac;;162;162;;;;162;;
;237812..238615;;CDS;;;;;;268;;2,5-didehydrogluconate reductase DkgB;*
;;;;;;;;;;;;
;244934..245665;;CDS;;132;132;;;244;;DNA polymerase III subunit epsilon;*
;245798..245874;;gac;;120;120;;;;120;;
comp;245995..246852;;CDS;;;;;;286;;DUF4942 domain-containing protein;*
;;;;;;;;;;;;
;367329..368582;;CDS;;114;114;;;418;114;glutamate-5-semialdehyde dehydrogenase;*
;368697..368772;;acg;;154;154;;;;;;
;368927..369265;;CDS;;;;;;113;;DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;631149..632015;;CDS;;270;270;;;289;;bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD;*
;632286..632362;;aga;;15;15;;;;15;;
comp;632378..632997;;CDS;;;;;;207;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;733188..734363;;CDS;;153;153;;;392;153;2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;*
comp;734517..734591;;cag;+;37;;37;;;;;
comp;734629..734703;;cag;2 cag;48;;48;;;;;
comp;734752..734828;;atgj;2 atgj;15;;15;;;;;
comp;734844..734918;;caa;2 caa;34;;34;;;;;
comp;734953..735027;;caa;;23;;23;;;;;
comp;735051..735135;;cta;;10;;10;;;;;
comp;735146..735222;;atgj;;380;380;;;;;;
comp;735603..737267;;CDS;;;;;;555;;asparagine synthase B;*
;;;;;;;;;;;;
;807377..808169;;CDS;;164;164;;;264;164;Pseudo, cell division protein CpoB;*
;808334..808409;;aaa;+;35;;35;;;;;
;808445..808520;;gta;5 aaa;2;;2;;;;;
;808523..808598;;aaa;2 gta;51;;51;;;;;
;808650..808725;;gta;;3;;3;;;;;
;808729..808804;;aaa;;48;;48;;;;;
;808853..808928;;aaa;;33;;33;;;;;
;808962..809037;;aaa;;277;277;;;;;;
;809315..810358;;CDS;;;;;;348;;quinolinate synthase NadA;*
;;;;;;;;;;;;
;950069..952345;;CDS;;343;343;;;*759;343;ATP-dependent Clp protease ATP-binding subunit ClpA;*
comp;952689..952776;;tcc;;253;253;;;;;;
comp;953030..953248;;CDS;;;;;;73;;translation initiation factor IF-1;*
;;;;;;;;;;;;
comp;1047224..1047883;;CDS;;206;206;;;220;206;FtsH protease modulator YccA;*
comp;1048090..1048177;;tca;;426;*426;;;;;;
;1048604..1049722;;CDS;;;;;;373;;hydrogenase 1 small subunit;*
;;;;;;;;;;;;
;1183656..1184018;;CDS;;463;*463;;;121;;hp;*
;1184482..1184558;;aga;;278;278;;;;278;;
> comp;1184837..1185786;;CDS;;;;;;317;;Pseudo, IS4 family transposase;*
;;;;;;;;;;;;
;1213982..1214809;;CDS;;165;165;;;276;165;DUF4942 domain-containing protein;*
comp;1214975..1215062;;tcc;;233;233;;;;;;
;1215296..1216234;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1216817..1217098;;CDS;;165;165;;;94;165;DUF4942 domain-containing protein;*
comp;1217264..1217351;;tcc;;234;234;;;;;;
;1217586..1218524;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1457038..1458129;;CDS;;16;16;;;364;16;acyl-CoA desaturase;*
comp;1458146..1458277;;ncRNA;;46;;;;44;;RtT sRNA;
comp;1458324..1458408;;tac;+;33;;33;;;;;
comp;1458442..1458526;;tac;2 tac;159;159;;;;;;
comp;1458686..1459528;;CDS;;;;;;281;;formyltetrahydrofolate deformylase;*
;;;;;;;;;;;;
comp;1829066..1830322;;CDS;;307;307;;;419;;hp;*
;1830630..1830706;;gtc;+;4;;4;;;;;
;1830711..1830787;;gtc;2 gtc;6;6;;;;6;;
<;1830794..1831177;;CDS;@4;;;;;128;;Pseudo, multidrug efflux MATE transporter MdtK;*
;;;;;;;;;;;;
comp;1831218..1832474;;CDS;;307;307;;;419;;hp;*
;1832782..1832858;;gtc;+;4;;4;;;;;
;1832863..1832939;;gtc;2 gtc;8;8;;;;8;;
<;1832948..1833280;;CDS;;;;;;111;;Pseudo, MATE family efflux transporter;*
;;;;;;;;;;;;
comp;1833321..1834577;;CDS;;307;307;;;419;;hp;*
;1834885..1834961;;gtc;+;4;;4;;;;;
;1834966..1835042;;gtc;2 gtc;108;108;;;;108;;
;1835151..1835456;;CDS;;;;;;102;;monooxygenase;*
;;;;;;;;;;;;
comp;2115794..2116459;;CDS;;195;195;;;222;;UPF0149 family protein YecA;*
comp;2116655..2116741;;tta;;12;;12;;;;;
comp;2116754..2116827;;tgc;;53;;53;;;;;
comp;2116881..2116956;;ggc;;151;151;;;;151;;
comp;2117108..2117656;;CDS;;;;;;183;;CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase;*
;;;;;;;;;;;;
comp;2191451..2192287;;CDS;;278;278;;;279;;hp;*
comp;2192566..2192655;;tcg;;93;93;;;;93;;
;2192749..2193546;;CDS;;100;100;;;266;100;DgsA anti-repressor MtfA;*
;2193647..2193722;;aac;;161;161;;;;;;
;2193884..2195146;;CDS;;;;;;421;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2232607..2233323;;CDS;;453;*453;;;239;;YebC/PmpR family DNA-binding transcriptional regulator;*
comp;2233777..2233852;;acc;;326;326;;;;326;;
;2234179..2235096;;CDS;;;;;;306;;nitrogen assimilation transcriptional regulator;*
;;;;;;;;;;;;
;2235198..2236148;;CDS;;37;37;;;317;;HTH-type transcriptional regulator Cbl;*
comp;2236186..2236261;;aac;;4;4;;;;4;;
;2236266..2237909;;CDS;;100;100;;;548;100;toxic metabolite efflux MATE transporter YeeO;*
;2238010..2238085;;aac;;161;161;;;;;;
;2238247..2239518;;CDS;;;;;;424;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2546968..2548728;;CDS;;74;74;;;587;74;cardiolipin transport protein PbgA;*
;2548803..2548879;;ccc;;101;101;;;;;;
comp;2548981..2549136;;CDS;;;;;;52;;autotransporter outer membrane beta-barrel domain-containing protein;*
;;;;;;;;;;;;
;2717780..2718712;;CDS;;75;75;;;311;75;formate/nitrite transporter family protein;*
;2718788..2718862;;agg;;437;*437;;;;;;
comp;2719300..2719830;;CDS;;;;;;177;;OmpH family outer membrane protein;*
;;;;;;;;;;;;
comp;2768744..2770933;;CDS;;206;206;;;*730;206;sensor domain-containing phosphodiesterase;*
comp;2771140..2771215;;gcc;+;39;;39;;;;;
comp;2771255..2771330;;gcc;2 gcc;220;220;;;;;;
;2771551..2771910;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;2772355..2773770;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;2774029..2774104;;gta;+;43;;43;;;;;
;2774148..2774223;;gta;3 gta;46;;46;;;;;
;2774270..2774345;;gta;;4;;4;;;;;
;2774350..2774425;;aaa;;110;110;;;;110;;
comp;2774536..2775420;;CDS;;;;;;295;;LysR family transcriptional regulator;*
;;;;;;;;;;;;
comp;2959205..2960503;;CDS;;323;323;;;433;323;alpha-ketoglutarate permease;*
comp;2960827..2960942;;5s;;83;;;;116;;;
comp;2961026..2965477;;23s;;184;;;;4452;;;
comp;2965662..2965737;;gaa;;431;;;;;;;
comp;2966169..2967720;;16s;;441;*441;;;1552;;;
comp;2968162..2970735;;CDS;;;;;;*858;;ATP-dependent chaperone ClpB;*
;;;;;;;;;;;;
comp;3027207..3027773;;CDS;;280;280;;;189;280;fructose-1-phosphate/6-phosphogluconate phosphatase;*
comp;3028054..3028130;;cgt;+;63;;63;;;;;
comp;3028194..3028270;;cgt;5 cgt;62;;62;;;;;
comp;3028333..3028409;;cgt;;62;;62;;;;;
comp;3028472..3028548;;cgt;;64;;64;;;;;
comp;3028613..3028689;;cgt;;3;;3;;;;;
comp;3028693..3028785;;agc;;315;315;;;;;;
comp;3029101..3029286;;CDS;;;;;;62;;carbon storage regulator CsrA;*
;;;;;;;;;;;;
comp;3157337..3158434;;CDS;;208;208;;;366;208;murein transglycosylase A;*
;3158643..3158719;;atgf;+;33;;33;;;;;
;3158753..3158829;;atgf;3 atgf;33;;33;;;;;
;3158863..3158939;;atgf;;635;*635;;;;;;
;3159575..3160075;;CDS;;;;;;167;;type VI secretion system contractile sheath small subunit;*
;;;;;;;;;;;;
;3230172..3231401;;CDS;;316;316;;;410;;HAAAP family serine/threonine permease;*
comp;3231718..3231791;;ggg;;78;78;;;;78;;
comp;3231870..3232625;;CDS;;;;;;252;;peptidoglycan DD-metalloendopeptidase family protein;*
;;;;;;;;;;;;
;3341048..3341755;;CDS;;105;105;;;236;105;DUF554 domain-containing protein;*
;3341861..3341936;;ttc;;197;197;;;;;;
;3342134..3343399;;CDS;;;;;;422;;integrase arm-type DNA-binding domain-containing protein;*
;;;;;;;;;;;;
comp;3569308..3569814;;CDS;;124;124;;;169;;G/U mismatch-specific DNA glycosylase;*
;3569939..3570014;;atgi;;53;53;;;;53;;
comp;3570068..3570832;;CDS;;;;;;255;;NADPH-dependent ferric chelate reductase;*
;;;;;;;;;;;;
comp;3670227..3670679;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3670886..3670962;;atgf;;347;347;;;;;;
>;3671310..3672155;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3673935..3674387;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3674594..3674670;;atgf;;347;347;;;;;;
>;3675018..3675869;;CDS;;;;;;284;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3677794..3678246;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3678453..3678529;;atgf;;347;347;;;;;;
>;3678877..3679722;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3681532..3681984;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3682191..3682267;;atgf;;347;347;;;;;;
;3682615..3683958;;CDS;;;;;;448;;argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3683966..3685591;;CDS;;456;*456;;;542;;phosphoethanolamine transferase;*
comp;3686048..3686134;;ctc;;14;14;;;;14;;
comp;3686149..3686481;;CDS;;;;;;111;;preprotein translocase subunit SecG;*
;;;;;;;;;;;;
;3784553..3785311;;CDS;;62;62;;;253;62;amino acid ABC transporter ATP-binding protein;*
comp;3785374..3785489;;5s;@3;39;;;;116;;;
comp;3785529..3785605;;acc;;14;;;;;;;
comp;3785620..3785735;;5s;;777;;;;116;;;
comp;3786513..3786588;;acc;;14;;;;;;;
comp;3786603..3786718;;5s;;1834;;;;116;;;
comp;3788553..3788628;;gaa;;1360;*1360;;;;;;
;3789989..3790543;;CDS;;;;;;185;;gamma carbonic anhydrase family protein;*
;;;;;;;;;;;;
comp;4078635..4080242;;CDS;;743;*743;;;536;;dipeptide ABC transporter substrate-binding protein DppA;*
comp;4080986..4081062;;ccg;;91;91;;;;91;;
comp;4081154..4082845;;CDS;;;;;;564;;kdo(2)-lipid A phosphoethanolamine 7''-transferase;*
;;;;;;;;;;;;
comp;4205966..4207348;;CDS;;292;292;;;461;292;glycoside-pentoside-hexuronide family transporter;*
;4207641..4207735;;tga;;300;300;;;;;;
>;4208036..4208857;;CDS;;;;;;274;;Pseudo, DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;4338643..4339335;;CDS;;479;*479;;;231;;FadR family transcriptional regulator;*
;4339815..4341342;;16s;;73;;;;1528;;;
;4341416..4341491;;gaa;;184;;;;;;;
;4341676..4344286;;23s;;83;;;;2611;;;
;4344370..4344485;;5s;;53;;;;116;;;
;4344539..4344615;;gac;;8;;;;;;;
;4344624..4344699;;tgg;;95;95;;;;95;;
comp;4344795..4345634;;CDS;;;;;;280;;HTH-type transcriptional regulator HdfR;*
;;;;;;;;;;;;
;4377681..4379066;;CDS;;102;102;;;462;102;amino acid permease;*
;4379169..4379245;;cgg;;58;;58;;;;;
;4379304..4379379;;cac;;20;;20;;;;;
;4379400..4379486;;ctg;;42;;42;;;;;
;4379529..4379605;;cca;;146;146;;;;;;
;4379752..4380987;;CDS;;;;;;412;;anaerobic sulfatase maturase;*
;;;;;;;;;;;;
;4460971..4461516;;CDS;;377;377;;;182;;menaquinone-dependent protoporphyrinogen IX dehydrogenase;*
;4461894..4463631;;16s;;56;;;;1738;;;
;4463688..4463764;;atc;;42;;;42;;;;
;4463807..4463882;;gca;;165;;;;;;;
;4464048..4467338;;23s;;83;;;;3291;;;
;4467422..4467537;;5s;;104;104;;;116;104;;
comp;4467642..4468169;;CDS;;;;;;176;;molybdopterin-guanine dinucleotide biosynthesis protein B;*
;;;;;;;;;;;;
;4605577..4606434;;CDS;;374;374;;;286;;glutamate racemase;*
;4606809..4608362;;16s;;363;;;;1554;;;
;4608726..4608801;;gaa;;1112;;;;;;;
;4609914..4610029;;5s;;136;136;;;116;136;;
;4610166..4611194;;CDS;;;;;;343;;UDP-N-acetylenolpyruvoylglucosamine reductase;*
;;;;;;;;;;;;
comp;4612185..4613135;;CDS;;361;361;;;317;;type I pantothenate kinase;*
;4613497..4613572;;aca;;8;;8;;;;;
;4613581..4613665;;tac;;116;;*116;;;;;
;4613782..4613856;;gga;;6;;6;;;;;
;4613863..4613938;;acc;;114;114;;;;114;;
;4614053..4615237;;CDS;;;;;;395;;elongation factor Tu;*
;;;;;;;;;;;;
comp;4642984..4644573;;CDS;;616;*616;;;530;;bifunctional  phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ;*
;4645190..4646378;;16s’;@1;83;83;;;1189;83;;
;4646462..4648150;;CDS;;436;*436;;;563;;bifunctional isocitrate dehydrogenase kinase/phosphatase;*
;4648587..4648662;;gaa;;185;;;;;;;
;4648848..4651319;;23s;;83;;;;2472;;;
;4651403..4651518;;5s;;76;76;;;116;76;;
;4651595..4651978;;CDS;;;;;;128;;hypothetical protein;*
;;;;;;;;;;;;
< comp;4834504..4834961;;CDS;;197;197;;;153;;pseudo, integrase;*
comp;4835159..4835234;;ttc;;106;106;;;;106;;
comp;4835341..4835916;;CDS;;;;;;192;;transcriptional regulator;*
;;;;;;;;;;;;
;4864628..4865173;;CDS;;210;210;;;182;210;oligoribonuclease;*
;4865384..4865459;;ggc;+;36;;36;;;;;
;4865496..4865571;;ggc;3 ggc;35;;35;;;;;
;4865607..4865682;;ggc;;233;233;;;;;;
;4865916..4865969;;CDS;;;;;;18;;hp;*
;;;;;;;;;;;;
comp;4974178..4975197;;CDS;;195;195;;;340;;NADPH-dependent aldehyde reductase Ahr;*
;4975393..4975477;;ttg;;39;39;;;;39;;
<> comp;4975517..4976055;;CDS;;;;;;180;;pseudo, IS630 family transposase;*
;;;;;;;;;;;;
;5042527..5042763;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5042802..5042888;;ctg;+;34;;34;;;;;
comp;5042923..5043009;;ctg;3 ctg;28;;28;;;;;
comp;5043038..5043124;;ctg;;290;290;;;;;;
comp;5043415..5044446;;CDS;;;;;;344;;16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC;*
;;;;;;;;;;;;
comp;5079375..5079581;;CDS;;117;117;;;69;117;AlpA family transcriptional regulator;*
;5079699..5081218;;16s;;73;;;;1520;;;
;5081292..5081368;;gaa;;12;;;12;;;;
;5081381..5081454;;gca;;366;366;;;;;;
;5081821..5082018;;CDS;;524;*524;;;66;;hypothetical protein;*
comp;5082543..5082754;;CDS;;;;;;71;;hypothetical protein;*
;;;;;;;;;;;;
comp;5090325..5090876;;CDS;;1808;*1808;;;184;;MarR family transcriptional regulator;*
comp;5092685..5092760;;gaa;;588;*588;;;;*588;;
< comp ;5093349..5093474;;CDS;;592;*592;;;42;;sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB;*
;5094067..5094142;;gaa;+;1472;;;*1472;;;;
;5095615..5095691;;atc;3 gaa;42;;;42;;;;
;5095734..5095809;;atc;2 atc;1130;;;*1130;;;;
;5096940..5097015;;gaa;;1145;;;*1145;;;;
;5098161..5098236;;gaa;;185;;;;;;;
;5098422..5100893;;23s;;83;;;;2472;;;
;5100977..5101092;;5s;;76;76;;;116;76;;
;5101169..5101552;;CDS;;63;63;;;128;;hypothetical protein;*
comp;5101616..5102059;;CDS;;;;;;148;;acetyltransferase;*
;;;;;;;;;;;;
;5124754..5125197;;CDS;;63;63;;;148;;acetyltransferase;*
comp;5125261..5125644;;CDS;;76;76;;;128;;hypothetical protein;*
comp;5125721..5125836;;5s;;83;;;;116;;;
comp;5125920..5128366;;23s’;@2;-10;*-10;;;2447;*-10;;
<;5128357..5128479;;CDS;;;;;;41;;pilus assembly protein;*
;;;;;;;;;;;;
comp;5252659..5253870;;CDS;;300;300;;;404;;tyrosine-type recombinase/integrase;*
comp;5254171..5254249;;tga;;292;292;;;;292;;
>;5254542..5255171;;CDS;;;;;;210;;pseudo, glycoside-pentoside-hexuronide family transporter;*
;;;;;;;;;;;;
> comp;5305902..5306228;;CDS;;0;0;;;109;0;pseudo, hp;*
comp;5306229..5306302;;atc;;1096;*1096;;;;;;
;5307399..5308450;;CDS;;;;;;351;;pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada;*
;;;;;;;;;;;;
comp;5321144..5321869;;CDS;;206;206;;;242;206;pseudo, histidine kinase;*
comp;5322076..5322151;;gcc;+;39;;39;;;;;
comp;5322191..5322266;;gcc;3 gcc;39;;39;;;;;
comp;5322306..5322381;;gcc;;220;220;;;;;;
;5322602..5322961;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;5323406..5324821;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;5325080..5325155;;gta;+;44;;44;;;;;
;5325200..5325275;;gta;2 gta;0;0;;;;0;;
<;5325276..5325389;;CDS;;;;;;38;;pseudo, putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
>;5375524..5376270;;CDS;;891;*891;;;249;*891;pseudo, AI-2E family transporter;*
;5377162..5377237;;gaa;;1047;*1047;;;;;;
comp;5378285..5379589;;CDS;;;;;;435;;isocitrate lyase;*
;;;;;;;;;;;;
comp >;5341397..5341492;;CDS;;-2;*-2;;;32;*-2;ABC transporter ATP-binding protein;*
comp;5341491..5344303;;23s;;174;;;;2813;;;
comp;5344478..5344553;;gca;;42;;;42;;;;
comp;5344596..5344672;;atc;;56;;;;;;;
comp;5344729..5346282;;16s;;1063;;;;1554;;;
comp;5347346..5347421;;gca;;42;;;42;;;;
comp;5347464..5347540;;atc;;56;;;;;;;
comp;5347597..5349150;;16s;;365;365;;;1554;;;
comp;5349516..5350088;;CDS;;187;187;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
>;5350276..5350914;;CDS;;;;;;213;;methionine ABC transporter ATP-binding protein MetN;*
;;;;;;;;;;;;
> comp;5359583..5360512;;CDS;;120;120;;;310;;tyrosine-type recombinase/integrase;*
comp;5360633..5360708;;gca;;42;;;;;;;
comp;5360751..5360827;;atc;;56;;;;;;;
comp;5360884..5362138;;16s’;;1;1;;;1255;1;;
< comp;5362140..5363543;;CDS;;;;;;468;;IS66 family transposase;*
;;;;;;;;;;;;
;5425965..5426201;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5426240..5426325;;ctg;+;26;;26;;;;a disparu le 20.12.19;*
comp;5426352..5426438;;ctg;3 ctg;28;;28;;;;;
comp;5426467..5426553;;ctg;;63;63;;;;;;
< comp;5426617..5427150;;CDS;;;;;;178;;pseudo, IS630-like element IS630 family transposase;*
;;;;;;;;;;;;
>;5433568..5433687;;CDS;;39;39;;;40;39;pseudo, nicotinamide-nucleotide amidase;*
comp;5433727..5433814;;tcc;;253;253;;;;;;
comp;5434068..5434286;;CDS;;;;;;73;;translation initiation factor IF-1;*

ecoN cumuls[modifier | modifier le wikicode]

ecoN cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;12;1;0;;1;5;1;5;100;16;1;0
;16 23 5s;0;20;13;2;50;11;40;10;200;34;30;1
;16 atc gca;2;40;17;;100;17;80;7;300;29;60;6
;16 gaa 235;2;60;9;4;150;16;120;16;400;18;90;8
;max a;5;80;4;;200;15;160;3;500;18;120;8
;a doubles;1;100;0;;250;14;200;4;600;8;150;7
;spéciaux;8;120;1;;300;14;240;9;700;0;180;11
;total aas;27;140;0;;350;12;280;2;800;2;210;11
sans ;opérons;50;160;0;;400;7;320;2;900;1;240;6
;1 aa;32;180;0;;450;4;360;3;1000;0;270;9
;max a;7;200;0;;500;4;400;0;1100;0;300;12
;a doubles;15;;0;;;11;;2;;0;;0
;total aas;94;;44;6;;130;;63;;126;;79
total aas;;121;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;33;32;;253;;142;;272;;172
;;;variance;23;15;;258;;145;;162;;79
sans jaune;;;moyenne;31;;;178;;127;;260;;
;;;variance;19;;;109;;91;;142;;

ecoN blocs[modifier | modifier le wikicode]

ecoN blocs;;;;;;;;;;;;
gène;interca;pbs;cdsa;;;gène;interca;pbs;cdsa;;;rRNAs
cds;365;;191;D-glycero;;cds;374;;286;Glu race;;16s
16s;73;1520;;;;16s;363;1554;;;;1189
gaa;12;;;;;gaa;1112;;;;;1255
gca;174;;;;;5s;136;116;;;;1520
23s;83;2588;;;;cds;;;343;UDP-N;;1520
5s;54;116;;;;;;;;;;1528
gac;162;;;;;cds;117;;69;tr AlpA;;1552
cds;;;268;gluDkgB;;16s;73;1520;;;;1554
;;;;;;gaa;12;;;;;1554
cds;323;;433;glutarate pm;;gca;366;;;;;1554
5s;83;116;;;;cds;524;;66;hp-66;;1738
23s;184;4452;;;;cds;;;71;hp-71;;
gaa;431;;;;;;;;;;;
16s;441;1552;;;;cds;-2;;32;ABC 32;;23s
cds;;;858;ClpB dep;;23s;174;2813;;;;2447
;;;;;;gca;42;;;;;2472
cds;616;;530;AICAR2;;atc;56;;;;;2472
16s’;83;1189;;;;16s;1063;1554;;;;2588
cds;436;;563;kinase isocit;;gca;42;;;;;2611
gaa;185;;;;;atc;56;;;;;2813
23s;83;2472;;;;16s;365;1554;;;;3291
5s;76;116;;;;cds;187;;191;D-glycero;;4452
cds;;;128;hp-128;;cds;;;213;ABC MetN;;
;;;;;;;;;;;;5s
cds;62;;253;pu-ABC;;cds;120;;310;Tyr recb 310;;116 x 11
5s;39;116;;;;gca;42;;;;;
acc;14;;;;;atc;56;;;;;
5s;777;116;;;;16s’;1;1255;;;;
acc;14;;;;;cds;;;468;IS66;;
5s;1834;116;;;;;;;;;;
gaa;1360;;;;;cds;63;;148;transferase;;
cds;;;185;gc anhydrase;;cds;76;;128;hp-128;;
;;;;;;5s;83;116;;;;
cds;377;;182;porphyrine M;;23s’;-10;2447;;;;
16s;56;1738;;;;cds;;;41;pilus;;
atc;42;;;;;;;;;;;
gca;165;;;;;cds;1808;;184;MarR ;;
23s;83;3291;;;;gaa;588;;;;;
5s;104;116;;;;cds;592;;42;sn-glycerol;;
cds;;;176;Mlb pB;;gaa;1472;;;;;
;;;;;;atc;42;;;;;
cds;479;;231;FadR tr ;;atc;1130;;;;;
16s;73;1528;;;;gaa;1145;;;;;
gaa;184;;;;;gaa;185;;;;;
23s;83;2611;;;;23s;83;2472;;;;
5s;53;116;;;;5s;76;116;;;;
gac;8;;;;;cds;63;;128;hp-128;;
tgg;95;;;;;cds;;;148;transferase;;
cds;;;280;HdfR HTH;;;;;;;;

ecoN distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;4;3 gtc2;atgi;;tct;;tat;;atgf;;3 gtc2;atgi;;tct;;tat;;atgf;3;3 gtc2;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;
ttc;2;tcc;4;tac;;tgc;;tac2;ttc;;tcc;;tac;1;tgc;1;tac2;ttc;;tcc;;tac;2;tgc;;tac2;ttc;;tcc;;tac;;tgc;
atc;1;acc;1;aac;3;agc;;aaa3;atc;;acc;1;aac;;agc;1;aaa3;atc;2;acc;;aac;;agc;;aaa3;atc;;acc;2;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;atgf3;ctc;;ccc;;cac;1;cgt;;atgf3;ctc;;ccc;;cac;;cgt;5;atgf3;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;ggc3;gtc;;gcc;;gac;;ggc;1;ggc3;gtc;6;gcc;5;gac;;ggc;3;ggc3;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;2;atc :;tta;1;tca;;taa;;tga;;atc :;tta;;tca;;taa;;tga;;atc :;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;2;4 16s atc2 aa;ata;;aca;1;aaa;3;aga;;4 16s atc2 aa;ata;;aca;;aaa;3;aga;;4 16s atc2 aa;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;gaa :;cta;1;cca;1;caa;;cga;;gaa :;cta;;cca;;caa;2;cga;;gaa :;cta;;cca;;caa;;cga;
gta;;gca;;gaa;4;gga;;7 16s 5s 4aa;gta;2;gca;;gaa;;gga;1;7 16s 5s 4aa;gta;5;gca;;gaa;;gga;;7 16s 5s 4aa;gta;;gca;;gaa;1;gga;
ttg;1;tcg;1;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;2 5s >aa aa;atgj;2;acg;;aag;;agg;;2 5s >aa aa;atgj;;acg;;aag;;agg;;2 5s >aa aa;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;6;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
ecoN;;34;;;;;34;;ecoN;20;;;;;;20;;ecoN;44;;;;;;44;;ecoN;;;;6;;;6

ecoN eco[modifier | modifier le wikicode]

ecoN eco tableaux[modifier | modifier le wikicode]
;;;;;;rouge;ff6600;$;jaune;ffff00;#;;;;;;;;;;;
;;eco ecoN;;;;orange;ffcc00;&;cyan;66ffff;°;gris2;dddddd;];;;;;;;;
;;;;;;jaunev;ccff66;@;turquoise;33ff99;%;Jaunev 5;669900;(;;;;;;;;
;19.12.19 Paris;;pour les cds;;;bleu;00ccff;§;gris1;eeeeee;[;;;;;;;;;;;
;Escherichia coli str. K-12 substr. MG1655;;;;;;;;;;;;;;;;;;;;;
;eco;;;;;;;;ecoN;;;;;;;;;;;;;
cluster;sens;;gènes;interca;cdsa;cds;;cluster;sens;;gènes;interca;cdsa;cds;;ecoN suite;sens;;gènes;interca;cdsa;cds
eco1;;222833..223408;cds;362;192;@D-glycero;;ecoN1;;231864..232436;CDS;365;191;@D-glycero;;EcoN 48;comp;5079375..5079581;CDS;117;69;tr AlpA
;;223771..225312;$16s;68;&1542;;;;;232802..234321;$16s;73;&1520;;;ok;;5079699..5081218;$16s;73;&1520;
;;225381..225457;atc;42;;;;;;234395..234471;gaa;12;;;;;;5081292..5081368;gaa;12;;
;;225500..225575;gca;183;;;;;;234484..234557;gca;174;;;;;;5081381..5081454;gca;366;;
;;225759..228662;$23s;93;&2904;;;;;234732..237319;$23s;83;&2588;;;;;5081821..5082018;CDS;524;66;hp-66
;;228756..228875;$5s;52;&120;;;;;237403..237518;$5s;54;&116;;;;comp;5082543..5082754;CDS;;71;hp-71
;;228928..229004;gac;162;;;;;;237573..237649;gac;162;;;;;;;;;;
;;229167..229970;cds;;268;@metDkgB;;;;237812..238615;CDS;;268;@gluDkgB;;eco1;;222833..223408;cds;[362;192;]D-glycero
;;;;;;;;;;;;;;;;;;223771..225312;$16s;[68;&1542;
eco2;;236067..236798;cds;132;244;@DNAIIIe;;ecoN2;;244934..245665;CDS;132;244;@DNAIIIe;;;;225381..225457;atc;[42;;
;;236931..237007;gac;327;;;;;;245798..245874;gac;120;;;;;;225500..225575;gca;[183;;
;;237335..238120;cds;;262;§lipo YafT;;;comp;245995..246852;CDS;;286;§DUF4942;;;;225759..228662;$23s;93;&2904;
;;;;;;;;;;;;;;;;;;228756..228875;$5s;52;&120;
eco3;;261503..262756;cds;114;418;@glu5dH;;ecoN3;;367329..368582;CDS;114;418;@glu5dH;;;;228928..229004;gac;162;;
;;262871..262946;acg;203;;;;;;368697..368772;acg;154;;;;;;229167..229970;cds;;268;@metDkgB
;comp;263150..263212;cds;;21;§YdiA;;;;368927..369265;CDS;;113;§DUF4102;;EcoN 56;comp >;5341397..5341492;CDS;-2;32;]ABC 32
;;262898..297205;#phage;;11436;pp CP4-6;;;;;;;;;;ok;comp;5341491..5344303;$23s;]174;&2813;
;;;;;;;;;;;;;;;;;comp;5344478..5344553;gca;]42;;
eco4;comp;563848..564480;cds;242;211;§put FimZ;;ecoN4;comp;631149..632015;CDS;270;289;§cyclo FolD;;;comp;5344596..5344672;atc;]56;;
;;564723..564799;aga;15;;;;;;632286..632362;aga;15;;;;;comp;5344729..5346282;$16s;]1063;&1554;
;comp;564815..565978;cds;;388;§put DLP12;;;comp;632378..632997;CDS;;207;§Tyr recb 207;;;comp;5347346..5347421;gca;[42;;
;;564755..586056;#phage;;7101;pp DLP12;;;;;;;;;;;comp;5347464..5347540;atc;[56;;
;;;;;;;;;;;;;;;;;comp;5347597..5349150;$16s;[365;&1554;
eco5;;695101..696276;cds;31;392;@octaprenyl;;ecoN5;;733188..734363;CDS;153;392;@octaprenyl;;;comp;5349516..5350088;CDS;[187;191;]D-glycero
;comp;696308..696378;rpr;51;&71;rpt71;;;comp;734517..734591;°cag;37;;;;;>;5350276..5350914;CDS;;213;ABC MetN
;comp;696430..696504;°cag;37;;;;;comp;734629..734703;°cag;48;;;;eco35;eco;3422436..3423194;cds;228;253;pu-YhdZ
;comp;696542..696616;°cag;47;;;;;comp;734752..734828;atgj;15;;;;;comp;3423423..3423542;$5s;]37;&120;
;comp;696664..696740;atg;15;;;;;comp;734844..734918;°caa;34;;;;;comp;3423580..3423655;acc;]12;;
;comp;696756..696830;°caa;34;;;;;comp;734953..735027;°caa;23;;;;;comp;3423668..3423787;$5s;]92;&120;
;comp;696865..696939;°caa;23;;;;;comp;735051..735135;cta;10;;;;;comp;3423880..3426783;$23s;]174;&2904;
;comp;696963..697047;cta;9;;;;;comp;735146..735222;°atgj;380;;;;;comp;34