Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur

Une page de Wikiversité.
Aller à la navigation Aller à la recherche
Atableur
Image logo représentative de la faculté
Annexe 112
Recherche : Les clusters de gènes tRNA et rRNA chez les procaryotes
Précédent :archeo
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Annexe : Atableur
Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur
 », n'a pu être restituée correctement ci-dessus.



bacilli[modifier | modifier le wikicode]

Bacillus subtilis[modifier | modifier le wikicode]

bsu[modifier | modifier le wikicode]

  • Lien tableau: bsu
Bacillus subtilis subsp. subtilis str. 168;;;;
43.6%GC;7.3.19 Paris;86;doubles;intercal
;;;;
;9810..11364;16s;@2;99
;11464..11540;atc;;11
;11552..11627;gca;;81
;11709..14636;23s;;55
;14692..14810;5s;;
;;;;
; 22292..22384;tca;;
;;;;
;30279..31832;16s;;99
;31932..32008;atc;;11
;32020..32095;gca;;81
;32177..35103;23s;;133
;35237..35355;5s;;
;;;;
;70181..70257;atg;;9
;70267..70338;gaa;;
;;;;
;90536..92089;16s;@1;164
;92254..95181;23s;;55
;95237..95354;5s;;20
;95375..95450;gta;;4
;95455..95530;aca;;36
;95567..95642;aaa;;6
;95649..95731;cta;;40
;95772..95846;ggc;;14
;95861..95946;tta;;9
;95956..96032;cgt;;27
;96060..96136;cca;;9
;96146..96221;gca;;170
;96392..97945;16s;;164
;98110..101037;23s;;55
;101093..101211;5s;;
;;;;
;160893..162445;16s;;164
;162610..165535;23s;;55
;165591..165707;5s;;46
;165754..165825;aac;;4
;165830..165902;acc;;56
;165959..166033;ggc;;30
;166064..166140;cgt;;27
;166168..166244;cca;;8
;166253..166328;gca;;171
;166500..168053;16s;;164
;168218..171141;23s;;55
;171197..171314;5s;;183
;171498..173049;16s;;164
;173214..176141;23s;;55
;176197..176315;5s;;
;;;;
;194205..194279;gaa;;3
;194283..194358;gta;;4
;194363..194435;aca;;22
;194458..194542;tac;;4
;194547..194621;caa;;
;;;;
;528704..528778;aac;;4
;528783..528873;agc;;29
;528903..528974;gaa;;11
;528986..529060;caa;;26
;529087..529162;aaa;;11
;529174..529255;cta;;80
;529336..529422;ctc;;
;;;;
;635110..635186;cgt;;13
;635200..635273;gga;;159
;635433..636987;16s;;167
;637155..640082;23s;;55
;640138..640254;5s;;13
;640268..640344;atgf;;60
;640405..640481;gac;;
;;;;
;946696..948250;16s;;167
;948418..951345;23s;;111
;951457..951572;5s;;9
;951582..951656;aac;;5
;951662..951753;tcc;;34
;951788..951859;gaa;;9
;951869..951944;gta;;9
;951954..952030;atgf;;11
;952042..952118;gac;;12
;952131..952206;ttc;;5
;952212..952284;aca;;22
;952307..952391;tac;;5
;952397..952470;tgg;;24
;952495..952570;cac;;9
;952580..952651;caa;;49
;952701..952775;ggc;;5
;952781..952851;tgc;;7
;952859..952947;tta;@3;265
;953213..953294;ttg;;
;;;;
;967065..967138;gga;;
;;;;
;1262789..1262861;gtc;;
;;;;
comp;2003276..2003348;agg;;
;;;;
;2563889..2563959;caa;;
;;;;
comp;2899816..2899889;aga;;
;;;;
comp;3171879..3171950;gaa;;25
comp;3171976..3172066;agc;;3
comp;3172070..3172144;aac;;10
comp;3172155..3172231;atc;;15
comp;3172247..3172320;gga;;10
comp;3172331..3172406;cac;;17
comp;3172424..3172499;ttc;;12
comp;3172512..3172588;gac;;11
comp;3172600..3172676;atgf;;17
comp;3172694..3172786;tca;;6
comp;3172793..3172869;atgi;;2
comp;3172872..3172948;atgj;;19
comp;3172968..3173040;gca;;5
comp;3173046..3173122;cca;;15
comp;3173138..3173214;cgt;;9
comp;3173224..3173309;tta;;14
comp;3173324..3173398;ggc;;5
comp;3173404..3173490;ctg;;10
comp;3173501..3173576;aaa;;37
comp;3173614..3173689;aca;;32
comp;3173722..3173797;gta;;20
comp;3173818..3173935;5s;;55
comp;3173991..3176918;23s;;167
comp;3177086..3178640;16s;;
;;;;
comp;3194455..3194527;gcc;;
;;;;
comp;3545889..3545964;cgg;;
;;;;
comp;4154787..4154859;ttc;;35
comp;4154895..4154971;gac;;81
comp;4155053..4155124;gaa;;9
comp;4155134..4155209;aaa;;

bsu blocs[modifier | modifier le wikicode]

bsu blocs;;;;;;;;;
Types;;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2;II3
16s;167;167;164;164;;16s;164;164;164
23s;111;55;55;55;;23s;55;55;55
5s;9;20;46;20;;5s;;;
;5;32;4;4;;;;;
;aac;gta;aac;gta;;;;;
;**15aas;**20aas;**5aas;** 8aas;;;;;
III;;;;;;IV;;;
16s;99;99;;;;cgt;13;;
atc;11;11;;;;gga;159;;
gca;81;81;;;;16s;167;;
23s;55;133;;;;23s;55;;
5s;;;;;;5s;13;;
;;;;;;atgf;60;;
;;;;;;gac;;;
Groupes;;;;;;;;;
;16s;164;;;;16s;164;;
I3;23s;55;;;I4;23s;55;;
;5s;46;;;;5s;20;;
;aac;4;;;;gta;4;;
;**4aas;8;;;;** 7aas;9;;
;gca;171;;;;gca;170;;
II1;16s;164;;;II3;16s;164;;
;23s;55;;;;23s;55;;
II2;5s;183;;;;5s;;;
;16s;164;;;;;;;
;23s;55;;;;;;;
;5s;;;;;;;;

bsu intercalaires entre cds[modifier | modifier le wikicode]

bsu;1.2.21 Paris;;bsu 8.2.18;;;;;;;
bsu;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>frequence5
;'''négatif;609;14.4;'''négatif ;-12;19;-1 à -164;'''4 215 606;-1;609
;'''zéro;27;0.6;;;;;'''intercals;0;27
;'''1 à 200;3033;71.9;'''0 à 200;72;56;;'''401 590;5;165
;'''201 à 370;412;9.8;'''201 à 370;258;44;;'''9.5%;10;94
;'''371 à 600;117;2.8;'''371 à 600;458;67;;;15;255
;'''601 à max;18;0.4;'''601 à 1028;755;132;;;20;190
;'''total 4216;<201;87.0;'''total 4209;92;113;-164 à 1021;;25;133
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;122
390880;7511;-1;609;-70;20;;0;27;35;126
3671416;1306;0;27;-60;2;;-1;°72;40;153
2160565;1021;1;°44;-50;5;;-2;4;45;100
2221061;952;2;33;-40;19;;-3;0;50;65
2226176;950;3;37;-30;10;'''min à -1;-4;°243;55;54
1886057;824;4;°29;-20;38;609;-5;0;60;60
2733772;809;5;22;-10;105;14.4%;-6;2;65;62
785543;783;6;21;0;437;;-7;12;70;78
3699446;783;7;21;10;259;;-8;°76;75;84
2060817;777;8;10;20;445;;-9;1;80;71
875428;731;9;19;30;255;;-10;6;85;83
1446317;682;10;23;40;279;'''1 à 100;-11;°44;90;51
2051329;669;11;32;50;165;2089;-12;0;95;59
2054599;627;12;°57;60;114;49.5%;-13;6;100;57
873402;625;13;°51;70;140;;-14;°20;105;57
1872812;623;14;°59;80;155;;-15;0;110;73
1278565;619;15;°56;90;134;;-16;6;115;65
1900080;602;16;34;100;116;;-17;°18;120;61
1944113;594;17;°47;110;130;;-18;0;125;66
2091705;594;18;°49;120;126;;-19;5;130;61
548710;588;19;28;130;127;;-20;°12;135;51
674832;584;20;°32;140;93;;-21;0;140;42
554669;582;21;27;150;110;;-22;2;145;62
2708943;582;22;31;160;100;;-23;°8;150;48
4172387;577;23;25;170;91;'''1 à 200;-24;0;155;54
376032;573;24;°31;180;82;3033;-25;2;160;46
661630;573;25;19;190;59;71.9%;-26;°8;165;53
820867;572;26;25;200;53;;-27;0;170;38
560151;567;27;°24;210;58;;-28;0;175;42
2225337;560;28;17;220;31;;-29;°6;180;40
1883166;559;29;27;230;44;;-30;0;185;32
1441291;558;30;°29;240;43;;-31;1;190;27
3977791;555;31;25;250;34;'''0 à 200;-32;°2;195;32
552616;552;32;22;260;26;3060;;583;200;21
1269733;550;33;°34;270;35;;reste;53;205;34
2465966;548;34;18;280;29;;total;636;210;24
2763025;546;35;27;290;19;;;;215;15
2701979;544;36;°32;300;15;;;;220;16
3534118;538;37;18;310;16;;'''intercal;'''<u>frequencef;225;17
4128119;533;38;28;320;11;;600;4198;230;27
599107;531;39;°47;330;9;;620;2;235;24
;;40;28;340;17;'''201 à 370;640;3;240;19
;;reste;2342;350;11;412;660;0;245;19
;;total;4216;360;8;9.8%;680;1;250;15
;;;;370;6;;700;1;255;15
;;;;380;11;;720;0;260;11
'''adresse;'''intercaln;'''décalage;'''long;390;13;;740;1;265;20
387744;-7616;shift 2 gènes;3135;400;3;;760;0;270;15
2159981;-1389;;;410;11;;780;1;275;17
3717238;-500;shift 2 gènes;88;420;7;;800;2;280;12
2909520;-492;tronq 2 gènes;0;430;8;;820;1;285;11
2601528;-361;comp;;440;3;;840;1;290;8
1252815;-164;shift 2 gènes;43;450;7;;860;0;295;7
2466721;-154;shift 2 gènes;1079;460;1;;880;0;300;8
1916663;-143;shift 2 gènes;292;470;5;;900;0;305;8
3666841;-127;comp;;480;5;;920;0;310;8
2693597;-119;shift 2 gènes;823;490;8;;940;0;315;4
538322;-113;shift 2 gènes;412;500;3;;960;2;320;7
1322014;-101;shift 2 gènes;736;510;2;;980;0;325;5
238164;-95;;;520;4;;1000;0;330;4
1526859;-94;;;530;3;;1020;0;335;12
2652993;-93;;;540;3;'''371 à 600;1040;1;340;5
2758043;-92;;;550;4;117;;16;345;6
3755967;-91;;;560;5;2.8%;;;350;5
2154781;-86;;;570;1;;;;355;6
2705398;-82;;;580;4;'''601 à max;;;360;2
2154705;-71;;;590;4;18;;;365;4
989712;-69;;;600;2;0.4%;;;370;2
2413585;-65;;;reste;18;;reste;2;reste;135
2381919;-59;;;total;4216;;total;4216;total;4216

bsu autres intercalaires[modifier | modifier le wikicode]

bsu;autres intercalaires;;adresses1;;;bsu;autres intercalaires;;adresses2;;;bsu;autres intercalaires;;adresses3;;;bsu;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;6994;350;;;deb;°CDS;634651;333;comp;;deb;°CDS;1629320;144;;;deb;°CDS;2909520;125;
;$rRNA;9810;99;;;;&tRNA;635110;13;;;;misc_R;1630115;161;;;;misc_R;2910872;64;
;&tRNA;11464;11;;;;&tRNA;635200;159;;;fin;°CDS;1630382;;;;fin;°CDS;2911116;;
;&tRNA;11552;81;;;;$rRNA;635433;167;;;deb;°CDS;1675171;78;;;deb;°CDS;2952828;61;
;$rRNA;11709;55;;;;$rRNA;637155;55;;;;misc_R;1675981;19;;;;misc_R;2953411;244;
;$rRNA;14692;36;;;;$rRNA;640138;13;;;fin;°CDS;1676042;;;;fin;°CDS;2953795;;
fin;°CDS;14847;;comp;;;&tRNA;640268;60;;;deb;°CDS;1727133;10;;;deb;°CDS;2959257;43;
deb;°CDS;19968;52;;;;&tRNA;640405;180;;;;misc_R;1731457;101;;;;misc_R;2961232;106;
;misc_R;20611;56;;;fin;°CDS;640662;;;;fin;°CDS;1731776;;;;fin;°CDS;2961586;;
deb;°CDS;20880;134;;;deb;°CDS;692740;143;;;deb;°CDS;1778337;183;;;deb;°CDS;3033696;153;
;&tRNA;22292;111;;;;misc_R;694425;134;;;;misc_R;1780404;63;;;;misc_R;3035589;8;
fin;°CDS;22496;;comp;;fin;°CDS;694662;;;;fin;°CDS;1780618;;;;fin;°CDS;3035730;;
deb;°CDS;25852;41;;;deb;°CDS;698092;79;;;deb;°CDS;1914630;-4;;;deb;°CDS;3036603;23;
;misc_R;26379;81;;;;misc_R;698369;140;;;;misc_R;1914992;-52;;;;misc_R;3037895;44;
fin;°CDS;26814;;;;fin;°CDS;698612;;;;fin;°CDS;1915221;;;;fin;°CDS;3038213;;
deb;°CDS;29772;243;;;deb;°CDS;945520;291;;;deb;°CDS;1916955;198;;;deb;°CDS;3102629;109;
;$rRNA;30279;99;;;;$rRNA;946696;167;;;;misc_R;1917501;58;;;;misc_R;3105153;102;
;&tRNA;31932;11;;;;$rRNA;948418;111;;;fin;°CDS;1917639;;;;fin;°CDS;3105470;;
;&tRNA;32020;81;;;;$rRNA;951457;9;;;deb;°CDS;2002637;93;;;deb;°CDS;3127825;167;
;$rRNA;32177;133;;;;&tRNA;951582;5;;;;&tRNA;2003276;52;comp;;;misc_R;3129195;196;
;$rRNA;35237;175;;;;&tRNA;951662;34;;;fin;°CDS;2003401;;comp;;fin;°CDS;3129530;;
fin;°CDS;35531;;;;;&tRNA;951788;9;;;deb;°CDS;2024042;83;;;deb;°CDS;3169763;232;comp
deb;°CDS;69626;168;;;;&tRNA;951869;9;;;;misc_R;2025160;148;;;;&tRNA;3171879;25;comp
;&tRNA;70181;9;;;;&tRNA;951954;11;;;fin;°CDS;2025400;;;;;&tRNA;3171976;3;comp
;&tRNA;70267;199;;;;&tRNA;952042;12;;;deb;°CDS;2069262;170;;;;&tRNA;3172070;10;comp
fin;°CDS;70538;;;;;&tRNA;952131;5;;;;misc_R;2069732;-233;;;;&tRNA;3172155;15;comp
deb;°CDS;88727;309;;;;&tRNA;952212;22;;;fin;°CDS;2069883;;;;;&tRNA;3172247;10;comp
;$rRNA;90536;164;;;;&tRNA;952307;5;;;deb;°CDS;2076206;469;;;;&tRNA;3172331;17;comp
;$rRNA;92254;55;;;;&tRNA;952397;24;;;;misc_R;2079096;10;;;;&tRNA;3172424;12;comp
;$rRNA;95237;20;;;;&tRNA;952495;9;;;fin;°CDS;2079214;;;;;&tRNA;3172512;11;comp
;&tRNA;95375;4;;;;&tRNA;952580;49;;;deb;°CDS;2094010;123;;;;&tRNA;3172600;17;comp
;&tRNA;95455;36;;;;&tRNA;952701;5;;;;misc_R;2095909;238;;;;&tRNA;3172694;6;comp
;&tRNA;95567;6;;;;&tRNA;952781;7;;;fin;°CDS;2096350;;;;;&tRNA;3172793;2;comp
;&tRNA;95649;40;;;;&tRNA;952859;265;;;;misc_R;2160390;-630;;;;&tRNA;3172872;19;comp
;&tRNA;95772;14;;;;&tRNA;953213;78;;;deb;°CDS;2162108;-2547;;;;&tRNA;3172968;5;comp
;&tRNA;95861;9;;;fin;°CDS;953373;;comp;;;misc_f;2163068;420;;;;&tRNA;3173046;15;comp
;&tRNA;95956;27;;;deb;°CDS;954893;69;;;;misc_R;2164643;682;;;;&tRNA;3173138;9;comp
;&tRNA;96060;9;;;;misc_R;955655;132;;;fin;°CDS;2165577;;;;;&tRNA;3173224;14;comp
;&tRNA;96146;170;;;fin;°CDS;955895;;;;deb;°CDS;2208328;61;;;;&tRNA;3173324;5;comp
;$rRNA;96392;164;;;deb;°CDS;966671;193;comp;;;ncRNA;2208590;-26;;;;&tRNA;3173404;10;comp
;$rRNA;98110;55;;;;&tRNA;967065;90;;;fin;°CDS;2208855;;;;;&tRNA;3173501;37;comp
;$rRNA;101093;237;;;fin;°CDS;967229;;comp;;deb;°CDS;2219514;-23;;;;&tRNA;3173614;32;comp
fin;°CDS;101449;;;;deb;°CDS;1178757;89;;;;misc_R;2219743;-66;;;;&tRNA;3173722;20;comp
deb;°CDS;119111;45;;;;misc_R;1180685;106;;;fin;°CDS;2219784;;;;;$rRNA;3173818;55;comp
;misc_R;119855;65;;;fin;°CDS;1180909;;;;deb;°CDS;2273594;-6;;;;$rRNA;3173991;167;comp
fin;°CDS;120061;;;;deb;°CDS;1218113;58;;;;misc_R;2273705;104;;;;$rRNA;3177086;464;comp
deb;°CDS;152937;56;;;;misc_R;1219164;470;;;fin;°CDS;2273989;;;;;misc_R;3179105;99;
;misc_R;153737;48;;;fin;°CDS;1219849;;;;deb;°CDS;2319440;88;;;fin;°CDS;3179306;;
fin;°CDS;153842;;;;deb;°CDS;1233133;104;;;;misc_R;2320113;141;;;deb;°CDS;3187503;124;
deb;°CDS;159779;349;comp;;;misc_R;1233405;70;;;fin;°CDS;2320355;;;;;misc_R;3188173;72;
;$rRNA;160893;164;;;fin;°CDS;1233614;;;;deb;°CDS;2330075;87;;;fin;°CDS;3188414;;
;$rRNA;162610;55;;;deb;°CDS;1240356;61;;;;misc_R;2331320;58;;;deb;°CDS;3193863;106;
;$rRNA;165591;46;;;;misc_R;1242262;78;;;fin;°CDS;2331779;;;;;&tRNA;3194455;107;comp
;&tRNA;165754;4;;;fin;°CDS;1242449;;;;deb;°CDS;2410017;-9;;;fin;°CDS;3194635;;comp
;&tRNA;165830;56;;;deb;°CDS;1257414;167;;;;misc_R;2410581;197;;;deb;°CDS;3334646;423;
;&tRNA;165959;30;;;;misc_R;1258304;67;;;fin;°CDS;2411086;;;;;ncRNA;3335414;205;
;&tRNA;166064;27;;;fin;°CDS;1258492;;;;deb;°CDS;2430258;129;;;fin;°CDS;3335751;;
;&tRNA;166168;8;;;deb;°CDS;1261426;172;comp;;;misc_R;2431473;119;;;deb;°CDS;3359995;156;
;&tRNA;166253;171;;;;&tRNA;1262789;840;;;fin;°CDS;2431737;;;;;misc_R;3360937;-211;
;$rRNA;166500;164;;;fin;°CDS;1263702;;comp;;deb;°CDS;2471787;133;;;fin;°CDS;3360974;;
;$rRNA;168218;55;;;deb;°CDS;1375777;32;;;;misc_R;2472880;25;;;deb;°CDS;3363266;105;
;$rRNA;171197;183;;;;misc_R;1376328;77;;;fin;°CDS;2473151;;;;;misc_R;3364397;114;
;$rRNA;171498;164;;;fin;°CDS;1376517;;;;deb;°CDS;2548245;73;;;fin;°CDS;3364618;;
;$rRNA;173214;55;;;deb;°CDS;1377243;87;;;;misc_R;2549407;168;;;deb;°CDS;3403493;108;
;$rRNA;176197;767;;;;misc_R;1378233;52;;;fin;°CDS;2549775;;;;;misc_R;3404546;158;
fin;°CDS;177083;;;;fin;°CDS;1378496;;;;deb;°CDS;2562966;86;comp;;fin;°CDS;3404835;;
deb;°CDS;193570;179;comp;;deb;°CDS;1383320;127;;;;&tRNA;2563889;66;;;deb;°CDS;3419656;103;
;&tRNA;194205;3;;;;misc_R;1385736;132;;;fin;°CDS;2564026;;comp;;;misc_R;3421169;116;
;&tRNA;194283;4;;;fin;°CDS;1386024;;;;deb;°CDS;2607762;82;;;fin;°CDS;3421465;;
;&tRNA;194363;22;;;deb;°CDS;1391040;96;;;;misc_R;2608732;39;;;deb;°CDS;3449732;185;
;&tRNA;194458;4;;;;misc_R;1391739;101;;;fin;°CDS;2608946;;;;;misc_R;3450712;176;
;&tRNA;194547;227;;;fin;°CDS;1391953;;;;deb;°CDS;2624785;39;;;fin;°CDS;3451248;;
fin;°CDS;194849;;;;deb;°CDS;1395371;113;;;;misc_R;2625952;69;;;deb;°CDS;3489910;68;
deb;°CDS;198497;173;;;;misc_R;1395622;237;;;fin;°CDS;2626112;;;;;misc_R;3491322;97;
;misc_R;200017;89;;;fin;°CDS;1396013;;;;deb;°CDS;2646594;292;;;fin;°CDS;3491655;;
fin;°CDS;200277;;;;deb;°CDS;1409912;55;;;;misc_R;2647405;-208;;;deb;°CDS;3544642;284;
deb;°CDS;275838;56;;;;misc_R;1410633;-113;;;fin;°CDS;2647456;;;;;&tRNA;3545889;269;comp
;misc_R;276815;97;;;fin;°CDS;1410654;;;;deb;°CDS;2678240;-77;;;fin;°CDS;3546234;;
fin;°CDS;277160;;;;deb;°CDS;1423241;92;;;;misc_R;2678343;233;;;deb;°CDS;3854256;53;
deb;°CDS;473803;103;;;;misc_R;1424527;83;;;deb;°CDS;2678799;-13;;;;misc_R;3856226;31;
;misc_R;474329;133;;;fin;°CDS;1424767;;;;;misc_R;2678876;127;;;;misc_R;3856479;81;
fin;°CDS;474731;;;;deb;°CDS;1425641;38;;;fin;°CDS;2679142;;;;fin;°CDS;3856782;;
deb;°CDS;483845;135;;;;misc_R;1426876;84;;;deb;°CDS;2773356;136;;;deb;°CDS;3946394;0;
;misc_R;486092;196;;;fin;°CDS;1427061;;;;;misc_R;2773783;6;;;;misc_R;3946910;41;
fin;°CDS;486432;;;;deb;°CDS;1438092;138;;;fin;°CDS;2773890;;;;fin;°CDS;3947158;;
deb;°CDS;528129;122;;;;misc_R;1439274;129;;;;misc_R;2800890;43;;;;misc_R;3988840;388;
;&tRNA;528704;4;;;fin;°CDS;1439448;;;;deb;°CDS;2813643;83;;;deb;°CDS;3997221;65;
;&tRNA;528783;29;;;deb;°CDS;1456092;46;;;;misc_R;2814491;51;;;;misc_R;3997775;82;
;&tRNA;528903;11;;;;misc_R;1457005;30;;;fin;°CDS;2814743;;;;deb;°CDS;3997964;68;
;&tRNA;528986;26;;;fin;°CDS;1457187;;;;deb;°CDS;2816535;89;;;;misc_R;3999166;77;
;&tRNA;529087;11;;;deb;°CDS;1482248;85;;;;misc_R;2817899;59;;;fin;°CDS;3999350;;
;&tRNA;529174;80;;;;misc_R;1483557;476;;;fin;°CDS;2818191;;;;deb;°CDS;4004288;386;
;&tRNA;529336;82;;;fin;°CDS;1484117;;;;deb;°CDS;2855518;13;;;;misc_R;4005523;126;
fin;°CDS;529505;;comp;;deb;°CDS;1533327;368;;;;misc_R;2855840;57;;;fin;°CDS;4005752;;
deb;°CDS;532292;30;;;;misc_R;1534070;-161;;;fin;°CDS;2855973;;;;deb;°CDS;4095915;89;
;misc_R;532583;115;;;fin;°CDS;1534120;;;;deb;°CDS;2866664;59;;;;misc_R;4096997;6;
fin;°CDS;532758;;;;deb;°CDS;1568924;2;;;;misc_R;2869366;165;;;fin;°CDS;4097416;;
deb;°CDS;559264;67;;;;misc_R;1569199;199;;;fin;°CDS;2869754;;;;deb;°CDS;4153696;383;comp
;misc_R;559532;540;;;fin;°CDS;1569519;;;;deb;°CDS;2895248;121;;;;&tRNA;4154787;35;comp
fin;°CDS;560151;;;;;misc_R;1607367;87;;;;misc_R;2897094;447;;;;&tRNA;4154895;81;comp
deb;°CDS;625125;54;;;deb;°CDS;1612521;62;;;fin;°CDS;2897788;;;;;&tRNA;4155053;9;comp
;misc_R;626346;175;;;;misc_R;1613078;52;;;deb;°CDS;2898931;63;;;;&tRNA;4155134;223;comp
fin;°CDS;626622;;;;fin;°CDS;1613357;;;;;&tRNA;2899816;130;comp;;fin;°CDS;4155433;;comp
;;;;;;deb;°CDS;1617210;39;;;fin;°CDS;2900020;;comp;;deb;°CDS;4169166;189;
;;;;;;;misc_R;1618161;26;;;;;;;;;;misc_R;4169802;125;
;;;;;;deb;°CDS;1618304;3;;;;;;;;;fin;°CDS;4170045;;
;;;;;;;misc_R;1618853;52;;;;;;;;;;;;;
;;;;;;deb;°CDS;1619023;0;;;;;;;;;;;;;
;;;;;;;misc_R;1620331;30;;;;;;;;;;;;;
;;;;;;fin;°CDS;1620476;;;;;;;;;;;;;;
bsu intercalaires tRNA-cds[modifier | modifier le wikicode]
bsu;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;134;comp’;111;;122;52;'''deb;3
;168;;199;;134;107;;5
comp’;179;;227;;168;130;'''fin;5
;122;comp’;82;;232;180;;7
comp’;333;;180;;383;199;'''total;
;;comp’;78;;'''-;223;<201;8
comp’;193;comp’;90;;'''-;227;total;12
comp’;172;comp’;840;;'''-;'''-;taux;67%
comp’;93;;52;;'''-;'''-;'''comp’;'''cumuls
comp’;86;comp’;66;;63;66;'''deb;7
comp’;63;;130;;86;78;;9
;232;;;;93;82;'''fin;5
comp’;106;;107;;106;90;;7
comp’;284;comp’;269;;172;111;'''total;
;383;;223;;179;269;<201;12
;;;;;193;840;total;16
;;;;;284;'''-;taux;75%
;;;;;333;'''-;;
;;;;;;;;
;deb;fin;total;;;;;
<201;10;13;23;;;;;
total;14;19;33;;;;;
taux;71%;68%;70%;;;;;
bsu intercalaires tRNA-tRNA[modifier | modifier le wikicode]
bsu;intercalaires tRNA-tRNA;;sans les tRNAs bordés de rRNA;;
adresse;intercalr;adresse;intercalr;intercalr;fréquence
70181;9;3172793;2;1;
95375;4;194205;3;2;1
95455;36;3171976;3;3;2
95567;6;95375;4;4;5
95649;40;165754;4;5;6
95772;14;194283;4;6;2
95861;9;194458;4;7;1
95956;27;528704;4;8;1
96060;9;951582;5;9;8
165754;4;952131;5;10;3
165830;56;952307;5;11;4
165959;30;952701;5;12;2
166064;27;3172968;5;13;1
166168;8;3173324;5;14;2
194205;3;95567;6;15;2
194283;4;3172694;6;16;
194363;22;952781;7;17;2
194458;4;166168;8;18;
528704;4;70181;9;19;1
528783;29;95861;9;20;
528903;11;96060;9;21;
528986;26;951788;9;22;2
529087;11;951869;9;23;
529174;80;952495;9;24;1
635110;13;3173138;9;25;1
640268;60;4155053;9;26;1
951582;5;3172070;10;27;2
951662;34;3172247;10;28;
951788;9;3173404;10;29;1
951869;9;528903;11;30;1
951954;11;529087;11;31;
952042;12;951954;11;32;1
952131;5;3172512;11;33;
952212;22;952042;12;34;1
952307;5;3172424;12;35;1
952397;24;635110;13;36;1
952495;9;95772;14;37;1
952580;49;3173224;14;38;
952701;5;3172155;15;39;
952781;7;3173046;15;40;1
952859;265;3172331;17;41;
3171879;25;3172600;17;42;
3171976;3;3172872;19;43;
3172070;10;194363;22;44;
3172155;15;952212;22;45;
3172247;10;952397;24;46;
3172331;17;3171879;25;47;
3172424;12;528986;26;48;
3172512;11;95956;27;49;1
3172600;17;166064;27;50;
3172694;6;528783;29;51;
3172793;2;165959;30;52;
3172872;19;3173614;32;53;
3172968;5;951662;34;54;
3173046;15;4154787;35;55;
3173138;9;95455;36;56;1
3173224;14;3173501;37;57;
3173324;5;95649;40;58;
3173404;10;952580;49;59;
3173501;37;165830;56;60;1
3173614;32;640268;60;reste;3
4154787;35;529174;80;total;64
4154895;81;4154895;81;;
4155053;9;952859;265;;

bsu distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;1;tct;;tat;;atgf;2
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
avant 16s;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
cgt;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
gga;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;1;tgc;;;;;;;;;;;;ttc;2;tcc;1;tac;1;tgc;1
;atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;;;;;;;;;;atc;1;acc;1;aac;3;agc;1
après 5s;ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;3
atgf;gtc;1;gcc;1;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;2;ggc;4
gac;tta;;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;1;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;1;aaa;2;aga;;;;;;;;;;;;ata;;aca;3;aaa;2;aga;
;cta;;cca;;caa;1;cga;;;cta;1;cca;;caa;2;cga;;;;;;;;;;;;cta;1;cca;3;caa;1;cga;
;gta;;gca;;gaa;;gga;1;;gta;1;gca;;gaa;4;gga;;;;;;;;;;;;gta;3;gca;3;gaa;2;gga;1
;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;1
;atgj;;acg;;aag;;agg;1;;atgj;1;acg;;aag;;agg;;;;;;;;;;;;atgj;1;acg;;aag;;agg;
;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;1;ccg;;cag;;cgg;
;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;bsu;;8;;;;;8;;bsu;18;;;;;;18;;;;;;;;;;;bsu;;;;52;2;;56
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2   1-3aas;;;

bsu lmo[modifier | modifier le wikicode]

bsu-lmo  comparaison;;10.11.19 Tanger;;;comparaisons internes bsu, lmo;;;;
bsu;intercal;lmo;intercal;diff;bsu;intercal;bsu;intercal;diff
gaa;25;gaa;5;-20;16s;167;16s;167;
agc;3;agc;34;31;23s;55;23s;111;
aac;10;aac;6;-4;5s;20;5s;9;
atc;15;atc;25;10;gta;32;aac;5;
gga;10;gga;23;13;aca;37;tcc;34;
cac;17;cac;28;11;aaa;10;gaa;9;
ttc;12;ttc;4;-8;ctg;5;gta;9;
gac;11;gac;4;-7;ggc;14;atgf;11;0
atgf;17;atgf;42;25;tta;9;gac;12;0
tca;6;tca;22;16;cgt;15;ttc;5;
atgi;2;atgi;11;9;cca;5;aca;22;
atgj;19;atgj;42;23;gca;19;tac;5;
gca;5;gca;22;17;atgj;2;tgg;24;
cca;15;cca;10;-5;atgi;6;cac;9;
cgt;9;cgt;9;0;tca;17;caa;49;
tta;14;tta;14;0;atgf;11;ggc;5;
ggc;5;ggc;15;10;gac;12;tgc;7;
ctg;10;cta;5;-5;ttc;17;tta;265;
aaa;37;aaa;41;4;cac;10;ttg;;
aca;32;aca;8;-24;gga;15;;;
gta;20;gta;13;;atc;10;16s;164;
5s;55;5s;81;;aac;3;23s;55;
23s;167;23s;244;;agc;25;5s;20;
16s;;16s;;;gaa;;gta;4;-28
;;;;;;;aca;36;-1
16s;167;16s;127;;;;aaa;6;-4
23s;111;atc;46;;;;cta;40;35
5s;9;gca;172;;;;ggc;14;0
aac;5;23s;80;;;;tta;9;0
tcc;34;5s;14;;;;cgt;27;12
gaa;9;aac;6;1;;;cca;9;4
gta;9;tcc;33;-1;;;gca;170;
atgf;11;gaa;56;47;;;;;
gac;12;gta;21;12;lmo;intercal;lmo;intercal;diff
ttc;5;atgf;6;-5;16s;244;16s;127;
aca;22;gac;4;-8;23s;81;atc;46;
tac;5;ttc;20;;5s;13;gca;172;
tgg;24;tac;7;2;gta;8;23s;80;
cac;9;tgg;15;-9;aca;41;5s;14;
caa;49;cac;29;20;aaa;5;aac;6;
ggc;5;caa;5;-44;cta;15;tcc;33;
tgc;7;ggc;19;14;ggc;14;gaa;56;
tta;265;tgc;45;;tta;9;gta;21;
ttg;;ttg;;;cgt;10;atgf;6;2
;;;;;cca;22;gac;4;0
16s;164;16s;244;;gca;42;ttc;20;
23s;55;23s;80;;atgj;11;tac;7;
5s;20;5s;13;;atgi;22;tgg;15;
gta;4;gta;8;4;tca;42;cac;29;
aca;36;aca;41;5;atgf;4;caa;5;
aaa;6;aaa;5;-1;gac;4;ggc;19;
cta;40;cta;14;-26;ttc;28;tgc;45;
ggc;14;ggc;21;7;cac;23;ttg;;
tta;9;tta;12;3;gga;25;;;
cgt;27;cgt;10;-17;atc;6;16s;244;
cca;9;cca;19;10;aac;34;23s;80;
gca;170;gca;341;;agc;5;5s;13;
;;;;;gaa;;gta;8;0
;;;;;;;aca;41;0
;;;;;;;aaa;5;0
;;;;;;;cta;14;-1
;;;;;;;ggc;21;7
;;;;;;;tta;12;3
;;;;;;;cgt;10;0
;;;;;;;cca;19;-3
;;;;;;;gca;341;
;;;;;;;;;
bsu;intercal;lmo;intercal;diff;entre génomes;;;intra génome;
gaa;3;gaa;157;;gamme;fréquence;;gamme;fréquence
gta;4;acg;9;;-15;5;;-7;1
aca;22;tac;11;;-14;;;-6;
tac;4;caa;6;;-13;;;-5;
caa;;aaa;;;-12;;;-4;1
;;;;;-11;;;-3;1
aga;;aga;;;-10;;;-2;
;;;;;-9;1;;-1;2
cgg;;cgg;;;-8;2;;0;9
;;;;;-7;1;;1;
gga;;gga;;;-6;;;2;1
;;;;;-5;3;;3;1
gtc;;gtc;;;-4;1;;4;1
;;;;;-3;;;5;
agg;;cgt;;;-2;;;6;
;;;;;-1;2;;7;1
caa;;ctc;;;0;2;;;2
;;;;;1;1;;total;20
gcc;;tcg;;;2;1;; -2+2;11
;;;;;3;1;;;
tca;;;;;4;2;;;
;;;;;5;1;;;
atg;9;aac;3;;6;;;;
gaa;;agc;;;7;1;;;
;;;;;8;;;;
;;gaa;27;;9;1;;;
;;gac;;;10;3;;;
;;;;;11;1;;;
cgt;13;16s;127;;12;1;;;
gga;159;atc;46;;13;1;;;
16s;167;gca;172;;14;1;;;
23s;55;23s;80;;15;;;;
5s;13;5s;14;;;7;;;
atgf;60;aac;24;;total;39;;;
gac;;acc;;; -2+2;6;;;

Listeria monocytogenes[modifier | modifier le wikicode]

lmo[modifier | modifier le wikicode]

  • Lien tableau: lmo
Listeria monocytogenes EGD-e;;;;
37.9%GC;7.3.19 Paris;67;doubles;intercal
;82705..82777;aag;;
;237466..239020;16s;@1;244
;239265..242195;23s;;80
;242276..242385;5s;;13
;242399..242471;gta;;8
;242480..242555;aca;;41
;242597..242669;aaa;;5
;242675..242756;cta;;14
;242771..242842;ggc;;21
;242864..242949;tta;;12
;242962..243035;cgt;;10
;243046..243119;cca;;19
;243139..243214;gca;;341
;243556..245041;16s;;244
;245286..248216;23s;;80
;248297..248406;5s;;
;;;;
;677464..677553;tcg;;
;;;;
;936656..936728;aac;;3
;936732..936819;agc;;
;;;;
;940017..940088;gaa;;27
;940116..940188;gac;;
;;;;
;970867..970937;gga;;
;;;;
;1266675..1266748;aga;;
;;;;
comp;1740916..1740987;gaa;;5
comp;1740993..1741083;agc;;34
comp;1741118..1741190;aac;;6
comp;1741197..1741270;atc;;25
comp;1741296..1741366;gga;;23
comp;1741390..1741462;cac;;28
comp;1741491..1741563;ttc;;4
comp;1741568..1741643;gac;;4
comp;1741648..1741721;atgf;;42
comp;1741764..1741853;tca;;22
comp;1741876..1741949;atgi;;11
comp;1741961..1742034;atgj;;42
comp;1742077..1742149;gca;;22
comp;1742172..1742245;cca;;10
comp;1742256..1742329;cgt;;9
comp;1742339..1742424;tta;;14
comp;1742439..1742513;ggc;;15
comp;1742529..1742610;cta;;5
comp;1742616..1742688;aaa;;41
comp;1742730..1742805;aca;;8
comp;1742814..1742886;gta;;13
comp;1742900..1743009;5s;;81
comp;1743091..1746021;23s;;244
comp;1746266..1747811;16s;;
;;;;
;1776112..1776183;cgt;;
;;;;
comp;1848821..1848930;5s;;81
comp;1849012..1851942;23s;;244
comp;1852187..1853732;16s;;
;;;;
;2162187..2162273;ctc;;
;;;;
;2215375..2215446;gaa;;157
;2215604..2215677;acg;;9
;2215687..2215770;tac;;11
;2215782..2215856;caa;;6
;2215863..2215935;aaa;;
;;;;
comp;2436493..2436576;ttg;;45
comp;2436622..2436695;tgc;;19
comp;2436715..2436786;ggc;;5
comp;2436792..2436863;caa;;29
comp;2436893..2436965;cac;;15
comp;2436981..2437054;tgg;;7
comp;2437062..2437145;tac;;20
comp;2437166..2437238;ttc;;4
comp;2437243..2437318;gac;;6
comp;2437325..2437398;atgf;;21
comp;2437420..2437495;gta;;56
comp;2437552..2437623;gaa;;33
comp;2437657..2437745;tcc;;6
comp;2437752..2437827;aac;;14
comp;2437842..2437951;5s;;80
comp;2438032..2440962;23s;;172
comp;2441135..2441210;gca;;46
comp;2441257..2441330;atc;;127
comp;2441458..2443003;16s;@2;
;;;;
comp;2540230..2540301;cgg;;
;;;;
comp;2672664..2672736;acc;;24
comp;2672761..2672836;aac;;14
comp;2672851..2672960;5s;;80
comp;2673041..2675971;23s;;172
comp;2676144..2676219;gca;;46
comp;2676266..2676339;atc;;127
comp;2676467..2678012;16s;;
;;;;
;2930362..2930434;gtc;;

lmo distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;1;tct;;tat;;atgf;2
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
après 5s;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
acc;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
aac;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;1;tgc;;;;;;;;;;;;ttc;2;tcc;1;tac;1;tgc;1
;atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;;;;;;;;;;atc;1;acc;0;aac;2;agc;1
;ctc;1;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;2
;gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;2;ggc;3
;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;2;tca;1;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;;aaa;1;aga;;;;;;;;;;;;ata;;aca;2;aaa;2;aga;
;cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;;;;;;;;;;cta;2;cca;2;caa;1;cga;
;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;2;gga;;;;;;;;;;;;gta;3;gca;2;gaa;2;gga;1
;ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;1
;atgj;;acg;;aag;1;agg;;;atgj;;acg;1;aag;;agg;;;;;;;;;;;;atgj;1;acg;;aag;;agg;
;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;lmo;;8;;;;;8;;lmo;9;;;;;;9;;;;;;;;;;;lmo;;;;44;;;44
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2   1-3aas;;;

lmo blocs[modifier | modifier le wikicode]

lmo blocs;;;;;;;;
Types;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2
16s;;244;;244;;16s;244;244
23s;;81;;80;;23s;80;81
5s;;13;;13;;5s;;
;;8;;8;;;;
;;gta;;gta;;;;
;;**20aas;;**8aas;;;;
III;;;;;;IV;;
16s;127;127;;;;;;
atc;46;46;;;;;;
gca;172;172;;;;;;
23s;80;80;;;;;;
5s;14;14;;;;;;
;6;24;;;;;;
;aac;aac;;;;;;
;**13aas;acc;;;;;;
Groupes;;;;;;;;
;;;;;;16s;244;
;;;;;I4;23s;80;
;;;;;;5s;13;
;;;;;;gta;8;
;;;;;;**7aas;19;
;;;;;;gca;341;
;;;;;;16s;244;
;;;;;II1;23s;80;
;;;;;;5s;;

lam[modifier | modifier le wikicode]

  • Lien tableau: lam
;Lactobacillus amylovorus strain 30SC;;;
38%GC;30.6.19 Paris;63;doubles;intercal
;447399..448972;16s;@1;125
;449098..449172;atc;;52
;449225..449297;gca;;115
;449413..452324;23s;;68
;452393..452509;5s;;4
;452514..452586;gta;;2
;452589..452661;aaa;;13
;452675..452756;cta;;23
;452780..452852;aca;;10
;452863..452934;ggc;;11
;452946..453031;tta;;8
;453040..453113;cgt;;5
;453119..453192;cca;;29
;453222..453295;atg;;12
;453308..453381;atgi;;27
;453409..453482;atgf;;3
;453486..453559;gac;;6
;453566..453638;ttc;;19
;453658..453728;gga;;5
;453734..453808;atc;;2
;453811..453900;agc;;
;;;;
;57091..58664;16s;;125
;58790..58864;atc;;52
;58917..58989;gca;;115
;59105..62016;23s;;68
;62085..62201;5s;;13
;62215..62287;aac;;
;;;;
;469566..471139;16s;@2;9
;471149..471334;cds1; hp 186;-3
;471332..474243;23s;;68
;474312..474428;5s;;13
;474442..474514;aac;;
;;;;
comp;1709284..1709374;tcc;;10
comp;1709385..1709457;aac;;13
comp;1709471..1709587;5s;;68
comp;1709656..1712567;23s;;-3
comp;1712565..1712750;cds2;hp 186;9
comp;1712760..1714333;16s;;
;;;;
comp;79386..79458;aag;;
;;;;
comp;79913..79985;aag;;
;;;;
;193922..193994;acc;;
;;;;
comp;210866..210939;ggg;;
;;;;
;287678..287752;ggc;+;111
;287864..287938;ggc;3 ggc;109
;288048..288122;ggc;;35
;288158..288231;ccg;;
;;;;
;457611..457682;gaa;;35
;457718..457804;tca;;9
;457814..457887;atgf;;3
;457891..457964;gac;;6
;457971..458046;ttc;;4
;458051..458132;tac;;4
;458137..458207;tgg;;12
;458220..458295;cac;;4
;458300..458371;caa;;23
;458395..458465;tgc;;40
;458506..458590;ttg;;
;;;;
;474442..474514;aac;;
;;;;
;507688..507760;acg;;
;;;;
;526886..526957;caa;;
;;;;
;551550..551631;tac;;34
;551666..551737;caa;;
;;;;
;567329..567416;ctt;;
;;;;
;583327..583413;tca;;6
;583420..583493;gac;;7
;583501..583576;cac;;4
;583581..583653;gta;;
;;;;
;642034..642106;agg;;
;;;;
comp;729370..729441;cgg;;
;;;;
;784793..784864;gag;;
;;;;
;917887..917975;tcg;;
;;;;
;1456724..1456800;aga;;
;;;;
;1681218..1681301;ctg;;
;;;;
comp;1707998..1708070;gta;;5
comp;1708076..1708147;gaa;;
;;;;
;1987190..1987263;cgt;;8
;1987272..1987345;cca;;

lam blocs[modifier | modifier le wikicode]

lam blocs;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds1;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;4;117;aac;;
gta;;;;;
;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds2;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;13;117;aac;;
aac;;;;;

lam distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1
1-3 aas;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
après 5s;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
3 aac;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
tcc;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;2;tgc;1;;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;;tgc;
;atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;;;atc;1;acc;;aac;;agc;1
>1aa;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;1;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;1
ggc3;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;;;gtc;;gcc;;gac;;ggc;3;;gtc;;gcc;;gac;1;ggc;1
;tta;;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;;taa;;tga;
;ata;;aca;;aaa;;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;
;cta;;cca;;caa;1;cga;;;cta;;cca;1;caa;2;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;;cga;
;gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;;;gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;;gga;1
;ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
;atgj;;acg;1;aag;2;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;
;ctg;1;ccg;;cag;;cgg;1;;ctg;;ccg;1;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
;gtg;;gcg;;gag;1;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
;lam;;14;;;;;14;;lam;22;;;;;;22;;lam;3;;;;;;3;;lam;;;;16;;;16
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4   1-3aas;;;

ppm[modifier | modifier le wikicode]

opérons[modifier | modifier le wikicode]

ppm chromosome[modifier | modifier le wikicode]
45.5%GC;26.7.19 Paris;16s 13;110;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Paenibacillus polymyxa SC2;;;;;;;;;;
;10545..11633;;CDS;;327;327;;;363;
;11961..13519;;16s;;280;;;;;
;13800..16728;;23s;;143;;;;;
;16872..16988;;5s;;232;232;;;;232
;17221..17640;;CDS;;93 855;;;;140;
;;;;;;;;;;
comp;111496..112530;;CDS;;616;;;;345;
;113147..114705;;16s;;207;;;;;
;114913..117843;;23s;;76;;;;;
;117920..118036;;5s;;343;343;;;;
;118380..119837;;CDS;;3 348;;;;486;
;;;;;;;;;;
;123186..124469;;CDS;;90;90;;;428;90
;124560..124648;;tca;;145;145;;;;
;124794..125135;;CDS;;55 592;;;;114;
;;;;;;;;;;
;180728..181003;;CDS;;412;;;;92;
;181416..182974;;16s;;108;;;;;
;183083..183199;;5s;@1;39;;;;;
;183239..183315;;atc;;20;;;20;;
;183336..183411;;gca;;128;;;;;
;183540..186468;;23s;;130;;;;;
;186599..186690;;agc;;28;;;28;;
;186719..186795;;atgj;;10;;;10;;
;186806..186881;;gta;;4;;;4;;
;186886..186961;;aca;;19;;;19;;
;186981..187057;;gac;;77;;;77;;
;187135..187210;;ttc;;6;;;6;;
;187217..187302;;tac;;7;;;7;;
;187310..187385;;aaa;;154;154;;;;154
;187540..188682;;CDS;;24 062;;;;381;
;;;;;;;;;;
comp;212745..213341;;CDS;;211;211;;;199;211
comp;213553..213624;;cgg;;259;259;;;;
;213884..214921;;CDS;;238 832;;;;346;
;;;;;;;;;;
;453754..455364;;CDS;;392;;;;537;
;455757..457315;;16s;;207;;;;;
;457523..460453;;23s;;76;;;;;
;460530..460646;;5s;;34;;;;;
;460681..460757;;atc;;22;;;22;;
;460780..460855;;gca;;4;;;4;;
;460860..460935;;aac;;34;;;34;;
;460970..461043;;atgj;;3;;;3;;
;461047..461138;;agc;;31;;;31;;
;461170..461241;;gaa;;6;;;6;;
;461248..461323;;gta;;10;;;10;;
;461334..461407;;atgf;;25;;;25;;
;461433..461509;;gac;;50;;;50;;
;461560..461635;;ttc;;22;;;22;;
;461658..461733;;aca;;5;;;5;;
;461739..461824;;tac;;16;;;16;;
;461841..461913;;cac;;18;;;18;;
;461932..462006;;caa;;4;;;4;;
;462011..462086;;aaa;;15;;;15;;
;462102..462189;;ctg;;6;;;6;;
;462196..462270;;ggc;;10;;;10;;
;462281..462351;;tgc;;26;;;26;;
;462378..462454;;cgt;;22;;;22;;
;462477..462550;;cca;;9;;;9;;
;462560..462630;;gga;;204;204;;;;204
comp;462835..463938;;CDS;;1 537;;;;368;
;;;;;;;;;;
;465476..466216;;CDS;;524;;;;247;
;466741..468299;;16s;;207;;;;;
;468507..471434;;23s;;76;;;;;
;471511..471627;;5s;;629;;;;;
;472257..473588;;CDS;;103 459;;;;444;
;;;;;;;;;;
;577048..577794;;CDS;;1 116;;;;249;
;578911..580469;;16s;;207;;;;;
;580677..583607;;23s;;76;;;;;
;583684..583800;;5s;;82;;;;;
;583883..583958;;gca;;4;;;4;;
;583963..584038;;aac;;3;;;3;;
;584042..584133;;tcc;;19;;;19;;
;584153..584224;;gaa;;9;;;9;;
;584234..584309;;gta;;29;;;29;;
;584339..584412;;atgf;;25;;;25;;
;584438..584514;;gac;;13;;;13;;
;584528..584603;;aca;;4;;;4;;
;584608..584693;;tac;;102;;;102;;
;584796..584870;;caa;;4;;;4;;
;584875..584950;;aaa;;12;;;12;;
;584963..585043;;cta;;10;;;10;;
;585054..585128;;ggc;;5;;;5;;
;585134..585210;;cgt;;12;;;12;;
;585223..585302;;ttg;;7;;;7;;
;585310..585386;;cca;;7;;;7;;
;585394..585464;;gga;;1 133;;;;;
;586598..587560;;CDS;;22 016;;;;321;
;;;;;;;;;;
;609577..609924;;CDS;;73;73;;;116;73
;609998..610069;;acg;;1 613;;;;;
comp;611683..612030;;CDS;;140 810;;;;116;
;;;;;;;;;;
;752841..754124;;CDS;;611;;;;428;
;754736..756294;;16s;;208;;;;;
;756503..759431;;23s;;75;;;;;
;759507..759623;;5s;;183;183;;;;183
comp;759807..760232;;CDS;;173 078;;;;142;
;;;;;;;;;;
;933311..934681;;CDS;;449;;;;457;
;935131..936689;;16s;;221;;;;;
;936911..939839;;23s;;76;;;;;
;939916..940032;;5s;;216;216;;;;216
;940249..941241;;CDS;;521 183;;;;331;
;;;;;;;;;;
;1462425..1462937;;CDS;;44;44;;;171;44
;1462982..1463057;;aac;;1;;1;;;
;1463059..1463147;;agc;;122;122;;;;
comp;1463270..1464145;;CDS;;74;;;;292;
;;;;;;;;;;
comp;1464220..1464981;;CDS;;246;246;;;254;
;1465228..1465299;;gaa;;86;;86;;;
;1465386..1465461;;aaa;;15;;15;;;
;1465477..1465562;;ctc;;162;162;;;;162
;1465725..1466180;;CDS;;1 667;;;;152;
;;;;;;;;;;
comp;1467848..1468585;;CDS;;262;262;;;246;
;1468848..1468930;;ctc;;148;148;;;;148
comp;1469079..1469564;;CDS;;112 990;;;;162;
;;;;;;;;;;
;1582555..1583361;;CDS;;490;;;;269;
;1583852..1583925;;ccc;;244;244;;;;
comp;1584170..1585441;;CDS;;32 099;;;;424;
;;;;;;;;;;
;1617541..1619682;;CDS;;107;107;;;714;107
;1619790..1619860;;gga;;265;265;;;;
;1620126..1621163;;CDS;;254 529;;;;346;
;;;;;;;;;;
;1875693..1876160;;CDS;;129;129;;;156;129
;1876290..1876365;;gcc;;11;;11;;;
;1876377..1876449;;aag;;520;;;;;
comp;1876970..1877974;;CDS;;55 215;;;;335;
;;;;;;;;;;
comp;1933190..1933630;;CDS;;381;;;;147;
;1934012..1934096;;ctg;;91;91;;;;91
comp;1934188..1934718;;CDS;;74 847;;;;177;
;;;;;;;;;;
comp;2009566..2010102;;CDS;;222;222;;;179;
;2010325..2010409;;ctg;;213;213;;;;
;2010623..2011135;;CDS;;432 608;;;;171;
;;;;;;;;;;
;2443744..2448333;;CDS;;540;;;;1530;
;2448874..2450432;;16s;;400;;;;;
;2450833..2453761;;23s;;143;;;;;
;2453905..2454021;;5s;;236;236;;;;236
comp;2454258..2455367;;CDS;;186 804;;;;370;
;;;;;;;;;;
;2642172..2643329;;CDS;;426;;;;386;
;2643756..2645314;;16s;;343;;;;;
;2645658..2648586;;23s;;144;;;;;
;2648731..2648847;;5s;;156;156;;;;156
;2649004..2649228;;CDS;;884 577;;;;75;
;;;;;;;;;;
comp;3533806..3534249;;CDS;;139;139;;;148;139
;3534389..3534460;;gtc;;279;279;;;;
comp;3534740..3535069;;CDS;;103 837;;;;110;
;;;;;;;;;;
;3638907..3639338;;CDS;;728;;;;144;
comp;3640067..3640152;;tta;;249;249;;;;249
;3640402..3640560;;CDS;;28 092;;;;53;
;;;;;;;;;;
;3668653..3669450;;CDS;;247;247;;;266;
comp;3669698..3669766;;atg;;267;267;;;;
comp;3670034..3670234;;CDS;;54 456;;;;67;
;;;;;;;;;;
;3724691..3725086;;CDS;;122;122;;;132;122
comp;3725209..3725282;;atgi;;435;;;;;
comp;3725718..3726359;;CDS;;612 148;;;;214;
;;;;;;;;;;
comp;4338508..4339209;;CDS;;107;107;;;234;107
comp;4339317..4339390;;cca;;7;;;7;;
comp;4339398..4339477;;ttg;;12;;;12;;
comp;4339490..4339566;;cgt;;5;;;5;;
comp;4339572..4339646;;ggc;;35;;;35;;
comp;4339682..4339757;;aaa;;28;;;28;;
comp;4339786..4339862;;gac;;26;;;26;;
comp;4339889..4339965;;atgf;;30;;;30;;
comp;4339996..4340071;;gta;;9;;;9;;
comp;4340081..4340152;;gaa;;17;;;17;;
comp;4340170..4340261;;tcc;;3;;;3;;
comp;4340265..4340340;;aac;;18;;;;;
comp;4340359..4340475;;5s;;76;;;;;
comp;4340552..4343482;;23s;;400;;;;;
comp;4343883..4345441;;16s;;493;;;;;
comp;4345935..4347563;;CDS;;46 596;;;;543;
;;;;;;;;;;
comp;4394160..4395092;;CDS;;238;238;;;311;
;4395331..4395404;;aga;;214;214;;;;
;4395619..4396383;;CDS;;49 894;;;;255;
;;;;;;;;;;
;4446278..4447621;;CDS;;207;207;;;448;
comp;4447829..4447902;;aga;;174;174;;;;
;4448077..4448370;;CDS;;256 556;;;;98;
;;;;;;;;;;
;4704927..4705187;;CDS;;361;;;;87;
comp;4705549..4705627;;ttg;;11;;11;;;
comp;4705639..4705713;;tgc;;11;;11;;;
comp;4705725..4705796;;ggc;;6;;6;;;
comp;4705803..4705877;;caa;;9;;9;;;
comp;4705887..4705959;;cac;;17;;17;;;
comp;4705977..4706050;;tgg;;7;;7;;;
comp;4706058..4706143;;tac;;4;;4;;;
comp;4706148..4706223;;aca;;22;;22;;;
comp;4706246..4706318;;ttc;;35;;35;;;
comp;4706354..4706430;;gac;;15;;15;;;
comp;4706446..4706522;;atgf;;25;;25;;;
comp;4706548..4706623;;gta;;58;;58;;;
comp;4706682..4706753;;gaa;;17;;17;;;
comp;4706771..4706862;;tcc;;3;;3;;;
comp;4706866..4706941;;aac;;326;326;;;;
comp;4707268..4707597;;CDS;;279 544;;;;110;
;;;;;;;;;;
comp;4987142..4989934;;CDS;;726;;;;931;
comp;4990661..4990731;;gga;;9;;;9;;
comp;4990741..4990814;;cca;;22;;;22;;
comp;4990837..4990913;;cgt;;5;;;5;;
comp;4990919..4990993;;ggc;;10;;;10;;
comp;4991004..4991084;;cta;;11;;;11;;
comp;4991096..4991171;;aaa;;4;;;4;;
comp;4991176..4991250;;caa;;55;;;55;;
comp;4991306..4991381;;gta;;11;;;11;;
comp;4991393..4991464;;gaa;;11;;;11;;
comp;4991476..4991548;;acc;;3;;;3;;
comp;4991552..4991627;;aac;;18;;;;;
comp;4991646..4991762;;5s;;76;;;;;
comp;4991839..4994768;;23s;;129;;;;;
comp;4994898..4994973;;gca;;20;;;20;;
comp;4994994..4995070;;atc;;38;;;;;
comp;4995109..4995225;;5s;;93;;;;;
comp;4995319..4996877;;16s;;367;;;;;
comp;4997245..4997475;;CDS;;60 140;;;;77;
;;;;;;;;;;
comp;5057616..5058803;;CDS;;163;163;;;396;163
comp;5058967..5059083;;5s;;76;;;;;
comp;5059160..5062089;;23s;;185;;;;;
comp;5062275..5062350;;gca;;89;;;;;
comp;5062440..5063998;;16s;;380;;;;;
comp;5064379..5066394;;CDS;;647 899;;;;672;
;;;;;;;;;;
;5714294..5714611;;CDS;;206;206;;;106;
comp;5714818..5714908;;tcg;;77;77;;;;77
comp;5714986..5715210;;CDS;;;;;;75;
ppm plasmide[modifier | modifier le wikicode]
  • Plasmide
plasmide;pSC2;37.6%GC;51;;;;;;;
;;;;;;CDS;aa;avec aa;aas;CDS dirigé
;3920..4174;;CDS;;536;536;;;85;
;4711..4803;;agc;+;5;;5;;;
;4809..4883;;tgc;3 aac;63;;63;;;
;4947..5021;;gaa;2 atc;7;;7;;;
;5029..5105;;ctt;2 caa;6;;6;;;
;5112..5186;;cca;2 cca;101;;101;;;
;5288..5361;;tgg;2 cga;4;;4;;;
;5366..5444;;tac;2 gaa;4;;4;;;
;5449..5522;;caa;2 tac;6;;6;;;
;5529..5605;;cac;3 tgg;5;;5;;;
;5611..5686;;gac;;125;;125;;;
;5812..5887;;gga;;10;;10;;;
;5898..5973;;aac;@1;4;;4;;;
;5978..6066;;tac;ctt;9;;9;;;
;6076..6153;;ata;ata;4;;4;;;
;6158..6231;;caa;;4;;4;;;
;6236..6311;;atgi;;5;;5;;;
;6317..6392;;aac;;4;;4;;;
;6397..6470;;tgg;;131;;131;;;
;6602..6678;;gaa;;5;;5;;;
;6684..6757;;ggc;;55;;55;;;
;6813..6885;;ttc;;22;;22;;;
;6908..6983;;cga;;4;;4;;;
;6988..7065;;cca;;5;;5;;;
;7071..7155;;ttg;;5;;5;;;
;7161..7235;;atc;;5;;5;;;
;7241..7317;;atgf;;5;;5;;;
;7323..7398;;gca;;109;;109;;;
;7508..7584;;cga;;3;;3;;;
;7588..7668;;cta;;13;;13;;;
;7682..7758;;atc;;8;;8;;;
;7767..7841;;aac;;4;;4;;;
;7846..7919;;tgg;;33;33;;;;33
;7953..8324;;CDS;@4;-24;-24;;;124;
;8301..8378;;gac;;8;;8;;;
;8387..8473;;tac;;86;;86;;;
;8560..8632;;aaa;;14;;14;;;
;8647..8720;;gga;;4;;4;;;
;8725..8800;;ttc;;7;;7;;;
;8808..8882;;acg;@2;100;100;;;;
comp;8983..9600;;CDS;acg;89;89;;;206;
;9690..9771;;tta;;3;;3;;;
;9775..9849;;aca;;35;35;;;;35
comp;9885..10169;;CDS;;150;;;;95;
;;;;;;;;;;
comp;10320..10622;;CDS;;116;116;;;101;
;10739..10813;;aca;;18;18;;;;18
comp;10832..11146;;CDS;;216;;;;105;
;;;;;;;;;;
comp;11363..11599;;CDS;;94;94;;;79;94
;11694..11768;;aga;;103;103;;;;
;11872..12312;;CDS;;195;;;;147;
;;;;;;;;;;
comp;12508..12756;;CDS;;293;293;;;83;
;13050..13126;;atc;;72;72;;;;72
;13199..14083;;CDS;;226;226;;;295;
;;;;;;;;;;
;14310..14385;;tcg;+;8;;8;;;
;14394..14481;;tcc;2 tcg;7;;7;;;
;14489..14563;;ctt;@3;3;;3;;;
;14567..14654;;tcg;tcg;5;;5;;;
;14660..14751;;tca;ctt;119;119;;;;119
;14871..15080;;CDS;;212044;;;;70;
;;;;;;;;;;
comp;227125..227388;;CDS;;444;444;;;88;
comp;227833..227903;;gga;;248;248;;;;248
comp;228152..228391;;CDS;;1401;;;;80;
;;;;;;;;;;
comp;229793..229999;;CDS;;24;24;;;69;24
comp;230024..230108;;tca;;289;289;;;;
comp;230398..230640;;CDS;;231;;;;81;
;;;;;;;;;;
comp;230872..231393;;CDS;;161;161;;;174;161
comp;231555..231640;;tta;;977;977;;;;
;232618..233067;;CDS;;277050;;;;150;
;510118..1;;;;;;;;;
ppm plasmide MAJ[modifier | modifier le wikicode]
plasmide;;Paenibacillus polymyxa SC2 MAJ;;;plasmide;;Paenibacillus polymyxa SC2;;;
23.10.19 Tanger;;;;;;26.7.19 Paris;;;;
;;49 aas;doubles;intercalaires;;;;51 aas;doubles;intercalaires
3920..4174;;cds hp;;;;3920..4174;;CDS;;536
4711..4803;;agc;+;;;4711..4803;;agc;+;5
4809..4883;;tgc;3 aac;;;4809..4883;;tgc;3 aac;63
4947..5021;;gaa;2 atc;;;4947..5021;;gaa;2 atc;7
5029..5105;;ctt;2 cca;;;5029..5105;;ctt;2 caa;6
5112..5186;;cca;2 cga;;;5112..5186;;cca;2 cca;101
5288..5361;;tgg;2 gaa;;;5288..5361;;tgg;2 cga;4
5366..5441;;tat;3 tgg;7;;5366..5444;;tac;2 gaa;4
5449..5522;;caa;;;;5449..5522;;caa;2 tac;6
5529..5605;;cac;;;;5529..5605;;cac;3 tgg;5
5611..5686;;gac;;;;5611..5686;;gac;;125
5812..5887;;gga;;;;5812..5887;;gga;;10
5898..5973;;aac;@1;;;5898..5973;;aac;@1;4
5978..6066;;tac;ctt;;;5978..6066;;tac;ctt;9
6076..6153;;ata;ata;82;;6076..6153;;ata;ata;4
;;****;tat;;;6158..6231;;caa;;4
6236..6311;;atgi;;;;6236..6311;;atgi;;5
6317..6392;;aac;;;;6317..6392;;aac;;4
6397..6470;;tgg;;;;6397..6470;;tgg;;131
6602..6678;;gaa;;;;6602..6678;;gaa;;5
6684..6757;;ggc;;;;6684..6757;;ggc;;55
6813..6885;;ttc;;;;6813..6885;;ttc;;22
6908..6980;;cga;;7;;6908..6983;;cga;;4
6988..7065;;cca;;;;6988..7065;;cca;;5
7071..7155;;ttg;;;;7071..7155;;ttg;;5
7161..7235;;atc;;4;;7161..7235;;atc;;5
7240..7317;;atgf;;;;7241..7317;;atgf;;5
7323..7398;;gca;;;;7323..7398;;gca;;109
7508..7584;;cga;;;;7508..7584;;cga;;3
7588..7668;;cta;;;;7588..7668;;cta;;13
7682..7758;;atc;;;;7682..7758;;atc;;8
7767..7841;;aac;;;;7767..7841;;aac;;4
7846..7919;;tgg;;;;7846..7919;;tgg;;33
7953..8324;;cds hp;;;;7953..8324;;CDS;@4;-24
8301..8378;;gac;;;;8301..8378;;gac;;8
8387..8473;;tac;;;;8387..8473;;tac;;86
8560..8632;;aaa;;;;8560..8632;;aaa;;14
8647..8720;;gga;;;;8647..8720;;gga;;4
8725..8800;;ttc;;;;8725..8800;;ttc;;7
8808..8882;;acg;@2;;;8808..8882;;acg;@2;100
8983..9600;;cds hp;acg;;comp;8983..9600;;CDS;acg;89
9690..9771;;tta;;;;9690..9771;;tta;;3
9775..9849;;aca;;;;9775..9849;;aca;;35
9885..10169;;cds hp;;;comp;9885..10169;;CDS;;150
;;;;;;;;;;
10320..10622;;cds hp;;;comp;10320..10622;;CDS;;116
10739..10813;;aca;;;;10739..10813;;aca;;18
10832..11146;;cds hp;;;comp;10832..11146;;CDS;;216
;;;;;;;;;;
11363..11599;;cds hp;;;comp;11363..11599;;CDS;;94
11694..11765;;aga;;85;;11694..11768;;aga;;103
11851..12312;;cds rev-trans;;;;11872..12312;;CDS;;195
;;;;;;;;;;
12508..12756;;cds trans-rg;;442;comp;12508..12756;;CDS;;293
****;;****;;;;13050..13126;;atc;;72
13199..14083;;cds hp;;;;13199..14083;;CDS;;226
;;;;;;;;;;
14310..14385;;tcg;+;;;14310..14385;;tcg;+;8
14394..14481;;tcc;2 tcg;;;14394..14481;;tcc;2 tcg;7
14489..14560;;ctt;@3;6;;14489..14563;;ctt;@3;3
14567..14654;;tcg;tcg;;;14567..14654;;tcg;tcg;5
14660..14751;;tca;ctt;;;14660..14751;;tca;ctt;119
14871..15080;;cds hp;;;;14871..15080;;CDS;;212044
;;;;;;;;;;
227125..227388;;cds hp;;;comp;227125..227388;;CDS;;444
227833..227903;;gga;;;comp;227833..227903;;gga;;248
228152..228391;;cds hp;;;comp;228152..228391;;CDS;;1401
;;;;;;;;;;
229793..229999;;cds hp;;;comp;229793..229999;;CDS;;24
230024..230108;;tca;;783;comp;230024..230108;;tca;;289
****;;****;;;comp;230398..230640;;CDS;;231
;;;;;;;;;;
230872..231393;;;cds hp;;comp;230872..231393;;CDS;;161
231558..231640;;tta;;;comp;231555..231640;;tta;;977
232618..233067;;cds hp;;;;232618..233067;;CDS;;277050
510118..1;;;;;;510118..1;;;;

ppm cumuls[modifier | modifier le wikicode]

Paenibacillus polymyxa SC2;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;13;1;1;0;1;0;100;8;5;40;0
;16 23 5s 0;7;20;12;46;50;1;200;20;17;60;1
;16 5 atc gca;2;40;3;15;100;4;300;10;6;80;2
;16 23 5s a;3;60;1;2;150;8;400;13;9;100;2
;max a;21;80;0;1;200;6;500;7;4;120;2
;a doubles;0;100;1;0;250;15;600;2;0;140;3
;16 gca 23 5s ;1;120;0;1;300;5;700;1;0;160;3
;total aas;73;140;0;0;350;3;800;1;1;180;2
sans ;opérons;19;160;0;0;400;5;900;0;0;200;1
;1 aa;15;180;0;0;450;4;1000;1;0;220;3
;max a;15;200;0;0;500;2;1100;0;0;240;2
;a doubles;0;;0;0;;11;;1;0;;1
;total aas;37;;18;65;;64;;64;42;;22
total aas;;110;moyenne;20;17;;193;;292;229;;150
remarques;;1;variance;21;17;;73;;234;123;;58
jaune;;;;;;;sans;;;sans;;
  • Plasmide
Paenibacillus polymyxa SC2;;;;;;;;;;;;
plasmide;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;0;1;0;;1;1;60;0;;40;4
;16 23 5s 0;;20;33;;50;4;80;4;;60;0
;16 5 atc gca;;40;1;;100;4;100;5;;80;1
;16 23 5s a;;60;1;;150;3;120;2;;100;1
;max a;;80;1;;200;1;140;1;;120;1
;a doubles;;100;1;;250;2;160;2;;140;0
;16 gca 23 5s ;;120;2;;300;2;180;1;;160;0
;total aas;;140;2;;350;0;200;0;;180;1
sans ;opérons;10;160;0;;400;0;220;1;;200;0
;1 aa;6;180;0;;450;1;240;0;;220;0
;max a;32;200;0;;500;0;260;0;;240;0
;a doubles;2;;0;;;2;;1;;;1
;total aas;51;;41;;;20;;17;;;9
total aas;;51;moyenne;6;;;126;;102;;;89
remarques;;3;variance;3;;;92;;32;;;77
;jaune;;;sans;;;sans;;sans;;;

ppm blocs[modifier | modifier le wikicode]

ppm blocs;;;;;;;
tRNAs;21;17;11;;;;
16s;207;207;400;;;;
23s;76;76;76;;;;
5s;34;82;18;;;;
;;;;;;;
tRNAs;13;_;_;10;;;
16s;93;_;16s;108;;16s;89
5s;38;;5s;39;;gca;185
atc;20;;atc;20;;23s;76
gca;129;;gca;128;;5s;
23s;76;;23s;130;;;
5s;18;;;;;;
;;;;;;;
16s;280;207;207;208;221;400;343
23s;143;76;76;75;76;143;144
5s;;;;;;;
;;;;;;;
5s;constant;39 aas;117 pbs;;;;

ppm distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1;;;;;;;;;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;;tac;;tgc;;;ttc;1;tcc;1;tac;1;tgc;1;;;;;;;;;;;ttc;2;tcc;2;tac;3;tgc;1
atc;;acc;;aac;;agc;;;atc;;acc;;aac;2;agc;1;;;;;;;;;;;atc;1;acc;1;aac;4;agc;2
ctc;1;ccc;1;cac;;cgt;;;ctc;1;ccc;;cac;1;cgt;;;;;;;;;;;;ctc;;ccc;;cac;1;cgt;4
gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;1;gac;1;ggc;1;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;4
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;2;;ata;;aca;1;aaa;1;aga;;;;;;;;;;;;ata;;aca;3;aaa;5;aga;
cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;;;;;;;;;;cta;2;cca;4;caa;3;cga;
gta;;gca;;gaa;;gga;1;;gta;1;gca;;gaa;2;gga;;;;;;;;;;;;gta;5;gca;2;gaa;4;gga;3
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;;;;;;;;;;ttg;2;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;;;atgj;;acg;;aag;1;agg;;;;;;;;;;;;atgj;2;acg;;aag;;agg;
ctg;2;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;1;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ppm;;15;;;;;15;;ppm;22;;;;;;22;;;;;;;;;;;ppm;;;;68;;;68
  • Plasmide
atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;2;tcc;1;tac;3;tgc;1
atc;1;acc;;aac;;agc;;;atc;2;acc;;aac;3;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;1;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;;aga;1;;ata;1;aca;1;aaa;1;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;2;caa;2;cga;2
gta;;gca;;gaa;;gga;1;;gta;;gca;1;gaa;2;gga;2
ttg;;tcg;;tag;;tgg;;;ttg;1;tcg;2;tag;;tgg;3
atgj;;acg;;aag;;agg;;;atgj;;acg;1;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ppm;;6;;;;;6;;ppm;45;;;;;;45

pmq[modifier | modifier le wikicode]

pmq opérons[modifier | modifier le wikicode]

58.3%GC;24.7.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paenibacillus mucilaginosus 3016;;;;;;;;;
;9206..10276;CDS;;322;322;;;357;
;10599..12139;16s;;269;;;;;
;12409..15343;23s;;95;;;;;
;15439..15555;5s;;178;178;;;;178
;15734..17190;CDS;;3061;;;;486;
;;;;;;;;;
;20252..21532;CDS;;47;47;;;427;47
;21580..21666;tca;;140;140;;;;
;21807..22157;CDS hp;@1;17;;;;117;
;22175..22357;CDS hp;;23;;;;*61;
;22381..22524;CDS hp;;86;;;;*48;
comp;22611..22796;CDS hp;;138;;;;*62;
comp;22935..25265;CDS replicase;;156;;;;*777;
;;;;;;;;;
;25422..26165;CDS;;220;220;;;248;
comp;26386..26460;cgg;;183;183;;;;183
;26644..27168;CDS;;151287;;;;175;
;;;;;;;;;
;178456..179454;CDS;;298;298;;;333;
;179753..181299;16s;;254;;;;;
;181554..184488;23s;;168;;;;;
;184657..184773;5s;;15;;;;;
;184789..184876;agc;;29;;;29;;
;184906..184982;atgj;;39;;;39;;
;185022..185097;gta;;15;;;15;;
;185113..185189;atgf;;14;;;14;;
;185204..185280;gac;;48;;;48;;
;185329..185404;ttc;;5;;;5;;
;185410..185485;aca;;9;;;9;;
;185495..185579;tac;;15;;;15;;
;185595..185670;aaa;;183;183;;;;183
comp;185854..187104;CDS;;30460;;;;417;
;;;;;;;;;
comp;217565..218146;CDS;;129;129;;;194;129
comp;218276..218350;cgg;;261;261;;;;
;218612..219643;CDS;;34238;;;;344;
;;;;;;;;;
;253882..254526;CDS;;677;*677;;;215;
;255204..256745;16s;;268;;;;;
;257014..259948;23s;;95;;;;;
;260044..260160;5s;;55;;;;;
;260216..260292;atc;;19;;;19;;
;260312..260387;gca;+;16;;;16;;
;260404..260475;gaa;2 gca;9;;;9;;
;260485..260569;tac;;20;;;20;;
;260590..260665;aac;;3;;;3;;
;260669..260744;gta;;19;;;19;;
;260764..260840;gac;;20;;;20;;
;260861..260933;ttc;;15;;;15;;
;260949..261021;aaa;;10;;;10;;
;261032..261118;ctg;;3;;;3;;
;261122..261196;ggc;;12;;;12;;
;261209..261280;tgc;;15;;;15;;
;261296..261369;cgt;;5;;;5;;
;261375..261448;cca;;158;;;*158;;
;261607..261682;gca;;4;;;4;;
;261687..261759;acc;;5;;;5;;
;261765..261854;tcg;;19;;;19;;
;261874..261961;agc;;17;;;17;;
;261979..262054;gtc;;5;;;5;;
;262060..262134;acg;;39;;;39;;
;262174..262262;tcc;;41;;;41;;
;262304..262386;ctc;;283;283;;;;*283
;262670..263515;CDS;;314679;;;;282;
;;;;;;;;;
;578195..579055;CDS;;324;324;;;287;
;579380..580921;16s;;258;;;;;
;581180..584114;23s;;166;;;;;
;584281..584397;5s;;31;;;;;
;584429..584505;aac;;6;;;6;;
;584512..584600;tcc;;38;;;38;;
;584639..584710;gaa;;11;;;11;;
;584722..584797;gta;;17;;;17;;
;584815..584891;atgf;;15;;;15;;
;584907..584983;gac;;67;;;67;;
;585051..585125;acg;;11;;;11;;
;585137..585212;cac;;10;;;10;;
;585223..585297;caa;;5;;;5;;
;585303..585378;aaa;;17;;;17;;
;585396..585470;ggc;+;40;;;40;;
;585511..585585;ggc;2 ggc;24;;;24;;
;585610..585692;ttg;;5;;;5;;
;585698..585774;cca;;19;;;19;;
;585794..585867;gga;;1;;;1;;
;585869..585942;aga;;187;187;;;;187
;586130..586885;CDS;;85587;;;;252;
;;;;;;;;;
;672473..672949;CDS;;18;18;;;159;18
;672968..673043;aac;;7;;7;;;
;673051..673138;agc;@2;297;;297;;;
;673436..673507;gaa;;9;;9;;;
;673517..673599;ctc;;180;180;;;;
;673780..674199;CDS;;182;;;;140;
;;;;;;;;;
;674382..675278;CDS;;159;159;;;299;
;675438..675520;ctc;;64;64;;;;64
;675585..675833;CDS;;18450;;;;83;
;;;;;;;;;
;694284..695636;CDS;;797;*797;;;451;
;696434..697974;16s;;261;;;;;
;698236..701170;23s;;94;;;;;
;701265..701381;5s;;43;;;;;
;701425..701498;atc;;11;;;11;;
;701510..701584;gaa;;5;;;5;;
;701590..701665;gtc;;5;;;5;;
;701671..701747;atgf;;4;;;4;;
;701752..701825;tgg;;9;;;9;;
;701835..701909;caa;;8;;;8;;
;701918..701990;aaa;;18;;;18;;
;702009..702095;ctg;;4;;;4;;
;702100..702174;ggc;;11;;;11;;
;702186..702259;cgt;;12;;;12;;
;702272..702348;cca;;577;*577;;;;*577
;702926..703120;CDS;;370320;;;;65;
;;;;;;;;;
;1073441..1074214;CDS;;373;373;;;258;
;1074588..1076136;16s;;260;;;;;
;1076397..1079331;23s;;168;;;;;
;1079500..1079616;5s;;9;;;;;
;1079626..1079701;aac;;6;;;6;;
;1079708..1079796;tcc;;38;;;38;;
;1079835..1079906;gaa;;11;;;11;;
;1079918..1079993;gta;;17;;;17;;
;1080011..1080087;atgf;;13;;;13;;
;1080101..1080177;gac;;49;;;49;;
;1080227..1080302;ttc;;4;;;4;;
;1080307..1080382;aca;;13;;;13;;
;1080396..1080481;tac;;8;;;8;;
;1080490..1080560;tgg;;13;;;13;;
;1080574..1080649;cac;;26;;;26;;
;1080676..1080747;caa;;9;;;9;;
;1080757..1080831;ggc;;12;;;12;;
;1080844..1080917;tgc;;10;;;10;;
;1080928..1081016;tta;;20;;;20;;
;1081037..1081113;cgt;;3;;;3;;
;1081117..1081199;ttg;;147;147;;;;147
;1081347..1081973;CDS;;128630;;;;209;
;;;;;;;;;
;1210604..1213519;CDS;;354;354;;;972;
;1213874..1213949;gca;;16;;16;;;
;1213966..1214037;gaa;;12;;12;;;
;1214050..1214125;gta;;16;;16;;;
;1214142..1214218;gac;;17;;17;;;
;1214236..1214311;cac;;9;;9;;;
;1214321..1214395;caa;;9;;9;;;
;1214405..1214477;aaa;;8;;8;;;
;1214486..1214572;ctg;;3;;3;;;
;1214576..1214647;ggc;;169;169;;;;169
comp;1214817..1215602;CDS;;378784;;;;262;
;;;;;;;;;
;1594387..1594665;CDS;;537;*537;;;93;
;1595203..1596743;16s;;252;;;;;
;1596996..1599930;23s;;94;;;;;
;1600025..1600141;5s;;43;;;;;
;1600185..1600261;atc;;19;;;19;;
;1600281..1600356;gca;;17;;;17;;
;1600374..1600445;gaa;;8;;;8;;
;1600454..1600529;gta;+;5;;;5;;
;1600535..1600610;aca;2 gta;10;;;10;;
;1600621..1600705;tac;;18;;;18;;
;1600724..1600799;aac;;4;;;4;;
;1600804..1600879;gta;;21;;;21;;
;1600901..1600977;atgf;;12;;;12;;
;1600990..1601066;gac;;34;;;34;;
;1601101..1601176;cac;;13;;;13;;
;1601190..1601264;caa;;8;;;8;;
;1601273..1601345;aaa;;17;;;17;;
;1601363..1601448;ctc;;13;;;13;;
;1601462..1601548;ctg;;5;;;5;;
;1601554..1601628;ggc;;14;;;14;;
;1601643..1601713;tgc;;10;;;10;;
;1601724..1601797;cgt;;5;;;5;;
;1601803..1601876;cca;;105;105;;;;105
;1601982..1602245;CDS;;232535;;;;88;
;;;;;;;;;
;1834781..1835260;CDS;;106;106;;;160;106
;1835367..1835439;gcc;;137;137;;;;
comp;1835577..1835978;CDS;;371114;;;;134;
;;;;;;;;;
comp;2207093..2208091;CDS;;192;192;;;333;192
;2208284..2208367;ctg;+;49;;49;;;
;2208417..2208500;ctg;2 ctg;315;315;;;;
;2208816..2209952;CDS;;1246561;;;;379;
;;;;;;;;;
;3456514..3456786;CDS;;256;256;;;91;
;3457043..3457119;ccc;;142;142;;;;142
;3457262..3457483;CDS;;1547757;;;;74;
;;;;;;;;;
comp;5005241..5005426;CDS;;127;127;;;62;127
comp;5005554..5005636;ctc;;40;;40;;;
comp;5005677..5005765;tcc;;13;;13;;;
comp;5005779..5005852;atg;;19;;19;;;
comp;5005872..5005958;tcg;;167;167;;;;
;5006126..5006220;ncRNA;;1377035;;;;32;
;;;;;;;;;
comp;6383256..6384173;CDS;;228;228;;;306;
;6384402..6384477;gtc;;69;69;;;;69
comp;6384547..6385458;CDS;;5453;;;;304;
;;;;;;;;;
comp;6390912..6391130;CDS;;142;142;;;73;142
comp;6391273..6391358;tta;;7;;7;;;
comp;6391366..6391442;atgi;;19;;19;;;
comp;6391462..6391538;atgf;;370;370;;;;
comp;6391909..6392460;CDS;;962046;;;;184;
;;;;;;;;;
;7354507..7354737;CDS;;342;342;;;77;*342
comp;7355080..7355162;ctc;;28;;;28;;
comp;7355191..7355279;tcc;;12;;;12;;
comp;7355292..7355368;atgf;;14;;;14;;
comp;7355383..7355459;atgj;;14;;;14;;
comp;7355474..7355561;agc;;8;;;8;;
comp;7355570..7355659;tcg;;4;;;4;;
comp;7355664..7355736;acc;;4;;;4;;
comp;7355741..7355816;gca;;119;;;;;
;7355936..7356030;ncRNA;@3;36;;;;;
comp;7356067..7356140;cca;;6;;;6;;
comp;7356147..7356220;cgt;;104;;;*104;;
comp;7356325..7356396;ggc;;7;;;7;;
comp;7356404..7356490;ctg;;9;;;9;;
comp;7356500..7356572;aaa;;9;;;9;;
comp;7356582..7356656;caa;;9;;;9;;
comp;7356666..7356741;cac;;17;;;17;;
comp;7356759..7356835;gac;;12;;;12;;
comp;7356848..7356923;gta;;4;;;4;;
comp;7356928..7357003;aac;;15;;;15;;
comp;7357019..7357103;tac;;8;;;8;;
comp;7357112..7357187;aca;;5;;;5;;
comp;7357193..7357264;gaa;;15;;;15;;
comp;7357280..7357355;gcc;;9;;;9;;
comp;7357365..7357438;atc;;54;;;;;
comp;7357493..7357609;5s;;112;;;;;
comp;7357722..7360655;23s;;258;;;;;
comp;7360914..7362454;16s;;403;*403;;;;
;7362858..7363397;CDS;;254752;;;;180;
;;;;;;;;;
;7618150..7618842;CDS;;280;280;;;231;*280
comp;7619123..7619193;ggg;;335;335;;;;
;7619529..7620461;CDS;;46171;;;;311;
;;;;;;;;;
comp;7666633..7668069;CDS;;104;104;;;479;104
comp;7668174..7668244;ggg;;5;;;5;;
comp;7668250..7668326;cca;;106;;;*106;;
comp;7668433..7668506;cgt;;11;;;11;;
comp;7668518..7668592;ggc;;5;;;5;;
comp;7668598..7668684;ctg;;13;;;13;;
comp;7668698..7668783;ctc;;16;;;16;;
comp;7668800..7668872;aaa;;10;;;10;;
comp;7668883..7668967;tac;;28;;;28;;
comp;7668996..7669071;ttc;;12;;;;;
comp;7669084..7669200;5s;;159;;;;;
comp;7669360..7672297;23s;;256;;;;;
comp;7672554..7674095;16s;;537;*537;;;;
;7674633..7675382;CDS;;177794;;;;250;
;;;;;;;;;
comp;7853177..7853761;CDS;;57;57;;;195;57
comp;7853819..7853892;cac;;230;;230;;;
comp;7854123..7854196;cac;;404;*404;;;;
comp;7854601..7854801;CDS;;245639;;;;67;
;;;;;;;;;
comp;8100441..8100854;CDS;;123;123;;;138;123
comp;8100978..8101094;5s;;167;;;;;
comp;8101262..8104180;23s;;248;;;;;
comp;8104429..8105969;16s;;325;325;;;;
comp;8106295..8106636;CDS;;45281;;;;114;
;;;;;;;;;
comp;8151918..8152448;CDS;;460;*460;;;177;*460
comp;8152909..8153031;5s;;94;;;;;
comp;8153126..8156060;23s;;258;;;;;
comp;8156319..8157859;16s;;456;*456;;;;
;8158316..8158642;CDS;;98285;;;;109;
;;;;;;;;;
;8256928..8257746;CDS;;83;83;;;273;83
comp;8257830..8257903;gga;;5;;;5;;
comp;8257909..8257985;cca;;16;;;16;;
comp;8258002..8258078;cgt;;4;;;4;;
comp;8258083..8258157;ggc;;8;;;8;;
comp;8258166..8258248;cta;;42;;;42;;
comp;8258291..8258366;aaa;;8;;;8;;
comp;8258375..8258449;caa;;9;;;9;;
comp;8258459..8258532;tgg;;4;;;4;;
comp;8258537..8258613;atgf;;5;;;5;;
comp;8258619..8258694;gtc;;5;;;5;;
comp;8258700..8258774;gaa;;11;;;11;;
comp;8258786..8258859;atc;;43;;;;;
comp;8258903..8259019;5s;;94;;;;;
comp;8259114..8262048;23s;;255;;;;;
comp;8262304..8263845;16s;;306;306;;;;
comp;8264152..8264370;CDS;;58373;;;;73;
;;;;;;;;;
comp;8322744..8323205;CDS;;393;393;;;154;*393
comp;8323599..8323715;5s;;94;;;;;
comp;8323810..8326748;23s;;258;;;;;
comp;8327007..8328547;16s;;369;369;;;;
comp;8328917..8330413;CDS;;21505;;;;499;
;;;;;;;;;
comp;8351919..8354414;CDS;;396;396;;;832;
comp;8354811..8354884;atg;;149;149;;;;149
comp;8355034..8355537;CDS;;34450;;;;168;
;;;;;;;;;
;8389988..8390512;CDS;;296;296;;;175;*296
comp;8390809..8390925;5s;;94;;;;;
comp;8391020..8393954;23s;;259;;;;;
comp;8394214..8395754;16s;;234;234;;;;
comp;8395989..8396255;CDS;;220222;;;;89;
;;;;;;;;;
comp;8616478..8616924;CDS;;417;*417;;;149;
;8617342..8617418;gac;;157;157;;;;157
;8617576..8618541;CDS;;105821;;;;322;
;;;;;;;;;
;8724363..8724614;CDS;;455;*455;;;84;
comp;8725070..8725160;tcg;;165;165;;;;165
comp;8725326..8725559;CDS;;9205;;;;78;
;;opéron;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd

pmq cumuls[modifier | modifier le wikicode]

pmq;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cds dirigé;gammes;cdsa;cdsd
avec rRNA;opérons;14;1;0;1;1;0;1;0;100;15;8
;16 23 5s 0;5;20;14;107;50;3;20;1;200;18;10
;16 atc gca;0;40;1;12;100;4;40;0;300;12;6
;16 23 5s a;9;60;1;4;150;11;60;2;400;9;3
;max a;23;80;0;1;200;11;80;2;500;6;4
;a doubles;3;100;0;0;250;3;100;1;600;0;0
;spéciaux;0;120;0;2;300;6;120;3;700;0;0
;total aas;138;140;0;0;350;7;140;3;800;0;0
sans ;opérons;17;160;0;1;400;6;160;5;900;1;0
;1 aa;11;180;0;0;450;3;180;3;1000;1;0
;max a;9;200;0;0;500;3;200;4;1100;0;0
;a doubles;1;;2;0;;5;;7;;0;0
;total aas;35;;18;128;;62;;31;;62;31
total aas;;173;;;;;;;;;;
remarques;;3;;;;;;;;;;
avec jaune;;;moyenne;;16;;;;;;235;213
;;;variance;;20;;;;;;184;122
sans jaune;;;moyenne;16;14;;207;;126;;;
;;;variance;12;11;;106;;49;;;

pmq blocs[modifier | modifier le wikicode]

Les blocs à rRNAs pmq;;;;;
CDS;298;324;373;12;
16s;254;258;260;159;
23s;168;166;168;256;
5s;15;31;9;537;
1er aa;agc;aac;aac;ttc;
aas;9;16;17;9;
CDS;183;187;147;104;
;;;;;
CDS;677;797;537;54;43
16s;268;261;252;112;94
23s;95;94;94;258;255
5s;55;43;43;403;306
atc / aas;22;11;19;23;12
CDS;283;577;105;342;83
;;;;;
CDS;322;123;460;393;296
16s;269;167;94;94;94
23s;95;248;258;258;259
5s;178;325;456;369;234

pmq distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;7
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;ctg2;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;ggc2  5s;ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;4;tcc;4;tac;6;tgc;3
atc;;acc;;aac;;agc;;;atc;;acc;;aac;1;agc;1;;atc;;acc;;aac;;agc;;;atc;5;acc;2;aac;5;agc;3
ctc;1;ccc;1;cac;;cgt;;;ctc;2;ccc;;cac;3;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;4;ccc;;cac;4;cgt;7
gtc;1;gcc;1;gac;1;ggc;;;gtc;;gcc;;gac;1;ggc;1;;gtc;;gcc;;gac;;ggc;;;gtc;3;gcc;1;gac;6;ggc;9
tta;;tca;1;taa;;tga;;;tta;1;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;1;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;4;aaa;8;aga;1
cta;;cca;;caa;;cga;;;cta;;cca;;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;7;caa;6;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;1;gaa;2;gga;;;gta;;gca;;gaa;;gga;;;gta;7;gca;4;gaa;7;gga;2
ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;2;tcg;2;tag;;tgg;3
atgj;1;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;2;acg;2;aag;;agg;
ctg;;ccg;;cag;;cgg;2;;ctg;1;ccg;;cag;;cgg;;;ctg;2;ccg;;cag;;cgg;;;ctg;5;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;1
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
pmq;;11;;;;;11;;pmq;22;;;;;;22;;pmq;2;;;;;;2;;pmq;;;;138;;;138

pmq intercalaires entre cds[modifier | modifier le wikicode]

;;;pmq 9.11.20;;;;;;;;;
pmq;8.2.21 Paris;;pmq 7.2.21;;;;;;;;;
pmq;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>fréquence5;intercal;<u>fréquencez
;'''négatif;795;11.0;'''négatif ;-11;16;-1 à -119;'''8 739 048;-1;795;610;15
;'''zéro;31;0.4;;;;;'''intercals;0;31;620;10
;'''1 à 200;4139;57.3;'''0 à 200;88;60;;'''1 202 544;5;200;630;6
;'''201 à 370;1520;21.0;'''201 à 370;266;46;;'''13.8%;10;113;640;6
;'''371 à 600;506;7.0;'''371 à 600;460;65;;;15;194;650;10
;'''601 à max;232;3.2;'''601 à 1028;861;248;;;20;157;660;8
;'''total 7223;<201;68.7;'''total 7223;165;188;-119 à 1742;;25;177;670;5
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;118;680;5
6589209;1742;-1;795;-70;13;;0;31;35;130;690;6
6004770;1651;0;31;-60;3;;-1;°80;40;135;700;4
4375163;1613;1;°53;-50;6;;-2;3;45;110;710;5
3234976;1576;2;°47;-40;14;;-3;1;50;106;720;5
1433663;1551;3;36;-30;27;'''min à -1;-4;°395;55;93;730;5
1961332;1546;4;35;-20;62;795;-5;1;60;87;740;5
1948392;1534;5;29;-10;104;11.0%;-6;4;65;99;750;4
8025788;1532;6;°33;0;597;;-7;5;70;75;760;6
6672573;1521;7;°30;10;313;;-8;°76;75;106;770;5
4064508;1497;8;14;20;351;;-9;1;80;109;780;4
1735863;1428;9;14;30;295;;-10;9;85;99;790;3
4067449;1378;10;22;40;265;'''1 à 100;-11;°34;90;108;800;5
2875626;1352;11;24;50;216;2448;-12;0;95;98;810;3
896926;1351;12;°38;60;180;33.9%;-13;7;100;103;820;5
6351796;1318;13;°44;70;174;;-14;°29;105;92;830;6
2069562;1279;14;°46;80;215;;-15;0;110;84;840;1
1529184;1277;15;°42;90;207;;-16;5;115;93;850;1
1897252;1277;16;36;100;201;;-17;°19;120;85;860;7
2910237;1276;17;26;110;176;;-18;0;125;100;870;2
3749065;1276;18;°39;120;178;;-19;1;130;97;880;2
4906359;1270;19;32;130;197;;-20;°15;135;72;890;3
1921516;1263;20;24;140;155;;-21;0;140;83;900;3
880003;1252;21;°43;150;183;;-22;6;145;89;910;3
5858747;1240;22;33;160;154;;-23;°13;150;94;920;2
5950046;1211;23;26;170;169;'''1 à 200;-24;0;155;77;930;4
8085655;1206;24;°47;180;177;4139;-25;4;160;77;940;5
7588882;1203;25;28;190;174;57.3%;-26;°16;165;84;950;2
7315024;1200;26;20;200;159;;-27;0;170;85;960;2
5662979;1189;27;°26;210;151;;-28;0;175;91;970;2
8557915;1186;28;16;220;144;;-29;°8;180;86;980;0
359256;1184;29;25;230;131;;-30;0;185;87;990;2
7839445;1169;30;°31;240;141;;-31;2;190;87;1000;2
1773925;1157;31;26;250;121;'''0 à 200;-32;°9;195;80;1010;2
3687367;1141;32;22;260;107;4170;;774;200;79;1020;1
1886363;1109;33;°27;270;103;;reste;52;205;81;1030;2
7335994;1095;34;23;280;94;;total;826;210;70;1040;2
5259590;1088;35;°32;290;74;;;;215;82;1050;2
3089348;1087;36;24;300;58;;;;220;62;1060;4
3287601;1084;37;27;310;80;;'''intercal;'''<u>fréquence5;225;65;1070;0
933373;1077;38;25;320;60;;600;6991;230;66;1080;1
8231158;1055;39;°29;330;69;;650;47;235;68;1090;3
1233491;1054;40;°30;340;48;'''201 à 370;700;28;240;73;1100;1
1379835;1052;reste;5173;350;58;1520;750;24;245;59;1110;1
1438197;1052;total;7223;360;41;21.0%;800;23;250;62;1120;0
2970387;1045;;;370;40;;850;16;255;55;1130;0
5913926;1042;;;380;44;;900;17;260;52;1140;0
7192953;1040;;;390;39;;950;16;265;51;1150;1
247705;1038;;;400;36;;1000;8;270;52;1160;1
1687282;1027;;;410;29;;1050;9;275;42;1170;1
7301491;1024;;;420;25;;1100;9;280;52;1180;0
2362680;1013;;;430;35;;1150;2;285;35;1190;3
;;;;440;31;;1200;6;290;39;1200;1
;;;;450;19;;1250;4;295;29;;205
'''adresse;'''intercaln;'''décalage;'''long;460;25;;1300;8;300;29;reste;27
4544722;-119;shift 2;16105;470;17;;1350;1;305;45;total;232
5318942;-119;shift 3;18655;480;21;;1400;3;310;35;;
1976860;-116;shift 4;1615;490;20;;1450;1;315;33;;
5337597;-115;shift 5;1973;500;26;;1500;1;320;27;;
3673911;-113;shift 6;419;510;13;;1550;4;325;30;;
5433750;-101;shift 7;5002;520;14;;1600;2;330;39;;
7350606;-101;shift 8;832;530;14;;1650;1;335;28;;
2131496;-95;shift 9;1189;540;19;'''371 à 600;;230;340;20;;
4669248;-95;;;550;20;506;;;345;34;;
2553569;-89;;;560;12;7.0%;;;350;24;;
2198194;-75;;;570;15;;;;355;28;;
1029214;-74;;;580;9;'''601 à max;;;360;13;;
7372543;-73;;;590;11;232;;;365;21;;
1297148;-65;;;600;12;3.2%;;;370;19;;
3921139;-65;;;reste;232;;reste;2;reste;738;;
6624824;-65;;;total;7223;;total;7223;total;7223;;

pmq autres intercalaires[modifier | modifier le wikicode]

pmq;autres intercalaires;;adresses1;;;pmq;autres intercalaires;;adresses2;;;pmq;autres intercalaires;;adresses3;;;pmq;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;9206;318;;;deb;°CDS;672473;18;;;deb;°CDS;1834781;106;;;deb;°CDS;7666633;104;comp
;$rRNA;10595;280;;;;&tRNA;672968;7;;;;&tRNA;1835367;137;;;;&tRNA;7668174;5;comp
;$rRNA;12412;97;;;;&tRNA;673051;297;;;fin;°CDS;1835577;;comp;;;&tRNA;7668250;106;comp
;$rRNA;15439;178;;;;&tRNA;673436;9;;;deb;°CDS;2147627;89;;;;&tRNA;7668433;11;comp
fin;°CDS;15734;;;;;&tRNA;673517;180;;;;ncRNA;2148556;114;;;;&tRNA;7668518;5;comp
deb;°CDS;20252;47;;;fin;°CDS;673780;;;;fin;°CDS;2148850;;;;;&tRNA;7668598;13;comp
;&tRNA;21580;137;;;deb;°CDS;674382;159;;;deb;°CDS;2207093;192;comp;;;&tRNA;7668698;16;comp
fin;°CDS;21807;;;;;&tRNA;675438;64;;;;&tRNA;2208284;49;;;;&tRNA;7668800;10;comp
deb;°CDS;25422;222;;;fin;°CDS;675585;;;;;&tRNA;2208417;315;;;;&tRNA;7668883;28;comp
;&tRNA;26388;183;comp;;deb;°CDS;694284;793;;;fin;°CDS;2208816;;;;;&tRNA;7668996;12;comp
fin;°CDS;26644;;;;;$rRNA;696430;272;;;deb;°CDS;3456514;256;;;;$rRNA;7669084;161;comp
deb;°CDS;178456;299;;;;$rRNA;698239;96;;;;&tRNA;3457043;142;;;;$rRNA;7669362;268;comp
;$rRNA;179754;266;;;;$rRNA;701265;43;;;fin;°CDS;3457262;;;;;$rRNA;7672563;533;comp
;$rRNA;181557;170;;;;&tRNA;701425;11;;;deb;°CDS;5004536;394;comp;;fin;°CDS;7674633;;
;$rRNA;184657;15;;;;&tRNA;701510;5;;;;&tRNA;5005554;40;comp;;deb;°CDS;7853177;84;comp
;&tRNA;184789;29;;;;&tRNA;701590;5;;;;&tRNA;5005677;13;comp;;;&tRNA;7853819;230;comp
;&tRNA;184906;39;;;;&tRNA;701671;4;;;;&tRNA;5005779;19;comp;;;&tRNA;7854123;404;comp
;&tRNA;185022;15;;;;&tRNA;701752;9;;;;&tRNA;5005872;167;comp;;fin;°CDS;7854601;;comp
;&tRNA;185113;14;;;;&tRNA;701835;8;;;;ncRNA;5006126;132;;;deb;°CDS;8100441;123;comp
;&tRNA;185204;48;;;;&tRNA;701918;18;;;fin;°CDS;5006353;;;;;$rRNA;8100978;169;comp
;&tRNA;185329;5;;;;&tRNA;702009;7;;;deb;°CDS;6383256;228;comp;;;$rRNA;8101264;259;comp
;&tRNA;185410;9;;;;&tRNA;702100;11;;;;&tRNA;6384402;72;;;;$rRNA;8104437;321;comp
;&tRNA;185495;15;;;;&tRNA;702186;12;;;fin;°CDS;6384547;;comp;;fin;°CDS;8106295;;comp
;&tRNA;185595;183;;;;&tRNA;702272;577;;;deb;°CDS;6390912;142;comp;;deb;°CDS;8151918;460;comp
fin;°CDS;185854;;comp;;fin;°CDS;702926;;;;;&tRNA;6391273;7;comp;;;$rRNA;8152909;96;comp
deb;°CDS;217565;129;comp;;deb;°CDS;1073441;377;;;;&tRNA;6391366;19;comp;;;$rRNA;8153128;269;comp
;&tRNA;218276;261;comp;;;$rRNA;1074592;271;;;;&tRNA;6391462;75;comp;;;$rRNA;8156327;272;comp
fin;°CDS;218612;;;;;$rRNA;1076400;170;;;fin;°CDS;6391614;;comp;;fin;°CDS;8158136;;comp
deb;°CDS;230970;186;;;;$rRNA;1079500;9;;;deb;°CDS;6561157;118;;;deb;°CDS;8256928;86;
;tmRNA;231642;140;;;;&tRNA;1079626;6;;;;ncRNA;6563228;95;comp;;;&tRNA;8257833;5;comp
fin;°CDS;232145;;;;;&tRNA;1079708;38;;;fin;°CDS;6563744;;comp;;;&tRNA;8257909;16;comp
deb;°CDS;253921;673;;;;&tRNA;1079835;11;;;deb;°CDS;7354507;342;;;;&tRNA;8258002;4;comp
;$rRNA;255200;280;;;;&tRNA;1079918;17;;;;&tRNA;7355080;28;comp;;;&tRNA;8258083;8;comp
;$rRNA;257017;97;;;;&tRNA;1080011;13;;;;&tRNA;7355191;12;comp;;;&tRNA;8258166;42;comp
;$rRNA;260044;55;;;;&tRNA;1080101;49;;;;&tRNA;7355292;14;comp;;;&tRNA;8258291;8;comp
;&tRNA;260216;19;;;;&tRNA;1080227;4;;;;&tRNA;7355383;14;comp;;;&tRNA;8258375;9;comp
;&tRNA;260312;16;;;;&tRNA;1080307;13;;;;&tRNA;7355474;8;comp;;;&tRNA;8258459;4;comp
;&tRNA;260404;9;;;;&tRNA;1080396;8;;;;&tRNA;7355570;4;comp;;;&tRNA;8258537;5;comp
;&tRNA;260485;20;;;;&tRNA;1080490;13;;;;&tRNA;7355664;4;comp;;;&tRNA;8258619;5;comp
;&tRNA;260590;3;;;;&tRNA;1080574;26;;;;&tRNA;7355741;119;comp;;;&tRNA;8258700;11;comp
;&tRNA;260669;19;;;;&tRNA;1080676;9;;;;ncRNA;7355936;36;;;;&tRNA;8258786;43;comp
;&tRNA;260764;20;;;;&tRNA;1080757;12;;;;&tRNA;7356067;6;comp;;;$rRNA;8258903;96;comp
;&tRNA;260861;15;;;;&tRNA;1080844;10;;;;&tRNA;7356147;104;comp;;;$rRNA;8259116;267;comp
;&tRNA;260949;10;;;;&tRNA;1080928;20;;;;&tRNA;7356325;7;comp;;;$rRNA;8262313;302;comp
;&tRNA;261032;3;;;;&tRNA;1081037;3;;;;&tRNA;7356404;9;comp;;fin;°CDS;8264152;;comp
;&tRNA;261122;12;;;;&tRNA;1081117;150;;;;&tRNA;7356500;9;comp;;deb;°CDS;8322744;393;comp
;&tRNA;261209;15;;;fin;°CDS;1081347;;;;;&tRNA;7356582;9;comp;;;$rRNA;8323599;96;comp
;&tRNA;261296;5;;;deb;°CDS;1210625;354;;;;&tRNA;7356666;17;comp;;;$rRNA;8323812;269;comp
;&tRNA;261375;158;;;;&tRNA;1213874;16;;;;&tRNA;7356759;12;comp;;;$rRNA;8327015;365;comp
;&tRNA;261607;4;;;;&tRNA;1213966;12;;;;&tRNA;7356848;4;comp;;fin;°CDS;8328917;;comp
;&tRNA;261687;5;;;;&tRNA;1214050;16;;;;&tRNA;7356928;15;comp;;deb;°CDS;8351919;396;comp
;&tRNA;261765;19;;;;&tRNA;1214142;17;;;;&tRNA;7357019;8;comp;;;&tRNA;8354811;149;comp
;&tRNA;261874;17;;;;&tRNA;1214236;9;;;;&tRNA;7357112;5;comp;;fin;°CDS;8355034;;comp
;&tRNA;261979;5;;;;&tRNA;1214321;9;;;;&tRNA;7357193;15;comp;;deb;°CDS;8389988;296;
;&tRNA;262060;39;;;;&tRNA;1214405;8;;;;&tRNA;7357280;9;comp;;;$rRNA;8390809;96;comp
;&tRNA;262174;41;;;;&tRNA;1214486;3;;;;&tRNA;7357365;54;comp;;;$rRNA;8391022;270;comp
;&tRNA;262304;283;;;;&tRNA;1214576;169;;;;$rRNA;7357493;113;comp;;;$rRNA;8394222;230;comp
fin;°CDS;262670;;;;fin;°CDS;1214817;;comp;;;$rRNA;7357723;269;comp;;fin;°CDS;8395989;;comp
deb;°CDS;578195;320;;;deb;°CDS;1594387;533;;;;$rRNA;7360922;399;comp;;deb;°CDS;8399622;208;comp
;$rRNA;579376;269;;;;$rRNA;1595199;263;;;fin;°CDS;7362858;;;;;ncRNA;8400892;47;comp
;$rRNA;581183;168;;;;$rRNA;1596999;96;;;deb;°CDS;7618150;280;;;fin;°CDS;8401203;;comp
;$rRNA;584281;31;;;;$rRNA;1600025;43;;;;&tRNA;7619123;335;comp;;deb;°CDS;8616478;417;comp
;&tRNA;584429;10;;;;&tRNA;1600185;19;;;fin;°CDS;7619529;;;;;&tRNA;8617342;157;
;&tRNA;584512;38;;;;&tRNA;1600281;17;;;;;;;;;fin;°CDS;8617576;;
;&tRNA;584639;11;;;;&tRNA;1600374;8;;;;;;;;;deb;°CDS;8724363;455;
;&tRNA;584722;17;;;;&tRNA;1600454;5;;;;;;;;;;&tRNA;8725070;165;comp
;&tRNA;584815;15;;;;&tRNA;1600535;10;;;;;;;;;fin;°CDS;8725326;;comp
;&tRNA;584907;67;;;;&tRNA;1600621;18;;;;;;;;;;;;;
;&tRNA;585051;11;;;;&tRNA;1600724;4;;;;;;;;;;;;;
;&tRNA;585137;10;;;;&tRNA;1600804;21;;;;;;;;;;;;;
;&tRNA;585223;5;;;;&tRNA;1600901;12;;;;;;;;;;;;;
;&tRNA;585303;17;;;;&tRNA;1600990;34;;;;;;;;;;;;;
;&tRNA;585396;40;;;;&tRNA;1601101;13;;;;;;;;;;;;;
;&tRNA;585511;24;;;;&tRNA;1601190;8;;;;;;;;;;;;;
;&tRNA;585610;8;;;;&tRNA;1601273;17;;;;;;;;;;;;;
;&tRNA;585698;19;;;;&tRNA;1601363;13;;;;;;;;;;;;;
;&tRNA;585794;1;;;;&tRNA;1601462;5;;;;;;;;;;;;;
;&tRNA;585869;187;;;;&tRNA;1601554;14;;;;;;;;;;;;;
fin;°CDS;586130;;;;;&tRNA;1601643;10;;;;;;;;;;;;;
;;;;;;;&tRNA;1601724;5;;;;;;;;;;;;;
;;;;;;;&tRNA;1601803;105;;;;;;;;;;;;;
;;;;;;fin;°CDS;1601982;;;;;;;;;;;;;;

pmq intercalaires tRNA-cds[modifier | modifier le wikicode]

pmq;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;47;;137;;18;64;'''deb;
comp’;222;comp’;183;;47;75;<201;8
;;comp’;183;;84;105;total;12
;129;comp’;261;;104;137;taux;67%
;;;283;;106;142;'''fin;
;;;187;;129;149;<201;11
;18;;180;;142;150;total;15
;159;;64;;159;157;taux;73%
;;;577;;256;165;;
;;;150;;354;180;'''total;
;354;comp’;169;;394;187;<201;19
;;;105;;396;283;total;27
;106;comp’;137;;'''-;315;taux;70%
comp’;192;;315;;'''-;404;;
;256;;142;;'''-;577;'''comp’;'''cumuls
;394;;;;86;72;;
comp’;228;comp’;72;;192;137;'''deb;2
;142;;75;;222;169;;8
comp’;342;;;;228;183;;
comp’;280;comp’;335;;280;183;'''fin;5
;104;;;;342;261;;7
;84;;404;;417;335;'''total;
comp’;86;;;;455;'''-;<201;7
;396;;149;;;;total;15
comp’;417;;157;;;;taux;47%
comp’;455;;165;;;;;
;;;;;;;;
;;;;;;;;
;deb;fin;total;;;;;
<201;10;16;26;;;;;
total;20;22;42;;;;;
taux;50%;73%;62%;;;;;

lbu[modifier | modifier le wikicode]

lbu opérons[modifier | modifier le wikicode]

49.8%GC;29.7.19 Paris;16s 8;;;;;;;;
Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
comp;18533..19237;CDS;;128;128;;;235;128
;19366..19438;act;@1;195;195;;;;
;19634..20371;CDS;;6912;;;;246;
;;;;;;;;;
;27284..29785;CDS;;276;276;;;*834;
;30062..30134;act;;134;134;;;;134
;30269..30907;CDS;;11768;;;;213;
;;;;;;;;;
;42676..43248;cds hp;;451;*451;;;*191;
;43700..45271;16s;;209;;;;;
;45481..48391;23s;;69;;;;;
;48461..48577;5s;;275;275;;;;275
;48853..49091;cds hp;;56679;;;;80;
;;;;;;;;;
comp;105771..106547;CDS;;56;56;;;259;56
comp;106604..106679;aag;;125;125;;;;
;106805..107533;CDS;;103754;;;;243;
;;;;;;;;;
;211288..212553;CDS;;94;94;;;422;
;212648..212720;acc;;23;23;;;;23
comp<;212744..213262;CDS;;64997;;;;173;
;;;;;;;;;
;278260..278928;CDS;;69;69;;;223;69
comp;278998..279068;ggg;;181;181;;;;
;279250..280275;CDS;;44047;;;;342;
;;;;;;;;;
comp;324323..324949;CDS;;117;117;;;209;117
;325067..325138;ggc;+;4;;4;;;
;325143..325216;ccg;2 ggc;108;;;;;
;325325..325399;ggc;;155;155;;;;
;325555..326016;CDS;;37886;;;;154;
;;;;;;;;;
;363903..364394;CDS;;98;98;;;164;98
;364493..364564;caa;;614;*614;;;;
;365179..366360;CDS;;-14;;;;*394;
;;;;;;;;;
;366347..367402;CDS;;75;75;;;352;
;367478..367559;tac;;5;;5;;;
;367565..367636;caa;;62;62;;;;62
<;367699..368318;CDS;;14127;;;;207;
;;;;;;;;;
;382446..382907;CDS;;30;30;;;154;30
;382938..383026;ctt;;118;118;;;;
;383145..383768;CDS;;70441;;;;208;
;;;;;;;;;
;454210..455529;CDS;;61;61;;;440;61
;455591..455665;agg;;341;341;;;;
;456007..457035;CDS;;75557;;;;343;
;;;;;;;;;
;532593..533285;CDS;;82;82;;;231;82
comp;533368..533442;cgg;;296;296;;;;
;533739..534782;CDS;;48963;;;;348;
;;;;;;;;;
;583746..584728;CDS;;57;57;;;328;57
comp;584786..584858;cag;;5;;5;;;
comp;584864..584935;gag;;170;170;;;;
;585106..586110;CDS;;94988;;;;335;
;;;;;;;;;
;681099..682741;CDS;;518;*518;;;*548;
;683260..684831;16s;;106;;;;;
;684938..685011;atc;;69;;;69;;
;685081..685153;gca;;127;;;;;
;685281..688191;23s;;68;;;;;
;688260..688376;5s;;208;208;;;;208
comp;688585..689801;CDS;;55794;;;;406;
;;;;;;;;;
comp;745596..745821;CDS;;134;134;;;75;134
comp;745956..746044;tcg;;787;*787;;;;
;746832..749597;CDS;;36741;;;;*922;
;;;;;;;;;
;786339..787004;CDS;;54;54;;;222;54
;787059..787142;ctg;;109;109;;;;
comp;787252..787872;CDS;;2072;;;;207;
;;;;;;;;;
comp;789945..791867;CDS;;613;*613;;;*641;
;792481..794052;16s;;105;;;;;
;794158..794231;atc;;69;;;69;;
;794301..794373;gca;;126;;;;;
;794500..797410;23s;;69;;;;;
;797480..797596;5s;;87;87;;;;87
;797684..798559;CDS;;36;;;;292;
;;;;;;;;;
comp;798596..800178;CDS;;530;*530;;;*528;
;800709..800781;aac;@2;3;;3;;;
;800785..800858;cca;;24;;24;;;
;800883..800954;ggc;;30;;30;;;
;800985..801058;cgt;;2;;2;;;
;801061..801133;gta;;3;;3;;;
;801137..801208;gaa;;42;;42;;;
;801251..801338;tca;;9;;9;;;
;801348..801421;atgf;;3;;3;;;
;801425..801498;gac;;6;;6;;;
;801505..801577;ttc;;8;;8;;;
;801586..801667;tac;;4;;4;;;
;801672..801742;tgg;;13;;13;;;
;801756..801831;cac;;26;;26;;;
;801858..801928;tgc;;28;;28;;;
;801957..802041;ttg;;356;356;;;;356
;802398..802961;CDS;;284259;;;;188;
;;;;;;;;;
comp;1087221..1088531;CDS;;157;157;;;437;157
comp;1088689..1088760;caa;;656;*656;;;;
comp;1089417..1090313;CDS;;173317;;;;*299;
;;;;;;;;;
comp;1263631..1265769;CDS;;188;188;;;*713;188
comp;1265958..1266031;aga;;222;222;;;;
;1266254..1268632;CDS;;84103;;;;*793;
;;;;;;;;;
comp;1352736..1354022;CDS;;98;98;;;429;98
;1354121..1354204;ctg;;204;204;;;;
comp;1354409..1354928;CDS;;13182;;;;173;
;;;;;;;;;
comp;1368111..1369307;CDS;;161;161;;;399;161
comp;1369469..1369541;gta;;3;;;3;;
comp;1369545..1369616;gaa;;138;;;*138;;
comp;1369755..1369828;atgj;;6;;;6;;
comp;1369835..1369925;tcc;;8;;;8;;
comp;1369934..1370006;aac;;7;;;;;
comp;1370014..1370130;5s;;69;;;;;
comp;1370200..1373111;23s;;126;;;;;
comp;1373238..1373310;gca;;69;;;69;;
comp;1373380..1373453;atc;;105;;;;;
comp;1373559..1375130;16s;;547;*547;;;;
;1375678..1376604;CDS;;102845;;;;*309;
;;;;;;;;;
comp;1479450..1479824;CDS;;200;200;;;125;
comp;1480025..1480101;gac;;26;;;26;;
comp;1480128..1480199;gaa;;3;;;3;;
comp;1480203..1480275;gta;;2;;;2;;
comp;1480278..1480351;cgt;;35;;;35;;
comp;1480387..1480458;ggc;;36;;;;;
comp;1480495..1480611;5s;;68;;;;;
comp;1480680..1483590;23s;;208;;;;;
comp;1483799..1485370;16s;;153;153;;;;153
comp;1485524..1485716;CDS;;20944;;;;64;
;;;;;;;;;
comp;1506661..1507464;CDS;;270;270;;;268;
comp;1507735..1507807;aag;+;34;;34;;;
comp;1507842..1507914;aag;5 aag;33;;33;;;
comp;1507948..1508020;aag;;33;;33;;;
comp;1508054..1508126;aag;@3;33;;33;;;
comp;1508160..1508232;aag;;130;130;;;;130
comp;1508363..1509226;CDS;;167;;;;288;
;;;;;;;;;
;1509394..1510872;CDS;;106;106;;;493;106
comp;1510979..1511051;gta;;3;;3;;;
comp;1511055..1511126;gaa;;151;;*151;;;
;1511278..1511366;ctt;;113;113;;;;
;1511480..1512010;CDS;;21195;;;;177;
;;;;;;;;;
comp;1533206..1534129;CDS;;355;355;;;308;
comp;1534485..1534557;acg;;154;154;;;;154
comp;1534712..1535950;CDS;;18502;;;;413;
;;;;;;;;;
;1554453..1554638;CDS;;303;303;;;62;303
comp;1554942..1555029;agc;;673;*673;;;;
comp;1555703..1556203;CDS;;595;;;;*167;
;;;;;;;;;
;1556799..1558178;CDS;;277;277;;;460;
comp;1558456..1558572;5s;;68;;;;;
comp;1558641..1561551;23s;;126;;;;;
comp;1561678..1561750;gca;;69;;;69;;
comp;1561820..1561893;atc;;105;;;;;
comp;1561999..1563570;16s;;189;189;;;;189
;1563760..1563948;CDS;;19274;;;;63;
;;;;;;;;;
comp;1583223..1584392;CDS;;151;151;;;390;151
comp;1584544..1584628;ttg;+;17;;17;;;
comp;1584646..1584730;ttg;2 ttg;28;;28;;;
comp;1584759..1584829;tgc;2 ttc;26;;26;;;
comp;1584856..1584931;cac;2 atgf;13;;13;;;
comp;1584945..1585015;tgg;;4;;4;;;
comp;1585020..1585101;tac;;8;;8;;;
comp;1585110..1585182;ttc;;6;;6;;;
comp;1585189..1585262;gac;;3;;3;;;
comp;1585266..1585339;atgf;;9;;9;;;
comp;1585349..1585436;tca;;42;;42;;;
comp;1585479..1585550;gaa;;258;;*258;;;
comp;1585809..1585899;agc;;2;;2;;;
comp;1585902..1585975;atc;;3;;3;;;
comp;1585979..1586049;gga;;14;;14;;;
comp;1586064..1586136;ttc;;17;;17;;;
comp;1586154..1586227;atgf;;11;;11;;;
comp;1586239..1586312;atgi;;12;;12;;;
comp;1586325..1586398;atg;;36;;36;;;
comp;1586435..1586508;cca;;6;;6;;;
comp;1586515..1586588;cgt;;5;;5;;;
comp;1586594..1586679;tta;;15;;15;;;
comp;1586695..1586766;ggc;;4;;4;;;
comp;1586771..1586843;aca;;11;;11;;;
comp;1586855..1586936;cta;;12;;12;;;
comp;1586949..1587021;aaa;;2;;2;;;
comp;1587024..1587096;gta;;157;157;;;;
comp;1587254..1588681;CDS;;539;;;;476;
;;;;;;;;;
comp;1589221..1590557;CDS;;156;156;;;446;156
comp;1590714..1590830;5s;;68;;;;;
comp;1590899..1593809;23s;;126;;;;;
comp;1593936..1594008;gca;;69;;;69;;
comp;1594078..1594151;atc;;105;;;;;
comp;1594257..1595828;16s;;581;*581;;;;
comp;1596410..1597276;CDS;;189853;;;;*289;
;;;;;;;;;
comp;1787130..1788440;CDS;;298;298;;;437;298
comp;1788739..1788855;5s;;68;;;;;
comp;1788924..1791834;23s;@4;208;;;;;
comp;1792043..1793614;16s;;436;*436;;;;
comp;1794051..1794596;CDS;;-8;;;;*182;
comp;1794589..1795436;CDS;;138;138;;;283;138
comp;1795575..1795648;gac;;3;;;3;;
comp;1795652..1795724;gta;;2;;;2;;
comp;1795727..1795800;cgt;;35;;;35;;
comp;1795836..1795907;ggc;;19;;;19;;
comp;1795927..1796000;cca;;3;;;3;;
comp;1796004..1796076;aac;;7;;;;;
comp;1796084..1796200;5s;;68;;;;;
comp;1796269..1799179;23s;;208;;;;;
comp;1799388..1800959;16s;;501;*501;;;;
comp;1801461..1802087;CDS;;;;;;*209;

lbu cumuls[modifier | modifier le wikicode]

lbu cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;0;1;0;100;5
;16 23 5s 0;2;20;33;9;50;2;20;0;200;11
;16 atc gca;5;40;11;3;100;12;40;2;300;19
;16 23 5s a;2;60;2;0;150;11;60;3;400;11
;max a;7;80;0;5;200;14;80;3;500;11
;a doubles;0;100;0;0;250;3;100;4;600;2
;autres;0;120;0;0;300;6;120;2;700;1
;total aas;26;140;0;1;350;2;140;5;800;2
sans ;opérons;23;160;1;0;400;2;160;5;900;1
;1 aa;16;180;0;0;450;1;180;1;1000;1
;max a;26;200;0;0;500;1;200;2;1100;0
;a doubles;3;;1;0;;10;;5;;0
;total aas;72;;48;18;;64;;32;;64
total aas;;98;;;;;;;;;
remarques;;;;;;;;;;;
avec jaune;;;moyenne;;;;;;138;;320
;;;variance;;;;;;81;;182
sans jaune;;;moyenne;14;29;;159;;114;;275
;;;variance;12;29;;85;;50;;122

lbu blocs[modifier | modifier le wikicode]

lbu blocs;;;;;;;
5s;68;5s;68;;;;
23s;126;23s;126;;;;
gca;69;gca;69;;;;
atc;105;atc;105;;;;
16s;;16s;;;;;
;;;;;;;
;;;;aac;7;;
16s;106;16s;105;5s;69;;
atc;69;atc;69;23s;126;;
gca;127;gca;126;gca;69;;
23s;68;23s;69;atc;105;;
5s;;5s;;16s;;;
;;;;;;;
ggc;36;;;aac;7;;
5s;68;5s;68;5s;68;16s;209
23s;208;23s;208;23s;208;23s;69
16s;;16s;;16s;;5s;

lbu distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;
att;;act;2;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;1;cct;;cat;;cgc;;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;ttg2;ttc;3;tcc;;tac;3;tgc;2;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;1;tac;;tgc;
atc;;acc;1;aac;;agc;1;aag5;atc;1;acc;;aac;1;agc;1;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;2;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;2;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;2
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;4;;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;2;ggc;2
tta;;tca;;taa;;tga;;;tta;1;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;;ata;;aca;1;aaa;1;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;;cca;;caa;2;cga;;;cta;1;cca;2;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;1;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;3;gca;;gaa;3;gga;1;;gta;;gca;;gaa;;gga;;;gta;3;gca;;gaa;2;gga;
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;2;;ttg;2;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;1;agg;1;;atgj;1;acg;;aag;;agg;;;atgj;;acg;;aag;5;agg;;;atgj;1;acg;;aag;;agg;
ctg;2;ccg;;cag;;cgg;1;;ctg;;ccg;1;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;duplicata;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
lbu;;16;;;;;16;;lbu;49;;;;;;49;;lbu;7;;;;;;7;;lbu;;;;16;;;16

ban*[modifier | modifier le wikicode]

ban opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Baci_anth_2002013094/baciAnth_2002013094-tRNAs.fa;gtRNAdb;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009902;ban*;;genome;;;;;;aas;cds dirigé
35.1%GC;15.8.19 Paris;16s 11;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Bacillus anthracis strain 2002013094;;;;;;;;;;
;618142..618366;;CDS;;188;188;;;75;188
;618555..618627;;gtc;;419;*419;;;;
comp;619047..619235;;CDS;;;;;;63;
;;;;;;;;;;
comp;1102183..1102602;;CDS;;130;130;;;140;130
comp;1102733..1102804;;gaa;+;1;;;1;;
comp;1102806..1102880;;aac;2 aca;8;;;8;;
comp;1102889..1102965;;atc;2 tca;11;;;11;;
comp;1102977..1103047;;tgg;;6;;;6;;
comp;1103054..1103126;;aca;;9;;;9;;
comp;1103136..1103211;;ttc;;9;;;9;;
comp;1103221..1103296;;gac;;4;;;4;;
comp;1103301..1103377;;atgf;;20;;;20;;
comp;1103398..1103490;;tca;;54;;;54;;
comp;1103545..1103637;;tca;;20;;;20;;
comp;1103658..1103730;;gca;;16;;;16;;
comp;1103747..1103820;;cca;;10;;;10;;
comp;1103831..1103904;;cgt;;3;;;3;;
comp;1103908..1103996;;tta;;16;;;16;;
comp;1104013..1104087;;ggc;;29;;;29;;
comp;1104117..1104197;;cta;;22;;;22;;
comp;1104220..1104295;;cac;;9;;;9;;
comp;1104305..1104380;;aca;;4;;;4;;
comp;1104385..1104460;;gta;;4;;;;;
comp;1104465..1104580;;5s;;97;;;;;
comp;1104678..1107604;;23s;;141;;;;;
comp;1107746..1109299;;16s;;694;*694;;;;
;1109994..1113038;;CDS;;;;;;*1015;
;;;;;;;;;;
comp;1306706..1307848;;CDS;;198;198;;;381;
comp;1308047..1308120;;gga;;115;115;;;;115
comp;1308236..1308889;;CDS;;;;;;218;
;;;;;;;;;;
;1312025..1312345;;CDS;;207;207;;;107;207
comp;1312553..1312637;;ttg;;10;;;10;;
comp;1312648..1312718;;tgc;;14;;;14;;
comp;1312733..1312807;;ggc;;5;;;5;;
comp;1312813..1312887;;caa;;63;;;63;;
comp;1312951..1313026;;cac;;19;;;19;;
comp;1313046..1313119;;tgg;;7;;;7;;
comp;1313127..1313210;;tac;;17;;;17;;
comp;1313228..1313303;;gta;;5;;;5;;
comp;1313309..1313383;;gaa;;24;;;24;;
comp;1313408..1313480;;acc;;4;;;4;;
comp;1313485..1313559;;aac;;9;;;;;
comp;1313569..1313684;;5s;;96;;;;;
comp;1313781..1316709;;23s;;141;;;;;
comp;1316851..1318405;;16s;;386;*386;;;;
;1318792..1319148;;CDS;;;;;;119;
;;;;;;;;;;
;1556278..1556507;;CDS;;57;57;;;77;57
comp;1556565..1556680;;5s;;49;;;;;
comp;1556730..1560126;;23s;;173;;;;;
comp;1560300..1562132;;16s;;476;*476;;;;
;1562609..1563322;;CDS;;;;;;238;
;;;;;;;;;;
>;1566949..1567219;;CDS;;99;99;;;90;99
comp;1567319..1567434;;5s;;46;;;;;
comp;1567481..1570409;;23s;;142;;;;;
comp;1570552..1572115;;16s;;451;*451;;;;
;1572567..1574498;;CDS;;;;;;*644;
;;;;;;;;;;
;1579539..1580615;;CDS;;14;14;;;359;14
comp;1580630..1580745;;5s;;45;;;;;
comp;1580791..1583912;;23s;;153;;;;;
comp;1584066..1585720;;16s;;294;294;;;;
comp;1586015..1587520;;CDS;;;;;;*502;
;;;;;;;;;;
comp;1600693..1601166;;CDS;;174;174;;;158;
comp;1601341..1601416;;gac;;3;;;3;;
comp;1601420..1601496;;atgf;;12;;;;;
comp;1601509..1601624;;5s;@1;46;;;;;
comp;1601671..1604598;;23s;;141;;;;;
comp;1604740..1606294;;16s;;75;;;;;
comp;1606370..1606440;;gga;;1;;1;;;
comp;1606442..1606518;;cca;+;4;;4;;;
comp;1606523..1606599;;cgt;Séquence 10;3;;3;;;
comp;1606603..1606691;;tta;;16;;16;;;
comp;1606708..1606782;;ggc;;29;;29;;;
comp;1606812..1606892;;cta;;14;;14;;;
comp;1606907..1606982;;aaa;;5;;5;;;
comp;1606988..1607062;;caa;;87;;*87;;;
comp;1607150..1607225;;gac;;46;;46;;;
comp;1607272..1607347;;gta;;4;;4;;;
comp;1607352..1607426;;gaa;;1;;1;;;
comp;1607428..1607502;;aac;2 aac;8;;8;;;
comp;1607511..1607587;;atc;;11;;11;;;
comp;1607599..1607669;;tgg;;6;;6;;;
comp;1607676..1607748;;aca;;9;;9;;;
comp;1607758..1607833;;ttc;;8;;8;;;
comp;1607842..1607917;;gac;;4;;4;;;
comp;1607922..1607998;;atgf;;20;;20;;;
comp;1608019..1608111;;tca;2 tca;54;;54;;;
comp;1608166..1608258;;tca;;20;;20;;;
comp;1608279..1608351;;gca;;16;;16;;;
comp;1608368..1608441;;cca;;10;;10;;;
comp;1608452..1608525;;cgt;;3;;3;;;
comp;1608529..1608617;;tta;;16;;16;;;
comp;1608634..1608708;;ggc;;29;;29;;;
comp;1608738..1608818;;cta;;13;;13;;;
comp;1608832..1608907;;aaa;;5;;5;;;
comp;1608913..1608987;;caa;;87;;*87;;;
comp;1609075..1609150;;gac;;46;;46;;;
comp;1609197..1609272;;gta;;4;;4;;;
comp;1609277..1609351;;gaa;;8;;8;;;
comp;1609360..1609450;;agc;;3;;3;;;
comp;1609454..1609528;;aac;;114;114;;;;114
comp;1609643..1610101;;CDS;;;;;;153;
;;;;;;;;;;
comp;1702642..1703788;;CDS;;114;114;;;382;114
comp;1703903..1703975;;gca;;10;;;10;;
comp;1703986..1704057;;ggc;;5;;;5;;
comp;1704063..1704138;;aaa;;5;;;5;;
comp;1704144..1704218;;caa;;65;;;65;;
comp;1704284..1704366;;tac;;17;;;17;;
comp;1704384..1704459;;gta;;5;;;5;;
comp;1704465..1704539;;gaa;;24;;;24;;
comp;1704564..1704636;;acc;;4;;;4;;
comp;1704641..1704715;;aac;;9;;;;;
comp;1704725..1704840;;5s;;82;;;;;
comp;1704923..1707851;;23s;;141;;;;;
comp;1707993..1709545;;16s;;223;223;;;;
comp;1709769..1709987;;CDS;;;;;;73;
;;;;;;;;;;
comp;1767157..1767618;;CDS;;206;206;;;154;206
comp;1767825..1767940;;5s;;45;;;;;
comp;1767986..1770913;;23s;;141;;;;;
comp;1771055..1772608;;16s;;372;*372;;;;
comp;1772981..1774480;;CDS;;;;;;*500;
;;;;;;;;;;
comp;1787717..1790188;;CDS;;259;259;;;*824;
comp;1790448..1790519;;gaa;;13;;13;;;
comp;1790533..1790606;;atgj;@2;160;160;;;;160
comp;1790767..1791249;;CDS;;;;;;161;
;;;;;;;;;;
comp;1820538..1820717;;CDS;;190;190;;;60;190
comp;1820908..1821023;;5s;;44;;;;;
comp;1821068..1823996;;23s;;77;;;;;
comp;1824074..1824149;;gca;;8;;;8;;
comp;1824158..1824234;;atc;;130;;;;;
comp;1824365..1825919;;16s;;217;217;;;;
comp;1826137..1826406;;CDS;;;;;;90;
;;;;;;;;;;
comp;1832600..1832992;;CDS;;166;166;;;131;
comp;1833159..1833251;;tca;;156;156;;;;156
comp;1833408..1834682;;CDS;;;;;;425;
;;;;;;;;;;
;1839668..1840669;;CDS;;34;34;;;334;34
comp;1840704..1840819;;5s;;44;;;;;
comp;1840864..1843791;;23s;;76;;;;;
comp;1843868..1843943;;gca;;8;;;8;;
comp;1843952..1844028;;atc;;130;;;;;
comp;1844159..1845713;;16s;;240;240;;;;
comp;1845954..1848425;;CDS;;;;;;*824;
;;;;;;;;;;
;1873838..1875127;;CDS;;139;139;;;430;139
;1875267..1875342;;aaa;;13;;13;;;
;1875356..1875427;;gaa;;21;;21;;;
;1875449..1875524;;gac;;41;;41;;;
;1875566..1875638;;ttc;;403;*403;;;;
;1876042..1876749;;CDS;;;;;;236;
;;;;;;;;;;
comp;2217640..2217846;;CDS;;205;205;;;69;205
;2218052..2218130;;cgg;;255;255;;;;
;2218386..2219693;;CDS;;;;;;436;
;;;;;;;;;;
comp;2428815..2429495;;CDS;;404;*404;;;227;
;2429900..2431456;;16s;;139;;;;;
;2431596..2434524;;23s;;97;;;;;
;2434622..2434737;;5s;;4;;;;;
;2434742..2434817;;gta;+;4;;;4;;
;2434822..2434897;;aca;2 cta;9;;;9;;
;2434907..2434982;;cac;2 aca;22;;;22;;
;2435005..2435085;;cta;;29;;;29;;
;2435115..2435189;;ggc;;16;;;16;;
;2435206..2435294;;tta;;3;;;3;;
;2435298..2435371;;cgt;;10;;;10;;
;2435382..2435455;;cca;;16;;;16;;
;2435472..2435544;;gca;;20;;;20;;
;2435565..2435657;;tca;;54;;;54;;
;2435712..2435805;;cta;;20;;;20;;
;2435826..2435902;;atgf;;1;;;1;;
;2435904..2435979;;gac;;12;;;12;;
;2435992..2436067;;ttc;;14;;;14;;
;2436082..2436157;;aca;;10;;;10;;
;2436168..2436243;;aaa;;13;;;13;;
;2436257..2436327;;gga;;10;;;10;;
;2436338..2436414;;atc;;7;;;7;;
;2436422..2436496;;aac;;7;;;7;;
;2436504..2436594;;agc;;6;;;6;;
;2436601..2436672;;gaa;;59;59;;;;59
;2436732..2436842;;CDS;;;;;;37;
;;;;;;;;;;
;2798971..2799474;;CDS;;109;109;;;168;109
;2799584..2799657;;gga;;1;;1;;;
;2799659..2799735;;aga;;407;*407;;;;
;2800143..2800343;;CDS;;;;;;67;
;;;;;;;;;;
comp;2991608..2992366;;CDS;;242;242;;;253;
;2992609..2992682;;atgi;;221;221;;;;221
;2992904..2993515;;CDS;;;;;;204;

ban cumuls[modifier | modifier le wikicode]

ban* cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;3;2;1;0;1;0;100;10
;16 23 5s 0;4;20;25;47;50;2;20;1;200;9
;16 atc gca;2;40;3;6;100;3;40;1;300;6
;16 23 5s a;5;60;4;2;150;6;60;2;400;4
;max a;21;80;0;2;200;7;80;0;500;4
;a doubles;2;100;2;0;250;8;100;1;600;1
;autres;0;120;0;0;300;3;120;4;700;1
;total aas;66;140;0;0;350;0;140;2;800;0
sans ;opérons;9;160;0;0;400;2;160;2;900;2
;1 aa;5;180;0;0;450;3;180;0;1000;0
;max a;33;200;0;0;500;0;200;2;1100;1
;a doubles;1;;0;0;;0;;4;;0
;total aas;46;;37;59;;34;;19;;38
total aas;;112;;;;;;;;;
remarques;;2;;;;;;;;;
avec jaune;;;moyenne;18;15;;232;;132;;274
;;;variance;21;14;;143;;62;;238
sans jaune;;;moyenne;14;;;165;;;;191
;;;variance;14;;;71;;;;124

ban blocs[modifier | modifier le wikicode]

ban intercalaires des 11 clusters à rRNAs;;;;;
aa;gta;aac;atgf;aac;CDS
inter aa;4;9;12;9;404
5s;97;96;46;82;139
23s;141;141;141;141;97
16s;694;386;75;223;4
CDS;CDS;CDS;gga;CDS;gta
;;;;;
CDS;57;99;14;206;
5s;49;46;45;45;
23s;173;142;153;141;
16s;476;451;294;372;
;;;;;
CDS;190;34;;;
5s;44;44;;;
23s;77;76;;;
gca;8;8;;;
atc;130;130;;;
16s;217;240;;;
CDS;;;;;

ban distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;tca2 5s;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;;tac;;tgc;;;;;;;;;;;;ttc;3;tcc;;tac;2;tgc;1
atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;;;;;;;;;;;;atc;3;acc;2;aac;6;agc;2
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;3;cgt;4
gtc;1;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;5;ggc;6
tta;;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;4;tca;5;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;1;aga;1;;;;;;;;;;;ata;;aca;5;aaa;4;aga;
cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;5;cca;4;caa;4;cga;
gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;2;gga;1;;;;;;;;;;;gta;6;gca;4;gaa;6;gga;2
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;1;tcg;;tag;;tgg;3
atgj;;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;;;;;;;;;;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;baci;>1aa;1aa;-5s;+5s;-16s;+16s;total
ban;;5;;;;;5;;ban;8;;;;;;8;;;;;;;;;;;ban;;;;93;;;93
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;2 1-3aas;33 -16s;;

ban séquences[modifier | modifier le wikicode]

33 aas;inter;21 aas;inter;19 aas;inter;11 aas;inter
;;;;;;;
gga;1;;;;;ttg;10
cca;4;;;;;tgc;14
cgt;3;;;;;ggc;5
tta;16;;;;;caa;63
ggc;29;;;;;cac;19
cta;14;;;;;tgg;7
aaa;5;;;;;tac;17
caa;87;;;;;gta;5
gac;46;gaa;6;;;gaa;24
gta;4;agc;7;;;acc;4
gaa;1;aac;7;gaa;1;aac;
aac;8;atc;10;aac;8;;
atc;11;gga;13;atc;11;;
tgg;6;aaa;10;tgg;6;;
aca;9;aca;14;aca;9;;
ttc;8;ttc;12;ttc;9;;
gac;4;gac;1;gac;4;;
atgf;20;atgf;20;atgf;20;;
tca;54;cta;54;tca;54;9 aas;inter
tca;20;tca;20;tca;20;;
gca;16;gca;16;gca;16;gca;10
cca;10;cca;10;cca;10;ggc;5
cgt;3;cgt;3;cgt;3;aaa;5
tta;16;tta;16;tta;16;caa;65
ggc;29;ggc;29;ggc;29;tac;17
cta;13;cta;22;cta;22;gta;5
aaa;5;cac;9;cac;9;gaa;24
caa;87;aca;4;aca;4;acc;4
gac;46;gta;;gta;;aac;
gta;4;;;;;;
gaa;8;;;;;;
agc;3;;;;;;
aac;;;;;;;

bacilli synthèse[modifier | modifier le wikicode]

bacilli distribution par génome[modifier | modifier le wikicode]

baci8;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
bsu;18;8;;52;2;4;;2;86
lmo;9;8;;44;;4;;2;67
lam;22;14;;16;;4;3;4;63
ppm;67;21;;68;;5;;;161
pmq;22;11;;138;;0;2;;173
lbu;49;16;;16;;10;7;;98
ban;8;5;;60;33;4;;2;112
;;;;;;;;;
total;195;83;0;394;35;31;12;10;760

bacilli distribution du total[modifier | modifier le wikicode]

baci8;Sans 2 16s, 10 13aas et 31 +16s;;;;;;717;;baci8;Le reste;;;;;;43
atgi;8;tct;;tat;;atgf;25;;atgi;;tct;;tat;;atgf;2
att;;act;2;aat;;agt;;;att;;act;;aat;;agt;
ctt;5;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;23;tcc;12;tac;24;tgc;12;;ttc;;tcc;1;tac;;tgc;
atc;16;acc;8;aac;32;agc;17;;atc;15;acc;1;aac;4;agc;
ctc;11;ccc;2;cac;21;cgt;27;;ctc;;ccc;;cac;;cgt;1
gtc;8;gcc;4;gac;34;ggc;39;;gtc;;gcc;;gac;2;ggc;3
tta;16;tca;17;taa;;tga;;;tta;;tca;;taa;;tga;
ata;1;aca;23;aaa;30;aga;9;;ata;;aca;;aaa;;aga;
cta;15;cca;27;caa;29;cga;2;;cta;;cca;;caa;;cga;
gta;36;gca;17;gaa;42;gga;19;;gta;;gca;16;gaa;;gga;1
ttg;13;tcg;10;tag;;tgg;15;;ttg;2;tcg;;tag;;tgg;
atgj;14;acg;7;aag;10;agg;3;;atgj;;acg;;aag;5;agg;
ctg;15;ccg;2;cag;1;cgg;8;;ctg;2;ccg;;cag;;cgg;
gtg;;gcg;;gag;2;ggg;4;;gtg;;gcg;;gag;;ggg;
baci8;>1aa;1aa;-5s;+5s;-16s;+16s;total;;baci8;dupli;1aa;-5s;+5s;-16s;+16s;total
type;207;83;0;394;33;0;717;;type;12;;;10;2;31;43

bacilli distribution par type[modifier | modifier le wikicode]

baci8;;;;;;;717;;baci8;;;;;;;83;;baci8;;;;;;;195;;baci8;;;;;;;12;;baci8;;;;;;;427
atgi;8;tct;0;tat;0;atgf;25;;atgi;2;tct;;tat;;atgf;;;atgi;3;tct;;tat;;atgf;7;;atgi;;tct;;tat;;atgf;;;atgi;3;tct;;tat;;atgf;18
att;0;act;2;aat;0;agt;0;;att;;act;2;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;5;cct;0;cat;0;cgc;0;;ctt;2;cct;;cat;;cgc;;;ctt;3;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;23;tcc;12;tac;24;tgc;12;;ttc;0;tcc;;tac;;tgc;;;ttc;9;tcc;3;tac;11;tgc;5;;ttc;;tcc;;tac;;tgc;;;ttc;14;tcc;9;tac;13;tgc;7
atc;16;acc;8;aac;32;agc;17;;atc;1;acc;2;aac;1;agc;1;;atc;3;acc;;aac;9;agc;6;;atc;;acc;;aac;;agc;;;atc;12;acc;6;aac;22;agc;10
ctc;11;ccc;2;cac;21;cgt;27;;ctc;3;ccc;2;cac;;cgt;1;;ctc;4;ccc;;cac;9;cgt;3;;ctc;;ccc;;cac;;cgt;;;ctc;4;ccc;;cac;12;cgt;23
gtc;8;gcc;4;gac;34;ggc;39;;gtc;5;gcc;2;gac;1;ggc;;;gtc;;gcc;1;gac;11;ggc;7;;gtc;;gcc;;gac;;ggc;3;;gtc;3;gcc;1;gac;22;ggc;29
tta;16;tca;17;taa;0;tga;0;;tta;2;tca;5;taa;;tga;;;tta;3;tca;5;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;11;tca;7;taa;;tga;
ata;1;aca;23;aaa;30;aga;9;;ata;;aca;1;aaa;;aga;7;;ata;1;aca;4;aaa;8;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;18;aaa;22;aga;1
cta;15;cca;27;caa;29;cga;2;;cta;;cca;;caa;4;cga;;;cta;3;cca;5;caa;10;cga;2;;cta;;cca;;caa;;cga;;;cta;12;cca;22;caa;15;cga;
gta;36;gca;17;gaa;42;gga;19;;gta;;gca;;gaa;;gga;5;;gta;8;gca;2;gaa;19;gga;4;;gta;;gca;;gaa;;gga;;;gta;28;gca;15;gaa;23;gga;10
ttg;13;tcg;10;tag;0;tgg;15;;ttg;;tcg;5;tag;;tgg;;;ttg;4;tcg;3;tag;;tgg;7;;ttg;2;tcg;;tag;;tgg;;;ttg;7;tcg;2;tag;;tgg;8
atgj;14;acg;7;aag;10;agg;3;;atgj;2;acg;3;aag;4;agg;3;;atgj;4;acg;2;aag;1;agg;;;atgj;;acg;;aag;5;agg;;;atgj;8;acg;2;aag;;agg;
ctg;15;ccg;2;cag;1;cgg;8;;ctg;5;ccg;;cag;;cgg;8;;ctg;1;ccg;2;cag;1;cgg;;;ctg;2;ccg;;cag;;cgg;;;ctg;7;ccg;;cag;;cgg;
gtg;0;gcg;0;gag;2;ggg;4;;gtg;;gcg;;gag;1;ggg;3;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;1
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total
;;;;;;;;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;;;;;*;;;

bacilli par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;baci8;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;43;21;5;13;;;82;
16;moyen;27;59;4;135;2;31;227;
14;fort;13;115;3;279;8;2;418;
; ;83;195;12;427;10;33;760;
10;g+cga;16;12;5;5;;;38;
2;agg+cgg;11;0;;;;;11;
4;carre ccc;12;5;;8;;;25;
5;autres;4;4;;;;;8;
;;43;21;5;13;;;82;
;total tRNAs  ‰ ;;;;;;;;
;baci8;1aa;>1aa;dup;+5s;1-3aas;autres;baci  ‰;ref. ‰
21;faible;57;28;7;17;;;108;26
16;moyen;36;78;5;178;3;41;299;324
14;fort;17;151;4;367;11;3;550;650
;;109;257;16;562;13;43;760;729
10;g+cga;21;16;7;7;;;50;10
2;agg+cgg;14;;;;;;14;
4;carre ccc;16;7;;11;;;33;16
5;autres;5;5;;;;;11;
;;57;28;7;17;;;108;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;baci8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;148;72;17;238;26;52;11;
16;moyen;93;203;14;310;324;33;30;
14;fort;45;397;10;452;650;16;59;
;;286;672;41;290;729;83;195;
10;g+cga;55;41;17;114;;37;;
2;agg+cgg;38;;;38;;26;;
4;carre ccc;41;17;;59;;28;;
5;autres;14;14;;28;;9;;
;;148;72;17;238;;43;;

bacilli, estimation des -rRNAs[modifier | modifier le wikicode]

;;;;;;;;bacilli;;;;;;;;;;;;;;;;;
32 génomes total avec rRNA;;;;baci;total;ttt;tgt;;100 génomes total avec rRNA;;;;baci;total;ttt;tgt;;;;;;;;;
effectifs;sans +16s;;;32;1889;0;0;;indices;;;;32;5903;0;0;;baci7;effectifs;;1aa+>1aa+dup;;;;290
atgi;20;tct;;tat;;atgf;91;;atgi;63;tct;;tat;;atgf;284;;atgi;5;tct;;tat;;atgf;7
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;2;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;5;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;63;tcc;30;tac;56;tgc;30;;ttc;197;tcc;94;tac;175;tgc;94;;ttc;9;tcc;3;tac;11;tgc;5
atc;92;acc;27;aac;99;agc;38;;atc;288;acc;84;aac;309;agc;119;;atc;4;acc;2;aac;10;agc;7
ctc;15;ccc;;cac;53;cgt;82;;ctc;47;ccc;;cac;166;cgt;256;;ctc;7;ccc;2;cac;9;cgt;4
gtc;3;gcc;1;gac;106;ggc;101;;gtc;9.4;gcc;3.1;gac;331;ggc;316;;gtc;5;gcc;3;gac;12;ggc;10
tta;59;tca;49;taa;;tga;;;tta;184;tca;153;taa;;tga;;;tta;5;tca;10;taa;;tga;
ata;;aca;87;aaa;84;aga;1;;ata;0;aca;272;aaa;263;aga;3.1;;ata;1;aca;5;aaa;8;aga;8
cta;54;cca;77;caa;69;cga;;;cta;169;cca;241;caa;216;cga;;;cta;3;cca;5;caa;14;cga;2
gta;113;gca;122;gaa;94;gga;49;;gta;353;gca;381;gaa;294;gga;153;;gta;8;gca;2;gaa;19;gga;9
ttg;32;tcg;2;tag;;tgg;42;;ttg;100;tcg;6.3;tag;;tgg;131;;ttg;6;tcg;8;tag;;tgg;7
atgj;32;acg;3;aag;;agg;;;atgj;100;acg;9.4;aag;;agg;;;atgj;6;acg;5;aag;10;agg;3
ctg;12;ccg;;cag;;cgg;;;ctg;37.5;ccg;;cag;;cgg;;;ctg;8;ccg;2;cag;1;cgg;8
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;3.1;;gtg;;gcg;;gag;2;ggg;3
;;693;;1171;;25;1889;;;;2166;;3659;;78;5903;;;;90;;131;;69;290
29.5.20 Tanger;;;;baci;total;ttt;tgt;;29.5.20 Tanger;;;;baci;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;49366;0,2;0;;indices;sans +16s;;;618;49366;0,2;0;;baci7;indices;;1aa+>1aa+dup;;;;
atgi;84;tct;0.3;tat;0.5;atgf;1;;atgi;146;tct;0.3;tat;0.5;atgf;285;;atgi;71;tct;;tat;;atgf;100
att;0.2;act;11;aat;0.5;agt;;;att;0.2;act;11;aat;0.5;agt;;;att;;act;29;aat;;agt;
ctt;47;cct;0.6;cat;0.2;cgc;0.2;;ctt;47;cct;0.6;cat;0.2;cgc;0.2;;ctt;71;cct;;cat;;cgc;
gtt;0.2;gct;0.5;gat;;ggt;;;gtt;0.2;gct;0.5;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;75;tcc;26;tac;64;tgc;23;;ttc;272;tcc;120;tac;239;tgc;117;;ttc;129;tcc;43;tac;157;tgc;71
atc;23;acc;8;aac;69;agc;40;;atc;310;acc;92;aac;378;agc;159;;atc;57;acc;29;aac;143;agc;100
ctc;28;ccc;6.1;cac;20;cgt;32;;ctc;75;ccc;6.1;cac;186;cgt;288;;ctc;100;ccc;29;cac;129;cgt;57
gtc;44;gcc;27;gac;55;ggc;-6;;gtc;53;gcc;30;gac;386;ggc;310;;gtc;71;gcc;43;gac;171;ggc;143
tta;27;tca;91;taa;1.1;tga;1.8;;tta;211;tca;244;taa;1.1;tga;1.8;;tta;71;tca;143;taa;;tga;
ata;2.1;aca;22;aaa;78;aga;116;;ata;2.1;aca;294;aaa;340;aga;119;;ata;14;aca;71;aaa;114;aga;114
cta;30;cca;2;caa;83;cga;6.3;;cta;199;cca;243;caa;299;cga;6.3;;cta;43;cca;71;caa;200;cga;29
gta;44;gca;62;gaa;174;gga;152;;gta;397;gca;443;gaa;468;gga;305;;gta;114;gca;29;gaa;271;gga;129
ttg;25;tcg;41;tag;0.8;tgg;6;;ttg;125;tcg;47;tag;0.8;tgg;137;;ttg;86;tcg;114;tag;;tgg;100
atgj;52;acg;38;aag;73;agg;72;;atgj;152;acg;47;aag;73;agg;72;;atgj;86;acg;71;aag;143;agg;43
ctg;22.5;ccg;19;cag;17;cgg;109;;ctg;60;ccg;19;cag;17;cgg;109;;ctg;114;ccg;29;cag;14;cgg;114
gtg;0.8;gcg;8.6;gag;16;ggg;15;;gtg;0.8;gcg;8.6;gag;16;ggg;18;;gtg;;gcg;;gag;29;ggg;43
;;654;;845;;582;2081;;;;2820;;4504;;660;7984;;;;1286;;1871;;986;4143
rapports;;23;;19;;88;26;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;baci7;indices;;1aa+>1aa+dup;;différence;;
atgi;57;tct;;tat;;atgf;0.2;;fiches;28.90625;;;fréquences;;;;;atgi;14;tct;100;tat;100;atgf;99
att;;act;100;aat;;agt;;;total des aas sans rRNA;925;;;0/0;0;;;;att;100;act;62;aat;100;agt;
ctt;100;cct;;cat;;cgc;;;avec;1902;;;10;2;;;;ctt;34;cct;100;cat;100;cgc;100
gtt;;gct;;gat;;ggt;;;genom;32;;;20;3;;;;gtt;100;gct;100;gat;;ggt;
ttc;28;tcc;22;tac;27;tgc;20;;;;;;30;1;;;;ttc;42;tcc;39;tac;59;tgc;67
atc;7;acc;8;aac;18;agc;25;;baci7;41.429;;;40;9;;;;atc;61;acc;73;aac;52;agc;60
ctc;38;ccc;100;cac;11;cgt;11;;sans;290;;;50;6;21;;;ctc;72;ccc;79;cac;84;cgt;44
gtc;82;gcc;90;gac;14;ggc;-2;;avec;470;;;60;5;;;;gtc;39;gcc;37;gac;68;ggc;104
tta;13;tca;37;taa;;tga;100;;genom;7;;;70;9;;;;tta;63;tca;36;taa;100;tga;100
ata;100;aca;8;aaa;23;aga;97;;;;;;80;5;;;;ata;85;aca;69;aaa;32;aga;1
cta;15;cca;1.0;caa;28;cga;100;;L’estimation par baci7;;;;90;3;;;;cta;29;cca;97;caa;58;cga;78
gta;11;gca;14;gaa;37;gga;50;;est  43 % au dessus;;;;100;6;;;;gta;62;gca;54;gaa;36;gga;15
ttg;20;tcg;87;tag;;tgg;4;;des aas sans;;;;;1;;;;ttg;71;tcg;64;tag;100;tgg;94
atgj;34;acg;80;aag;100;agg;100;;32;;100;;;50;;;;atgj;39;acg;47;aag;49;agg;40
ctg;38;ccg;100;cag;100;cgg;100;;atc;45;310;;;;;;;ctg;80;ccg;34;cag;16;cgg;5
gtg;100;gcg;100;gag;100;ggg;83;;gca;59;443;;;;;;;gtg;100;gcg;100;gag;44;ggg;65
;;;;;;;;;;;;;;;;;;;;867;;838;;850;2554

clostridia[modifier | modifier le wikicode]

psor[modifier | modifier le wikicode]

psor opérons[modifier | modifier le wikicode]

27.3%GC;8.8.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paeniclostridium sordellii AM370;;;;;;;;;
;9847..10620;CDS;;205;205;;;258;
;10826..12332;16s;;196;;;;;
;12529..15445;23s;;78;;;;;
;15524..15640;5s;;85;85;;;;85
;15726..15947;CDS;;;;;;74;
;;;;;;;;;
;18845..19297;CDS;;3;3;;;151;3
;19301..19393;tcc;;27;;;;;
;19421..19685;ncRNA;;152;152;;;;
;19838..21478;CDS;;;;;;*547;
;;;;;;;;;
;24343..24570;CDS;;309;309;;;76;
;24880..26386;16s;;196;;;;;
;26583..29499;23s;;122;;;;;
;29622..29738;5s;;5;;;5;;
;29744..29832;tta;+;13;;;13;;
;29846..29921;atgf;3 aaa;15;;;15;;
;29937..30011;gaa;6 atg;9;;;9;;
;30021..30094;gga;3 gta;6;;;6;;
;30101..30176;gta;1 cgt;5;;;5;;
;30182..30258;gac;1 ggc;16;;;16;;
;30275..30350;aac;2 fois suite;4;;;4;;
;30355..30429;aca;aac aca aga;4;;;4;;
;30434..30518;tac;caa cac cca;15;;;15;;
;30534..30617;cta;cta gaa gac;14;;;14;;
;30632..30708;aga;gga tac tca;7;;;7;;
;30716..30791;caa;tgc tta ttc;11;;;11;;
;30803..30878;aaa;;6;;;6;;
;30885..30973;tca;;3;;;3;;
;30977..31052;ttc;;9;;;9;;
;31062..31138;atgj;;8;;;8;;
;31147..31223;atgi;;21;;;21;;
;31245..31321;cca;;6;;;6;;
;31328..31404;cac;;4;;;4;;
;31409..31482;tgc;;25;;;25;;
;31508..31596;tta;;13;;;13;;
;31610..31685;atgf;;15;;;15;;
;31701..31775;gaa;;9;;;9;;
;31785..31858;gga;;6;;;6;;
;31865..31940;gta;;5;;;5;;
;31946..32022;gac;;16;;;16;;
;32039..32114;aac;;4;;;4;;
;32119..32193;aca;;4;;;4;;
;32198..32282;tac;;15;;;15;;
;32298..32381;cta;;11;;;11;;
;32393..32467;ggc;;13;;;13;;
;32481..32557;aga;;7;;;7;;
;32565..32640;caa;;11;;;11;;
;32652..32727;aaa;;6;;;6;;
;32734..32822;tca;;3;;;3;;
;32826..32901;ttc;;9;;;9;;
;32911..32987;atgj;;8;;;8;;
;32996..33072;atgi;;21;;;21;;
;33094..33170;cca;;6;;;6;;
;33177..33253;cac;;9;;;9;;
;33263..33338;aaa;;21;;;21;;
;33360..33433;tgc;;6;;;6;;
;33440..33516;cgt;;10;;;;;
;33527..33602;gta;;162;162;;;;162
;33765..34016;CDS;;;;;;84;
;;;;;;;;;
;34042..34455;CDS;;249;249;;;138;
;34705..36211;16s;;196;;;;;
;36408..39324;23s;;78;;;;;
;39403..39519;5s;;402;*402;;;;
comp;39922..40113;CDS;;348;348;;;64;
;40462..41968;16s;;196;;;;;
;42165..45081;23s;;78;;;;;
;45160..45276;5s;;180;180;;;;*180
;45457..47394;CDS;;;;;;*646;
;;;;;;;;;
;101428..102144;CDS;;276;276;;;239;
;102421..103927;16s;;54;;;;;
;103982..104057;gca;;114;;;;;
;104172..107096;23s;;41;;;;;
;107138..107211;gga;;11;;;;;
;107223..107339;5s;;99;99;;;;99
comp;107439..108617;CDS;;;;;;393;
;;;;;;;;;
;111345..111884;CDS;;431;*431;;;180;
;112316..113822;16s;;54;;;;;
;113877..113952;gca;;114;;;;;
;114067..116982;23s;;193;;;;;
;117176..117292;5s;;5;;;;;
;117298..117386;tta;;9;;;9;;
;117396..117472;atgi;;123;;;;;
;117596..119102;16s;;54;;;;;
;119157..119232;gca;;114;;;;;
;119347..122263;23s;;193;;;;;
;122457..122573;5s;;5;;;;;
;122579..122667;tta;;9;;;9;;
;122677..122753;atgi;;123;;;;;
;122877..124383;16s;;54;;;;;
;124438..124513;gca;;114;;;;;
;124628..127549;23s;;78;;;;;
;127628..127744;5s;;100;100;;;;100
;127845..129260;CDS;;;;;;472;
;;;;;;;;;
;215388..216260;CDS;;264;264;;;291;
;216525..218030;16s;;123;;;;;
;218154..218229;gca;;152;;;;;
;218382..221296;23s;;50;;;;;
;221347..221420;gga;;12;;;;;
;221433..221549;5s;;109;109;;;;109
;221659..221940;CDS;;525;*525;;;94;
;222466..223972;16s;;196;;;;;
;224169..227083;23s;;144;;;;;
;227228..227344;5s;;228;228;;;;*228
;227573..227989;CDS;;;;;;139;
;;;;;;;;;
;449964..450266;CDS;;253;253;;;101;
;450520..452026;16s;;196;;;;;
;452223..455139;23s;;144;;;;;
;455284..455400;5s;;112;112;;;;112
comp;455513..456616;CDS;;;;;;368;
;;;;;;;;;
;498418..499074;CDS;;189;189;;;219;
;499264..500770;16s;;118;;;;;
;500889..500964;gca;;95;;;;;
;501060..503976;23s;;144;;;;;
;504121..504237;5s;;131;131;;;;131
;504369..504551;CDS;;;;;;61;
;;;;;;;;;
;546886..550416;CDS;;41;41;;;*1177;*41
comp;550458..550544;ttg;;138;138;;;;
;550683..553325;CDS;;;;;;*881;
;;;;;;;;;
;608009..608683;CDS;;195;195;;;225;
;608879..608975;tga;;37;37;;;;37
comp;609013..609732;CDS;;;;;;240;
;;;;;;;;;
;815939..816655;CDS;;71;71;;;239;71
;816727..816800;tgc;;12;;12;;;
;816813..816888;aac;;3;;3;;;
;816892..816966;aca;;285;285;;;;
;817252..818727;CDS;;;;;;492;
;;;;;;;;;
;1284870..1288097;CDS;;111;111;;;*1076;*111
;1288209..1288297;cta;;426;*426;;;;
;1288724..1290853;CDS;;;;;;*710;
;;;;;;;;;
;1445161..1445664;CDS;;135;135;;;168;135
;1445800..1445868;other;@1;258;258;;;;
;1446127..1446813;CDS;;;;;;229;
;;;;;;;;;
;2267513..2267698;CDS;@2;306;306;;;62;*306
comp;2268005..2268088;cta;;404;*404;;;;
;2268493..2269758;CDS;;;;;;422;
;;;;;;;;;
;3094098..3094784;CDS;;40;40;;;229;40
comp;3094825..3094941;5s;;78;;;;;
comp;3095020..3097936;23s;;194;;;;;
comp;3098131..3099637;16s;;276;276;;;;
comp;3099914..3101161;CDS;;;;;;416;
;;;;;;;;;
;3159922..3160827;CDS;;37;37;;;302;37
comp;3160865..3160956;agc;;120;120;;;;
comp;3161077..3161376;CDS;;;;;;100;
;;;;;;;;;
comp;3274188..3274733;CDS;;245;245;;;182;*245
comp;3274979..3275095;5s;@3;12;;;;;
comp;3275108..3275181;gga;;107;;;;;
comp;3275289..3278214;23s;;137;;;;;
comp;3278352..3279858;16s;;253;253;;;;
comp;3280112..3280690;CDS;;;;;;193;
;;;;;;;;;
comp;3303104..3304150;CDS;;124;124;;;349;124
comp;3304275..3304459;riboswitch;@4;96;;;;;
comp;3304556..3304672;5s;;11;;;;;
comp;3304684..3304758;aca;;116;;;;;
comp;3304875..3307789;23s;;196;;;;;
comp;3307986..3309492;16s;;364;*364;;;;
;3309857..3310504;CDS;;;;;;216;
;;;;;;;;;
comp;3438683..3439531;CDS;;142;142;;;283;142
comp;3439674..3439750;aga;;7;;;7;;
comp;3439758..3439832;ggc;;9;;;9;;
comp;3439842..3439918;gac;;5;;;5;;
comp;3439924..3439999;gta;;8;;;8;;
comp;3440008..3440082;gaa;;5;;;;;
comp;3440088..3440204;5s;;40;;;;;
comp;3440245..3443168;23s;;112;;;;;
comp;3443281..3443356;gca;;109;;;;;
comp;3443466..3444972;16s;;138;;;;;
comp;3445111..3445187;atgj;+;13;;;13;;
comp;3445201..3445276;ttc;3 atg;6;;;6;;
comp;3445283..3445359;atc;2 cca;6;;;6;;
comp;3445366..3445442;cca;2 gga;31;;;31;;
comp;3445474..3445549;tgg;2 aac;11;;;11;;
comp;3445561..3445637;atgi;;6;;;6;;
comp;3445644..3445720;cca;;6;;;6;;
comp;3445727..3445817;agc;;11;;;11;;
comp;3445829..3445917;tca;;6;;;6;;
comp;3445924..3445999;aaa;;12;;;12;;
comp;3446012..3446087;caa;;6;;;6;;
comp;3446094..3446170;aga;;19;;;19;;
comp;3446190..3446263;gga;;11;;;11;;
comp;3446275..3446359;tac;;4;;;4;;
comp;3446364..3446438;aca;;4;;;4;;
comp;3446443..3446518;aac;;31;;;31;;
comp;3446550..3446625;aac;;16;;;16;;
comp;3446642..3446718;gac;;5;;;5;;
comp;3446724..3446799;gta;;6;;;6;;
comp;3446806..3446879;gga;;9;;;9;;
comp;3446889..3446963;gaa;;15;;;15;;
comp;3446979..3447054;atgf;;13;;;13;;
comp;3447068..3447156;tta;;5;;;;;
comp;3447162..3447278;5s;;213;;;;;
comp;3447492..3450406;23s;;196;;;;;
comp;3450603..3452109;16s;;239;239;;;;
comp;3452349..3452552;CDS;;;;;;68;
;;;;;;;;;
comp;3523330..3524046;CDS;;129;129;;;239;129
comp;3524176..3524251;gta;+;8;;8;;;
comp;3524260..3524334;gaa;2 fois;20;;20;;;
comp;3524355..3524430;aaa;gta gaa aaa;10;;10;;;
comp;3524441..3524515;aca;;10;;10;;;
comp;3524526..3524602;gac;;7;;7;;;
comp;3524610..3524685;gta;;9;;9;;;
comp;3524695..3524769;gaa;;5;;5;;;
comp;3524775..3524850;aaa;;289;289;;;;
;3525140..3526039;CDS;;;;;;300;

psor cumuls[modifier | modifier le wikicode]

psor cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;0;1;0;1;0;100;9
;16 23 5s 0;6;20;9;65;50;5;20;1;200;8
;16 atc gca;0;40;0;6;100;4;40;3;300;13
;16 23 5s a;2;60;0;0;150;10;60;1;400;4
;max a;44;80;0;0;200;5;80;1;500;4
;a doubles;2;100;0;0;250;5;100;3;600;1
;autres;9;120;0;0;300;8;120;3;700;1
;total aas;87;140;0;0;350;3;140;4;800;1
sans ;opérons;8;160;0;0;400;1;160;1;900;1
;1 aa;6;180;0;0;450;4;180;2;1000;0
;max a;8;200;0;0;500;0;200;0;1100;1
;a doubles;1;;0;0;;1;;3;;1
;total aas;17;;9;71;;46;;22;;44
total aas;;104;;;;;;;;;
remarques;;4;;;;;;;;;
avec jaune;;;moyenne;9;10;;206;;119;;304
;;;variance;5;6;;121;;73;;257
sans jaune;;;moyenne;;;;173;;95;;220
;;;variance;;;;90;;45;;121

psor blocs[modifier | modifier le wikicode]

I;;I2;I3;I4;;;II;;III;;IV;IV1;IV2
;;;;;;;;;;;;;
;;;;;;;;;CDS;124;;;
;;;;;;;CDS;245;riboswitch;96;;;
CDS;205;249;348;525;253;40;5s;12;5s;11;CDS;309;5
16s;196;196;196;196;196;78;gga;107;aca;116;16s;196;213
23s;78;78;78;144;144;194;23s;137;23s;196;23s;122;196
5s;85;402;180;228;112;276;16s;253;16s;364;5s;5;239
CDS;;;;;;;CDS;;CDS;;tta;;
V;;V2;VI;VI1;VII;VII1;VIII;VIII1;IX;;X;X1;
;;;;;;;;;;;;;
CDS;276;264;CDS;431;;;;;CDS;189;gaa;5;
16s;54;123;16s;54;16s;54;16s;54;16s;118;5s;40;
gca;114;152;gca;114;gca;114;gca;114;gca;95;23s;112;
23s;41;50;23s;193;23s;193;23s;78;23s;144;gca;109;
gga;11;12;5s;5;5s;5;5s;100;5s;131;16s;138;
5s;99;109;tta;9;tta;9;CDS;;CDS;;atg;;
CDS;;;atg;123;atg;123;;;;;;;
;;;;;;;;;;;;;
;CDS;431;;CDS;309;;CDS;142;;CDS;264;;
VI;16s;54;IV1;16s;196;;* * * *4aas;8;V2;16s;123;;
;gca;114;;23s;122;;gaa;5;;gca;152;;
;23s;193;;5s;5;;5s;40;;23s;50;;
;5s;5;;tta;13;;23s;112;;gga;12;;
;tta;9;;* * * * 42aas;10;;gca;109;;5s;109;;
;atg;123;;gta;162;X1;16s;138;;CDS;525;;
VII;16s;54;;CDS;25;;atg;13;I4;16s;196;;
;gca;114;;CDS;249;;* * * *21aas;13;;23s;144;;
;23s;193;I2;16s;196;;tta;5;;5s;228;;
;5s;5;;23s;78;;5s;213;;CDS;;;
;tta;9;;5s;402;;23s;196;;;;;
;atg;123;;CDS;348;IV2;16s;239;;;;;
VIII;16s;54;I3;16s;196;;CDS;;;;;;
;gca;114;;23s;78;;;;;;;;
;23s;78;;5s;180;;;;;;;;
;5s;100;;CDS;;;;;;;;;
;CDS;;;;;;;;;;;;

psor distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;avant 5s;atgi;3;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;3 gga;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;aca ;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;1;;;;;;;;;;1-3 aas;ttc;3;tcc;;tac;3;tgc;2
atc;;acc;;aac;;agc;1;;atc;;acc;1;aac;1;agc;;;;;;;;;;;2 tta;atc;1;acc;;aac;4;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;2 atgi;ctc;;ccc;;cac;2;cgt;1
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;1;ggc;;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;2
tta;;tca;;taa;;tga;1;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;3;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;2;aaa;2;aga;;;;;;;;;;;;ata;;aca;3;aaa;4;aga;4
cta;2;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;2;cca;4;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;;;;;;;;;;;;gta;5;gca;;gaa;4;gga;4
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;;;;;;;;;;atgj;3;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
psor;;5 *;;;;;5;;psor;12;;;;;;12;;;;;;;;;;;psor;;;4;72;;7;87
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4   1-3 aas;;;

cdc[modifier | modifier le wikicode]

cdc opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  10 ;83 aas;doubles;intercalaires;CDS;cds pbs;avec aa;cdsa;cdsd;protéines
Peptoclostridium difficile CD196;;;;;;;;;;;
dir    ;9857..10630;;cds;;179;179;774;;258;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;10810..12317;;16s;;52;;1508;;;;
dir    ;12370..12445;;gca;;249;;76;;;;
dir    ;12695..15596;;23s;;111;;2902;;;;
dir    ;15708..15824;;5s;;126;126;117;;;126;
dir    ;15951..16460;;cds;;;;510;;170;;transcription repressor NadR
;;;;;;;;;;;
dir   ;19402..19857;;cds;;0;0;456;;152;0;nucleoside deaminase
dir   ;19858..19949;;tcc;;37;;92;;;;
dir   ;19987..20251;;ncRNA;@1;76;76;265;;;;
dir   ;20328..21965;;cds;;;;1638;;546;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;23419..24624;;cds;;505;*505;1206;;402;;glycosyl transferase
dir    ;25130..26637;;16s;;279;;1508;;;;
dir    ;26917..29816;;23s;+;180;;2900;;;;
dir    ;29997..30113;;5s;3 aaa;6;;117;;;;
dir    ;30120..30194;;aac;3 gta;6;;75;6;;;
dir    ;30201..30286;;tta;;15;;86;15;;;
dir    ;30302..30377;;atgf;;7;;76;7;;;
dir    ;30385..30459;;gaa;;9;;75;9;;;
dir    ;30469..30542;;gga;;5;;74;5;;;
dir    ;30548..30623;;gta;;5;;76;5;;;
dir    ;30629..30705;;gac;;9;;77;9;;;
dir    ;30715..30789;;aca;;14;;75;14;;;
dir    ;30804..30888;;tac;;8;;85;8;;;
dir    ;30897..30980;;cta;;29;;84;29;;;
dir    ;31010..31086;;aga;;7;;77;7;;;
dir    ;31094..31169;;caa;;88;;76;88;;;
dir    ;31258..31346;;tca;;3;;89;3;;;
dir    ;31350..31425;;ttc;;6;;76;6;;;
dir    ;31432..31508;;atgj;;11;;77;11;;;
dir    ;31520..31596;;atgi;;23;;77;23;;;
dir    ;31620..31696;;cca;;7;;77;7;;;
dir    ;31704..31780;;cac;;8;;77;8;;;
dir    ;31789..31864;;aaa;;7;;76;7;;;
dir    ;31872..31945;;tgc;;6;;74;6;;;
dir    ;31952..32026;;aac;;5;;75;5;;;
dir    ;32032..32117;;tta;;15;;86;15;;;
dir    ;32133..32208;;atgf;;7;;76;7;;;
dir    ;32216..32290;;gaa;;9;;75;9;;;
dir    ;32300..32373;;gga;;5;;74;5;;;
dir    ;32379..32454;;gta;;5;;76;5;;;
dir    ;32460..32536;;gac;;9;;77;9;;;
dir    ;32546..32620;;aca;;14;;75;14;;;
dir    ;32635..32719;;tac;;9;;85;9;;;
dir    ;32729..32812;;cta;;23;;84;23;;;
dir    ;32836..32910;;ggc;;24;;75;24;;;
dir    ;32935..33011;;aga;;9;;77;9;;;
dir    ;33021..33096;;caa;;8;;76;8;;;
dir    ;33105..33180;;aaa;;2;;76;2;;;
dir    ;33183..33271;;tca;;3;;89;3;;;
dir    ;33275..33350;;ttc;;6;;76;6;;;
dir    ;33357..33433;;atgj;;11;;77;11;;;
dir    ;33445..33521;;atgi;;17;;77;17;;;
dir    ;33539..33615;;cac;;8;;77;8;;;
dir    ;33624..33699;;aaa;;7;;76;7;;;
dir    ;33707..33780;;tgc;;7;;74;7;;;
dir    ;33788..33864;;cgt;;12;;77;12;;;
dir    ;33877..33952;;gta;;75;75;76;;;75;
dir    ;34028..34441;;cds;;308;308;414;;138;;hp
dir    ;34750..38181;;cds;;;;3432;;1144;;pyruvate carboxylase
;;;;;;;;;;;
dir    ;127011..127715;;cds;;281;281;705;;235;;N-acetylmuramoyl-L-alanine amidase CwlD
dir    ;127997..129505;;16s;;279;;1509;;;;
dir    ;129785..132685;;23s;+;131;;2901;;;;
dir    ;132817..132933;;5s;2 cca;6;;117;;;;
dir    ;132940..133014;;aac;;4;;75;4;;;
dir    ;133019..133093;;gaa;;5;;75;5;;;
dir    ;133099..133174;;gta;;5;;76;5;;;
dir    ;133180..133256;;gac;;10;;77;10;;;
dir    ;133267..133341;;aca;;14;;75;14;;;
dir    ;133356..133440;;tac;;9;;85;9;;;
dir    ;133450..133523;;gga;;10;;74;10;;;
dir    ;133534..133610;;aga;;9;;77;9;;;
dir    ;133620..133695;;caa;;11;;76;11;;;
dir    ;133707..133782;;aaa;;2;;76;2;;;
dir    ;133785..133873;;tca;;17;;89;17;;;
dir    ;133891..133981;;agc;;8;;91;8;;;
dir    ;133990..134066;;cca;;85;;77;85;;;
dir    ;134152..134227;;tgg;;60;;76;60;;;
dir    ;134288..134364;;cca;;6;;77;6;;;
dir    ;134371..134447;;atc;;3;;77;3;;;
dir    ;134451..134526;;ttc;;7;;76;7;;;
dir    ;134534..134610;;atgj;;114;;77;;;;
dir    ;134725..136115;;16s;;68;;1391;;;;
dir    ;136184..136259;;gca;;271;;76;;;;
dir    ;136531..139430;;23s;;126;;2900;;;;
dir    ;139557..139673;;5s;;213;213;117;;;213;
comp;139887..141071;;cds;;372;*372;1185;;395;;pyridoxal phosphate-dependent aminotransferase
dir    ;141444..143795;;cds;;21;21;2352;;784;;anaerobic ribonucleoside triphosphate reductase
dir    ;143817..144356;;cds;;776;*776;540;;180;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;145133..146640;;16s;;52;;1508;;;;
dir    ;146693..146768;;gca;;373;;76;;;;
dir    ;147142..150041;;23s;;126;;2900;;;;
dir    ;150168..150284;;5s;;7;;117;7;;;
dir    ;150292..150366;;aac;;5;;75;5;;;
dir    ;150372..150457;;tta;;15;;86;15;;;
dir    ;150473..150548;;atgf;;7;;76;7;;;
dir    ;150556..150630;;gaa;;14;;75;14;;;
dir    ;150645..150718;;gga;;5;;74;5;;;
dir    ;150724..150799;;gta;;5;;76;5;;;
dir    ;150805..150881;;gac;;10;;77;10;;;
dir    ;150892..150966;;ggc;;9;;75;9;;;
dir    ;150976..151049;;aga;;975;*975;74;;;;
dir    ;152025..152864;;cds;;;;840;;280;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;378341..380728;;cds;;583;*583;2388;;796;;cadmium-translocating P-type ATPase
dir   ;381312..382819;;16s;;311;;1508;;;;
dir   ;383131..386030;;23s;;126;;2900;;;;
dir   ;386157..386273;;5s;;177;177;117;;;177;
dir   ;386451..387059;;cds;;;;609;;203;;DedA family protein
;;;;;;;;;;;
comp;833130..833894;;cds;;258;258;765;;255;;DeoR/GlpR transcriptional regulator
dir    ;834153..834243;;agc;;87;87;91;;;87;
dir    ;834331..835119;;cds;;;;789;;263;;flagellar motor protein
;;;;;;;;;;;
dir    ;1089165..1090139;;cds;;239;239;975;;325;239;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1090379..1091886;;16s;;320;;1508;;;;
dir    ;1092207..1095106;;23s;;91;;2900;;;;
dir    ;1095198..1095271;;gga;@2;8;;74;;;;
dir    ;1095280..1095396;;5s;;273;273;117;;;;
dir    ;1095670..1097688;;cds;;;;2019;;673;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1181549..1182958;;cds;;1374;*1374;1410;;470;;MBOAT family protein
comp;1184333..1184415;;ttg;;318;318;83;;;318;
dir    ;1184734..1187382;;cds;;;;2649;;883;;DNA polymerase I
;;;;;;;;;;;
dir   ;1835768..1837498;;cds;;109;109;1731;;577;109;Na+/H+ antiporter NhaC family protein
dir   ;1837608..1837688;;cta;;231;231;81;;;;
<dir   ;1837920..1838093;;cds;;;;174;;58;;HXXEE domain-containing protein
;;;;;;;;;;;
dir   ;2981767..2982444;;cds;;159;159;678;;226;159;sortase SrtB
comp;2982604..2982678;;aca;@3;94;;75;;;;
comp;2982773..2985672;;23s;;184;;2900;;;;
comp;2985857..2987364;;16s;;340;340;1508;;;;
dir   ;2987705..2988643;;cds;;;;939;;313;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
comp;3787361..3788431;;cds;;454;*454;1071;;357;;ABC transporter ATP-binding protein
comp;3788886..3789002;;5s;;126;;117;;;;
comp;3789129..3792028;;23s;;281;;2900;;;;
comp;3792310..3793817;;16s;;191;191;1508;;;191;
comp;3794009..3794587;;cds;;;;579;;193;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;3944262..3944453;;cds;;119;119;192;;64;119;DUF378 domain-containing protein
comp;3944573..3944689;;5s;;126;;117;;;;
comp;3944816..3947715;;23s;;217;;2900;;;;
comp;3947933..3949440;;16s;;282;282;1508;;;;
comp;3949723..3950004;;cds;;221;221;282;;94;;hp
comp;3950226..3951755;;cds;;;;1530;;510;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4084445..4085437;;cds;;382;*382;993;;331;;DNA replication protein DnaC
comp;4085820..4085894;;aca;;33;;75;;;;
comp;4085928..4086003;;gta;;4;;76;;;;
comp;4086008..4086082;;gaa;;6;;75;;;;
comp;4086089..4086164;;aaa;;326;326;76;;;326;
comp;4086491..4087780;;cds;;;;1290;;430;;adenylosuccinate synthase

cdc cumuls[modifier | modifier le wikicode]

cdc cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;;0;1;1;1;1;100;3
;16 23 5s 0;3;20;2;61;50;1;20;0;200;5
;16 gca 235;3;40;1;4;100;3;40;0;300;7
;16 23 5s a;2;60;;1;150;3;60;0;400;5
;max a;43;80;;0;200;4;80;1;500;3
;a doubles;2;100;;2;250;4;100;1;600;3
;autres;2;120;;0;300;4;120;2;700;1
;total aas;75;140;;0;350;4;140;1;800;2
sans ;opérons;5;160;;0;400;2;160;1;900;1
;1 aa;4;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;1;200;1;1100;0
;a doubles;0;;;0;;5;;4;;1
;total aas;8;;3;68;;32;;13;;31
total aas;;83;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;14;12;;313;;165;;378
;;;variance;;15;;283;;94;;259
sans jaune;;;moyenne;;9;;206;;;;286
;;;variance;;5;;107;;;;144

cdc blocs[modifier | modifier le wikicode]

7.11.19 Tanger;;;;;;;;;;;;;;
cdc blocs;groupes;;types;;;;absents;;;;;;;
;cds;281;I;;;;;II;;III;;IV;IV1;IV2
IV2;16s;279;;;;;;;;;;;;
;23s;131;CDS;583;454;119;;cds;239;;;;;
;5s;6;16s;311;126;126;;16s;320;cds;159;cds;505;281
;aac;4;23s;126;281;217;;23s;91;aca;94;16s;279;279
;**16aas;3;5s;177;191;282;;gga;8;23s;184;23s;180;131
;ttc;7;CDS;;;;;5s;273;16s;340;5s;6;6
;atgj;114;;;;;;cds;;cds;;aac;6;4
VIII1;16s;68;;;;;;;;;;;;
;gca;271;;;;;;V;;V2;VI;VI1;VII;VII1
;23s;126;;;;;;;;;;;;
;5s;213;;;;;;;;;;;;
;cds;372;;;;;;;;;;;;
;cds;21;;;;;;VIII;VIII1;IX;;X;X1;
;cds;776;;;;;;;;;;cds;21;
X1;16s;52;;;;;;atgj;114;cds;179;cds;776;
;gca;373;;;;;;16s;68;16s;52;16s;52;
;23s;126;;;;;;gca;271;gca;249;gca;373;
;5s;7;;;;;;23s;126;23s;111;23s;126;
;aac;5;;;;;;5s;213;5s;126;5s;7;
;**7aas;9;;;;;;cds;372;cds;;aac;5;
;aga;975;;;;;;;;;;;;
;cds;;;;;;;;;;;;;

cdc distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;;;;;;;;;avant 5s;atgi;2;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;gga 1;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;aca 1;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;;;;;;;;;;ttc;3;tcc;;tac;3;tgc;2
atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;;;;;;;;;;;;atc;1;acc;2;aac;2;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;2;cgt;1
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;;;;;;;;;;;;gtc;;gcc;;gac;4;ggc;2
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;3;tca;3;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;;;;;;;;;;;;ata;;aca;3;aaa;4;aga;4
cta;1;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;2;cca;3;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;1;gga;;;;;;;;;;;;gta;5;gca;;gaa;4;gga;4
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;;;;;;;;;;atgj;3;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cdc;;4 *;;;;;4;;cdc;4;;;;;;4;;;;;;;;;;;cdc;;;2 *;70;;3;75

cdc psor[modifier | modifier le wikicode]

cdc-psor  comparaison;;7.11.19 Tanger;;;comparaisons internes cdc, psor;;;;
cdc;intercal;psor;intercal;diff;cdc;intercal;cdc;intercal;diff
cds;505;CDS;309;;cds;505;cds;281;
16s;279;16s;196;;16s;279;16s;279;
23s;180;23s;122;;23s;180;23s;131;
5s;6;5s;5;;5s;6;5s;6;
aac;6;tta;13;;aac;6;aac;4;
tta;15;atg;15;-2;tta;15;gaa;5;
atgf;7;gaa;9;8;atgf;7;gta;5;
gaa;9;gga;6;0;gaa;9;gac;10;
gga;5;gta;5;1;gga;5;aca;14;
gta;5;gac;16;;gta;5;tac;9;0
gac;9;aac;4;;gac;9;gga;10;1
aca;14;aca;4;-10;aca;14;aga;9;0
tac;8;tac;15;7;tac;8;caa;11;
cta;29;cta;14;-15;cta;29;aaa;2;
aga;7;aga;7;0;aga;7;tca;17;2
caa;88;caa;11;;caa;88;agc;8;
tca;3;aaa;6;;tca;3;cca;85;
ttc;6;tca;3;0;ttc;6;tgg;60;
atgj;11;ttc;9;3;atgj;11;cca;6;
atgi;23;atg;8;-3;atgi;23;atc;3;
cca;7;atg;21;-2;cca;7;ttc;7;
cac;8;cca;6;-1;cac;8;atgj;114;
aaa;7;cac;4;;aaa;7;16s;;
tgc;6;tgc;25;;tgc;6;cds;776;
aac;5;tta;13;-2;aac;5;16s;52;
tta;15;atg;15;8;tta;15;gca;373;
atgf;7;gaa;9;0;atgf;7;23s;126;
gaa;9;gga;6;1;gaa;9;5s;7;
gga;5;gta;5;0;gga;5;aac;5;
gta;5;gac;16;;gta;5;tta;15;0
gac;9;aac;4;;gac;9;atgf;7;1
aca;14;aca;4;-10;aca;14;gaa;14;0
tac;9;tac;15;6;tac;9;gga;5;
cta;23;cta;11;-12;cta;23;gta;5;
ggc;24;ggc;13;-11;ggc;24;gac;10;
aga;9;aga;7;-2;aga;9;ggc;9;0
caa;8;caa;11;3;caa;8;aga;975;3
aaa;2;aaa;6;4;aaa;2;cds;;0
tca;3;tca;3;0;tca;3;;;
ttc;6;ttc;9;3;ttc;6;;;
atgj;11;atg;8;-3;atgj;11;;;
atgi;17;atg;21;;atgi;17;;;
cac;8;cca;6;;cac;8;;;
aaa;7;cac;9;1;aaa;7;;;
tgc;7;aaa;21;14;tgc;7;;;
cgt;12;tgc;6;-1;cgt;12;;;
gta;75;cgt;10;-2;gta;75;;;
cds;;gta;162;;cds;;;;
;;CDS;;;;;;;
;;;;;psor;;psor;intercal;diff
cds;776;;;;CDS;309;CDS;239;
16s;52;;;;16s;196;16s;196;
gca;373;;;;23s;122;23s;213;
23s;126;;;;5s;5;5s;5;
5s;7;atg;138;;tta;13;tta;13;0
aac;5;16s;109;;atg;15;atg;15;0
tta;15;gca;112;;gaa;9;gaa;9;0
atgf;7;23s;40;;gga;6;gga;6;0
gaa;14;5s;5;;gta;5;gta;5;0
gga;5;gaa;8;;gac;16;gac;16;0
gta;5;gta;5;0;aac;4;aac;31;
gac;10;gac;9;-1;aca;4;aac;4;
ggc;9;ggc;7;-2;tac;15;aca;4;0
aga;975;aga;142;;cta;14;tac;11;-4
cds;;CDS;;;aga;7;gga;19;5
;;;;;caa;11;aga;6;-1
cds;281;CDS;239;;aaa;6;caa;12;1
16s;279;16s;196;;tca;3;aaa;6;0
23s;131;23s;213;;ttc;9;tca;11;
5s;6;5s;5;;atg;8;agc;6;
aac;4;tta;13;;atg;21;cca;6;
gaa;5;atg;15;;cca;6;atg;11;
gta;5;gaa;9;;cac;4;tgg;31;
gac;10;gga;6;;tgc;25;cca;6;
aca;14;gta;5;;tta;13;atc;6;0
tac;9;gac;16;;atg;15;ttc;13;0
gga;10;aac;31;;gaa;9;atg;138;0
aga;9;aac;4;;gga;6;16s;;0
caa;11;aca;4;-10;gta;5;atg;138;0
aaa;2;tac;11;2;gac;16;16s;109;0
tca;17;gga;19;9;aac;4;gca;112;
agc;8;aga;6;-3;aca;4;23s;40;0
cca;85;caa;12;1;tac;15;5s;5;
tgg;60;aaa;6;4;cta;11;gaa;8;
cca;6;tca;11;-6;ggc;13;gta;5;
atc;3;agc;6;-2;aga;7;gac;9;-1
ttc;7;cca;6;;caa;11;ggc;7;1
atgj;114;atg;11;;aaa;6;aga;142;0
16s;;tgg;31;-29;tca;3;CDS;;
;;cca;6;0;ttc;9;;;
;;atc;6;3;atg;8;;;
;;ttc;13;6;atg;21;;;
;;atg;138;;cca;6;;;
;;16s;;;cac;9;;;
;;;;;aaa;21;;;
;;CDS;129;;tgc;6;;;
;;gta;8;;cgt;10;;;
;;gaa;20;;gta;162;;;
;;aaa;10;;CDS;;;;
cds;382;aca;10;;;;;;
aca;33;gac;7;;;;;;
gta;4;gta;9;5;;;;;
gaa;6;gaa;5;-1;;;;;
aaa;326;aaa;289;;;;;;
cds;;CDS;;;;;;;
;;;;;;;;;
cdc-psor  coservation des cds;;;;;fréquence des diff psor-cdc des intercalaires;;;;
cdc;intercal;psor;intercal;protéines;;gamme;fréquence;;
cds;0;CDS;3;151 – 152;;-15;2;;
tcc;37;tcc;27;;;-14;;;
ncRNA;76;ncRNA;152;547 – 546;;-13;;;
cds;;CDS;;;;-12;1;;
;;;;;;-11;1;;
cds;1374;CDS;41;470 – 1177;;-10;3;;
ttg;318;ttg;138;883 – 881;;-9;;;
cds;;CDS;;;;-8;;;
;;;;;;-7;;;
cds;109;CDS;111;577 – 1076;;-6;1;;
cta;231;cta;426;;;-5;;;
cds;;CDS;;58 – 577;;-4;;;
;;;;;;-3;3;;
cds;258;CDS;37;255 – 302;;-2;7;;
agc;87;agc;120;;;-1;4;;
cds;;CDS;;263 – 100;;0;8;;
;;;;;;1;4;;
;;CDS;306;62;;2;1;;
;;cta;404;422;;3;4;;
;;CDS;;;;4;2;;
;;;;;;5;1;;
;;CDS;135;;;6;2;;
;;other;258;;;7;1;;
;;CDS;;;;8;2;;
;;;;;;9;1;;
;;CDS;195;;;10;;;
;;tga;37;;;11;;;
;;CDS;;;;12;;;
;;;;;;13;;;
;;CDS;71;;;14;1;;
;;tgc;12;;;15;;;
;;aac;3;;;;;;
;;aca;285;;;total;49;;
;;CDS;;;;sous t.  -2+2;24;;

cdc8[modifier | modifier le wikicode]

cdc8 opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  16 ;110 aas;doubles;intercalaires;CDS;aa;avec aa;pbs;CDS dirigé;protéines
Peptoclostridium difficile M68;;;;;;;;;;;
dir   ;4299490..4300134;;cds;;214;214;;;645;;tyrosine-type recombinase/integrase
dir   ;4300349..4300807;;cds;@1;554;*554;;;459;;helix-turn-helix domain-containing protein
dir   ;4301362..4303101;;cds;;0;0;;;*1740;;hypothetical protein
dir   ;4303102..4303305;;cds;;167;167;;;204;;hp
dir   ;4303473..4304299;;23s°;;132;;;;827;;
dir   ;4304432..4304548;;5s;+;6;;;;117;;
dir   ;4304555..4304629;;aac;;4;;;4;75;;
dir   ;4304634..4304708;;gaa;2 cca;5;;;5;75;;
dir   ;4304714..4304789;;gta;;5;;;5;76;;
dir   ;4304795..4304871;;gac;;11;;;11;77;;
dir   ;4304883..4304957;;aca;;14;;;14;75;;
dir   ;4304972..4305056;;tac;;9;;;9;85;;
dir   ;4305066..4305139;;gga;;10;;;10;74;;
dir   ;4305150..4305226;;aga;;9;;;9;77;;
dir   ;4305236..4305311;;caa;;11;;;11;76;;
dir   ;4305323..4305398;;aaa;;2;;;2;76;;
dir   ;4305401..4305489;;tca;;18;;;18;89;;
dir   ;4305508..4305598;;agc;;8;;;8;91;;
dir   ;4305607..4305683;;cca;;85;;;*85;77;;
dir   ;4305769..4305844;;tgg;;60;;;*60;76;;
dir   ;4305905..4305981;;cca;;5;;;5;77;;
dir   ;4305987..4306063;;atc;;3;;;3;77;;
dir   ;4306067..4306142;;ttc;;7;;;7;76;;
dir   ;4306150..4306226;;atgj;;114;;;;77;;
dir   ;4306341..4307538;;16s;;0;0;;;1198;0;
dir   ;4307539..4308225;;cds;;100;100;;;687;;xylose isomerase
dir   ;1..796;4308325;23s°;;181;;;;796;;
dir   ;978..1094;;5s;;6;;;;117;;
dir   ;1101..1175;;aac;+;6;;;6;75;;
dir   ;1182..1267;;tta;3 aaa;15;;;15;86;;
dir   ;1283..1358;;atgf;3 gta;7;;;7;76;;
dir   ;1366..1440;;gaa;;9;;;9;75;;
dir   ;1450..1523;;gga;;5;;;5;74;;
dir   ;1529..1604;;gta;;5;;;5;76;;
dir   ;1610..1686;;gac;;9;;;9;77;;
dir   ;1696..1770;;aca;;14;;;14;75;;
dir   ;1785..1869;;tac;;10;;;10;85;;
dir   ;1880..1963;;cta;;28;;;28;84;;
dir   ;1992..2068;;aga;;7;;;7;77;;
dir   ;2076..2151;;caa;;89;;;*89;76;;
dir   ;2241..2329;;tca;;3;;;3;89;;
dir   ;2333..2408;;ttc;;6;;;6;76;;
dir   ;2415..2491;;atgj;;11;;;11;77;;
dir   ;2503..2579;;atgi;;29;;;29;77;;
dir   ;2609..2685;;cca;;7;;;7;77;;
dir   ;2693..2769;;cac;;8;;;8;77;;
dir   ;2778..2853;;aaa;;7;;;7;76;;
dir   ;2861..2934;;tgc;;6;;;6;74;;
dir   ;2941..3015;;aac;;6;;;6;75;;
dir   ;3022..3107;;tta;;15;;;15;86;;
dir   ;3123..3198;;atgf;;7;;;7;76;;
dir   ;3206..3280;;gaa;;9;;;9;75;;
dir   ;3290..3363;;gga;;5;;;5;74;;
dir   ;3369..3444;;gta;;5;;;5;76;;
dir   ;3450..3526;;gac;;9;;;9;77;;
dir   ;3536..3610;;aca;;14;;;14;75;;
dir   ;3625..3709;;tac;;9;;;9;85;;
dir   ;3719..3802;;cta;;24;;;24;84;;
dir   ;3827..3901;;ggc;;24;;;24;75;;
dir   ;3926..4002;;aga;;9;;;9;77;;
dir   ;4012..4087;;caa;;8;;;8;76;;
dir   ;4096..4171;;aaa;;2;;;2;76;;
dir   ;4174..4262;;tca;;3;;;3;89;;
dir   ;4266..4341;;ttc;;6;;;6;76;;
dir   ;4348..4424;;atgj;;11;;;11;77;;
dir   ;4436..4512;;atgi;;17;;;17;77;;
dir   ;4530..4606;;cac;;8;;;8;77;;
dir   ;4615..4690;;aaa;;7;;;7;76;;
dir   ;4698..4771;;tgc;;7;;;7;74;;
dir   ;4779..4855;;cgt;;12;;;12;77;;
dir   ;4868..4943;;gta;;75;75;;;76;75;
dir   ;5019..5432;;cds;;308;308;;;414;;hp
dir   ;5741..9172;;cds;;;;;;*3432;;pyruvate carboxylase
;;;;;;;;;;;
dir   ;94032..94736;;cds;;281;281;;;705;281;N-acetylmuramoyl-L-alanine amidase CwlD
dir   ;95018..95994;;16s°;;100;;;;977;;
dir   ;96095..97613;;23s°;;126;;;;1519;;
dir   ;97740..97856;;5s;;7;;;;117;;
dir   ;97864..97938;;aac;;6;;;6;75;;
dir   ;97945..98030;;tta;;15;;;15;86;;
dir   ;98046..98121;;atgf;;7;;;7;76;;
dir   ;98129..98203;;gaa;;8;;;8;75;;
dir   ;98212..98285;;gga;;4;;;4;74;;
dir   ;98290..98365;;gta;;5;;;5;76;;
dir   ;98371..98447;;gac;;10;;;10;77;;
dir   ;98458..98532;;ggc;;9;;;9;75;;
dir   ;98542..98615;;aga;;954;*954;;;74;;
dir   ;99570..100409;;cds;;;;;;840;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;306829..309216;;cds;;733;;;;*2388;;cadmium-translocating P-type ATPase
<> comp;309950..310076;;cds;;1;1;;;127;1;glycine/sarcosine/betaine reductase complex  selenoprotein A
dir   ;310078..311313;;23s°;;126;;;;1236;;
dir   ;311440..311556;;5s;;177;177;;;117;;
dir   ;311734..312342;;cds;;;;;;609;;DedA family protein
;;;;;;;;;;;
comp;861856..862620;;cds;;258;258;;;765;;DeoR/GlpR transcriptional regulator
dir   ;862879..862969;;agc;;87;87;;;91;87;
dir   ;863057..863845;;cds;;;;;;789;;flagellar motor protein
;;;;;;;;;;;
dir    ;1106477..1107451;;cds;;238;238;;;975;238;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1107690..1109197;;16s;@2;320;;;;1508;;
dir    ;1109518..1112416;;23s;;91;;;;2899;;
dir    ;1112508..1112581;;gga;;8;;;;74;;
dir    ;1112590..1112706;;5s;;273;273;;;117;;
dir    ;1112980..1114998;;cds;;;;;;*2019;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1196804..1198213;;cds;;1378;*1378;;;*1410;;MBOAT family protein
comp;1199592..1199674;;ttg;;318;318;;;83;318;
dir    ;1199993..1202641;;cds;;;;;;*2649;;DNA polymerase I
;;;;;;;;;;;
dir    ;1850896..1852626;;cds;;109;109;;;*1731;109;Na+/H+ antiporter NhaC family protein
dir    ;1852736..1852816;;cta;;334;334;;;81;;
dir    ;1853151..1853666;;cds;;;;;;516;;HXXEE domain-containing protein
;;;;;;;;;;;
dir    ;3024038..3024715;;cds;;150;150;;;678;150;sortase SrtB
comp;3024866..3024940;;aca;@3;93;;;;75;;
comp;3025034..3027933;;23s;;184;;;;2900;;
comp;3028118..3029625;;16s;;374;374;;;1508;;
dir    ;3030000..3030938;;cds;;;;;;939;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
dir    ;3805298..3806743;;cds;;208;208;;;*1446;;tyrosine-type recombinase/integrase
comp;3806952..3807028;;agg;;61;61;;;77;61;
<comp;3807090..3808790;;cds;;;;;;*1701;;formate dehydrogenase subunit alpha
;;;;;;;;;;;
comp;3875816..3876886;;cds;;452;*452;;;1071;;ABC transporter ATP-binding protein
comp;3877339..3877455;;5s;;125;;;;117;;
comp;3877581..3880480;;23s;;261;;;;2900;;
comp;3880742..3882249;;16s;;190;190;;;1508;190;
comp;3882440..3883018;;cds;;;;;;579;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;4017523..4017714;;cds;;118;118;;;192;118;DUF378 domain-containing protein
comp;4017833..4017949;;5s;;126;;;;117;;
comp;4018076..4020975;;23s;;321;;;;2900;;
comp;4021297..4022804;;16s;;292;292;;;1508;;
comp;4023097..4023378;;cds;;221;221;;;282;;hp
comp;4023600..4025129;;cds;;;;;;*1530;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4135881..4136873;;cds;;383;383;;;993;;DNA replication protein DnaC
comp;4137257..4137331;;aca;;33;;33;;75;;
comp;4137365..4137440;;gta;;4;;4;;76;;
comp;4137445..4137519;;gaa;;6;;6;;75;;
comp;4137526..4137601;;aaa;;331;331;;;76;331;
comp;4137933..4139222;;cds;;;;;;*1290;;adenylosuccinate synthase
;;;;;;;;;;;
dir    ;4178197..4178970;;cds;;179;179;;;774;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;4179150..4180587;;16s;;161;;;;1438;;
comp;4180749..4180865;;5s;;201;;;;117;;
comp;4181067..4183959;;23s;;217;;;;2893;;
comp;4184177..4185684;;16s;;108;;;;1508;;
comp;4185793..4185869;;atgi;;11;;;11;77;;
comp;4185881..4185969;;tta;;5;;;;89;;
comp;4185975..4186091;;5s;;201;;;;117;;
comp;4186293..4189192;;23s;;375;;;;2900;;
comp;4189568..4189643;;gca;;52;;;;76;;
comp;4189696..4190959;;16s’;@4;100;;;;1264;;
dir    ;4191060..4192225;;16s’;;52;;;;1166;;
dir    ;4192278..4192353;;gca;;248;;;;76;;
dir    ;4192602..4193197;;23s°;;100;;;;596;;
dir    ;4193298..4193874;;16s°;;321;;;;577;;
dir    ;4194196..4196423;;23s’;;100;;;;2228;;
dir    ;4196524..4197091;;16s°;;320;;;;568;;
dir    ;4197412..4199044;;23s°;;100;;;;1633;;
dir    ;4199145..4201593;;23s’;;126;;;;2449;;
dir    ;4201720..4201836;;5s;;127;127;;;117;127;
dir    ;4201964..4202473;;cds;;;;;;510;;transcription repressor NadR
;;;;;;;;;;;
dir    ;4205417..4205872;;cds;;0;0;;;456;0;nucleoside deaminase
dir    ;4205873..4205964;;tcc;@5;37;;;;92;;
dir    ;4206002..4206266;;ncRNA;;76;76;;;265;;
dir    ;4206343..4207980;;cds;;;;;;*1638;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;4209435..4210639;;cds;;496;*496;;;1205;;glycosyl transferase
;4211136..4212643;;16s;;321;;;;1508;;
;4212965..4213127;;23s°;;100;100;;;163;100;
<>comp;4213228..4213849;;cds;;111;;;;622;;CHAP domain-containing protein
;;;;;;;;;;;
comp;4213961..4214620;;cds;;228;228;;;660;228;type A-1 chloramphenicol O-acetyltransferase
dir    ;4214849..4216199;;16s;;321;;;;1351;;
dir    ;4216521..4217008;;23s°;;101;;;;488;;
comp;4217110..4218529;;23s°;;250;;;;1420;;
comp;4218780..4218855;;gca;;52;;;;76;;
comp;4218908..4219471;;16s°;;100;;;;564;;
comp;4219572..4219856;;23s°;;217;;;;285;;
comp;4220074..4221581;;16s;;179;179;;;1508;179;
>comp;4221761..4222206;;cds;;386;386;;;446;386;B/F/G family RNA polymerase sigma-70 factor
dir    ;4222593..4224100;;16s;;321;;;;1508;;
dir    ;4224422..4227321;;23s;;181;;;;2900;;
dir    ;4227503..4227619;;5s;;6;;;;117;;
dir    ;4227626..4227700;;aac;;6;;;6;75;;
dir    ;4227707..4227792;;tta;;15;;;15;86;;
dir    ;4227808..4227883;;atgf;;7;;;7;76;;
dir    ;4227891..4227965;;gaa;;9;;;9;75;;
dir    ;4227975..4228048;;gga;;5;;;5;74;;
dir    ;4228054..4228129;;gta;;5;;;5;76;;
dir    ;4228135..4228211;;gac;;9;;;9;77;;
dir    ;4228221..4228295;;aca;;14;;;14;75;;
dir    ;4228310..4228394;;tac;;10;;;10;85;;
dir    ;4228405..4228488;;cta;;28;;;28;84;;
dir    ;4228517..4228593;;aga;;7;;;7;77;;
dir    ;4228601..4228676;;caa;;89;;;*89;76;;
dir    ;4228766..4228854;;tca;;3;;;3;89;;
dir    ;4228858..4228933;;ttc;;6;;;6;76;;
dir    ;4228940..4229016;;atgj;;11;;;11;77;;
dir    ;4229028..4229104;;atgi;;29;;;29;77;;
dir    ;4229134..4229210;;cca;;7;;;7;77;;
dir    ;4229218..4229294;;cac;;8;;;8;77;;
dir    ;4229303..4229378;;aaa;;353;;;;76;;
comp;4229732..4229848;;5s;;126;;;;117;;
comp;4229975..4232010;;23s’;;582;;;;2036;;
dir    ;4232593..4234098;;16s;@6;217;;;;1506;;
dir    ;4234316..4237215;;23s;;126;;;;2900;;
dir    ;4237342..4237458;;5s;;216;216;;;117;216;
comp;4237675..4238859;;cds;;372;372;;;1185;;pyridoxal phosphate-dependent aminotransferase
dir    ;4239232..4241583;;cds;;21;21;;;*2352;;anaerobic ribonucleoside triphosphate reductase
dir    ;4241605..4242144;;cds;;778;*778;;;540;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;4242923..4244459;;16s;@7;261;;;;1537;;
dir    ;4244721..4247619;;23s;;201;;;;2899;;
dir    ;4247821..4247937;;5s;;5;;;;117;;
dir    ;4247943..4248031;;tta;;11;;;11;89;;
dir    ;4248043..4248119;;atgi;;108;;;;77;;
dir    ;4248228..4249735;;16s;;184;;;;1508;;
dir    ;4249920..4250564;;23s°;;100;100;;;645;100;
<dir    ;4250665..4250923;;cds;;112;112;;;259;112;hp
comp;4251036..4253145;;23s’;;375;;;;2110;;
comp;4253521..4253596;;gca;;52;;;;76;;
comp;4253649..4254226;;16s°;;282;282;;;578;;
dir    ;4254509..4254712;;cds;;12;12;;;204;;hp
dir    ;4254725..4256002;;cds;;;;;;*1278;;phage portal protein

cdc8 cumuls[modifier | modifier le wikicode]

cdc8 cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;21;1;;0;1;4;1;3;100;6
;16 23 5s 0;4;20;2;77;50;2;20;0;200;8
;16 gca 235;2;40;1;6;100;7;40;0;300;11
;16 23 5s a;5;60;;0;150;5;60;0;400;5
;max a;43;80;;1;200;5;80;2;500;5
;a doubles;2;100;;3;250;6;100;3;600;5
;autres;10;120;;0;300;5;120;3;700;1
;total aas;98;140;;0;350;4;140;1;800;1
sans ;opérons;6;160;;0;400;4;160;1;900;1
;1 aa;5;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;2;200;1;1100;0
;a doubles;0;;;0;;4;;7;;1
;total aas;9;;3;87;;48;;22;;44
total aas;;108;;;;;;;;;
remarques;;7;;;;;;;;;
avec jaune;;;moyenne;14;14;;256;;155;;330
;;;variance;;16;;252;;109;;234
sans jaune;;;moyenne;;10;;182;;;;208
;;;variance;;6;;117;;;;97

cdc8 blocs[modifier | modifier le wikicode]

cdc8 blocs;;;;;;;;
Bloc type;groupes;intercal;Bloc type;groupes;intercal;Bloc type;groupe;intercal
;cds;554;;cds;150;;cds;496
;cds;0;;aca;93;;16s;321
;cds;168;;23s;184;;23s°;100
;23s°;133;III;16s;374;;cds;111
IV2;5s;7;;cds;;;cds;228
;aac;5;;;;;16s;321
;**16aas;8;;cds;452;;23s°;101
;atgj;115;;5s;125;;23s°;250
IV1;16s;1;;23s;261;;gca;52
;cds;100;I2;16s;190;;16s°;100
;23s°;182;;cds;;;23s°;217
;5s;7;;;;;16s;179
;aac;7;;cds;118;;cds;386
;**41aas;13;;5s;126;IV3;16s;321
;gta;76;;23s;321;;23s;181
;cds;308;I3;16s;292;;5s;6
;cds;;;cds;;;aac;6
;;;;;;;**17aas;8
;cds;281;;cds;179;;aaa;353
;16s°;100;;16s;161;;5s;126
;23s°;126;;5s;201;;23s;582
X1;5s;7;I1;23s;217;I4;16s;217
;aac;6;;16s;108;;23s;126
;**7aas;9;;atgi;11;;5s;216
;aga;954;;tta;5;;cds;372
;cds;;;5s;201;;cds;21
;;;;23s;375;;cds;778
;cds;733;VII1;gca;52;IV4;16s;261
;cds;1;;16s’;100;;23s;201
;23s°;126;;16s’;52;;5s;5
;5s;177;;gca;248;;tta;11
;cds;;;23s°;100;;atgi;108
;;;;16s°;321;;16s;184
;cds;238;;23s;100;;23s°;100
II;16s;320;;16s°;320;;cds;112
;23s;91;;23s°;100;;23s’;375
;gga;8;;23s’;126;;gca;52
;5s;273;;5s;127;;16s°;282
;cds;;;cds;;;cds;

cdc8 cdc psor 43[modifier | modifier le wikicode]

cdc8;43aas;cdc;43aas;;;cdc8;43aas;psor;44aas;
16s;1;;;;;16s;1;;;
cds;100;16s;279;;;cds;100;16s;196;
23s°;181;23s;180;-1;;23s°;181;23s;122;
5s;6;5s;6;0;;5s;6;5s;5;
aac;6;aac;6;0;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;10;tac;8;-2;;tac;10;tac;15;5
cta;28;cta;29;1;;cta;28;cta;14;-14
aga;7;aga;7;0;;aga;7;aga;7;0
caa;89;caa;88;-1;;caa;89;caa;11;
tca;3;tca;3;0;;tca;3;aaa;6;
ttc;6;ttc;6;0;;ttc;6;tca;3;0
atgj;11;atgj;11;0;;atgj;11;ttc;9;3
atgi;29;atgi;23;-6;;atgi;29;atg;8;-3
cca;7;cca;7;0;;cca;7;atg;21;-8
cac;8;cac;8;0;;cac;8;cca;6;-1
aaa;7;aaa;7;0;;aaa;7;cac;4;
tgc;6;tgc;6;0;;tgc;6;tgc;25;
aac;6;aac;5;-1;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;9;tac;9;0;;tac;9;tac;15;6
cta;24;cta;23;-1;;cta;24;cta;11;-13
ggc;24;ggc;24;0;;ggc;24;ggc;13;-11
aga;9;aga;9;0;;aga;9;aga;7;-2
caa;8;caa;8;0;;caa;8;caa;11;3
aaa;2;aaa;2;0;;aaa;2;aaa;6;4
tca;3;tca;3;0;;tca;3;tca;3;0
ttc;6;ttc;6;0;;ttc;6;ttc;9;3
atgj;11;atgj;11;0;;atgj;11;atg;8;-3
atgi;17;atgi;17;0;;atgi;17;atg;21;
cac;8;cac;8;0;;cac;8;cca;6;
aaa;7;aaa;7;0;;aaa;7;cac;9;1
tgc;7;tgc;7;0;;tgc;7;aaa;21;14
cgt;12;cgt;12;0;;cgt;12;tgc;6;-1
gta;75;gta;75;0;;gta;75;cgt;10;-2
cds;;cds;;;;cds;;gta;162;
;;;;;;;;cds;;

cdc8 cdc psor 18[modifier | modifier le wikicode]

cdc8;18aas;;;;;cdc8;19aas;psor;23aas;
cds;214;;;;;16s;321;16s;196;
cds;554;;;;;23s;181;23s;213;
cds;0;cdc;18aas;;;5s;6;5s;5;
cds;167;16s;279;;;aac;6;tta;13;-2
23s°;132;23s;131;-1;;tta;15;atg;15;8
5s;6;5s;6;0;;atgf;7;gaa;9;0
aac;4;aac;4;0;;gaa;9;gga;6;1
gaa;5;gaa;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;11;gac;10;-1;;gac;9;aac;31;
aca;14;aca;14;0;;aca;14;aac;4;
tac;9;tac;9;0;;tac;10;aca;4;-10
gga;10;gga;10;0;;cta;28;tac;11;
aga;9;aga;9;0;;aga;7;gga;19;
caa;11;caa;11;0;;caa;89;aga;6;-1
aaa;2;aaa;2;0;;tca;3;caa;12;
tca;18;tca;17;-1;;ttc;6;aaa;6;
agc;8;agc;8;0;;atgj;11;tca;11;
cca;85;cca;85;0;;atgi;29;agc;6;
tgg;60;tgg;60;0;;cca;7;cca;6;
cca;5;cca;6;1;;cac;8;atg;11;
atc;3;atc;3;0;;aaa;353;tgg;31;
ttc;7;ttc;7;0;;;;cca;6;
atgj;114;atgj;114;0;;;;atc;6;
;;;;;;;;ttc;13;
;;psor;23aas;;;;;atg;138;
;;16s;196;;;;;;;
cdc8;18aas;23s;213;;;;;cdc8;18aas;
cds;214;5s;5;;;;;cds;214;
cds;554;tta;13;;;;;cds;554;
cds;0;atg;15;;;cdc8;19aas;cds;0;
cds;167;gaa;9;;;16s;321;cds;167;
23s°;132;gga;6;;;23s;181;23s°;132;
5s;6;gta;5;0;;5s;6;5s;6;
aac;4;gac;16;;;aac;6;aac;4;
gaa;5;aac;31;;;tta;15;gaa;5;
gta;5;aac;4;;;atgf;7;gta;5;0
gac;11;aca;4;-10;;gaa;9;gac;11;2
aca;14;tac;11;2;;gga;5;aca;14;0
tac;9;gga;19;9;;gta;5;tac;9;
gga;10;aga;6;-3;;gac;9;gga;10;
aga;9;caa;12;1;;aca;14;aga;9;2
caa;11;aaa;6;4;;tac;10;caa;11;
aaa;2;tca;11;-7;;cta;28;aaa;2;
tca;18;agc;6;-2;;aga;7;tca;18;
agc;8;cca;6;;;caa;89;agc;8;
cca;85;atg;11;;;tca;3;cca;85;
tgg;60;tgg;31;-29;;ttc;6;tgg;60;
cca;5;cca;6;1;;atgj;11;cca;5;
atc;3;atc;6;3;;atgi;29;atc;3;
ttc;7;ttc;13;6;;cca;7;ttc;7;
atgj;114;atg;138;24;;cac;8;atgj;114;
;;;;;;aaa;353;;;

cdc8 cdc psor 9[modifier | modifier le wikicode]

cdc8;18aas;cdc8;9aas;;;cdc8;9aas;cdc;9aas;
cds;214;;;;;cds;281;16s;52;
cds;554;;;;;16s°;100;gca;373;
cds;0;cds;281;;;23s°;126;23s;126;
cds;167;16s°;100;;;5s;7;5s;7;
23s°;132;23s°;126;;;aac;6;aac;5;-1
5s;6;5s;7;;;tta;15;tta;15;0
aac;4;aac;6;;;atgf;7;atgf;7;0
gaa;5;tta;15;;;gaa;8;gaa;14;6
gta;5;atgf;7;;;gga;4;gga;5;1
gac;11;gaa;8;;;gta;5;gta;5;0
aca;14;gga;4;;;gac;10;gac;10;0
tac;9;gta;5;0;;ggc;9;ggc;9;0
gga;10;gac;10;;;aga;954;aga;975;21
aga;9;ggc;9;;;cds;;cds;;
caa;11;aga;954;;;;;;;
aaa;2;cds;;;;cdc8;I4;cdc;VIII1;
tca;18;;;;;;;16s;68;
agc;8;;;;;16s;217;gca;271;
cca;85;;;;;23s;126;23s;126;0
tgg;60;;;;;5s;216;5s;213;-3
cca;5;;;;;cds;372;cds;372;0
atc;3;;;;;cds;21;cds;21;0
ttc;7;;;;;cds;778;cds;776;-2
atgj;114;;;;;16s;261;16s;52;
;;;;;;23s;201;gca;373;
cdc8;19aas;cdc8;9aas;;;5s;5;23s;126;-75
;;cds;281;;;;;5s;7;2
16s;321;16s°;100;;;;;;;
23s;181;23s°;126;;;psor;VII1;cdc8;VII1;
5s;6;5s;7;;;CDS;431;cds;179;
aac;6;aac;6;0;;16s;54;16s;161;
tta;15;tta;15;9;;gca;114;5s;201;
atgf;7;atgf;7;-8;;23s;193;23s;217;
gaa;9;gaa;8;1;;5s;5;16s;108;
gga;5;gga;4;-5;;tta;9;atgi;11;2
gta;5;gta;5;0;;atg;123;tta;5;0
gac;9;gac;10;;;16s;54;5s;201;8
aca;14;ggc;9;;;gca;114;23s;375;261
tac;10;aga;954;;;23s;193;gca;52;-2
cta;28;cds;;;;5s;5;16s’;100;-23
aga;7;;;;;tta;9;16s’;52;
caa;89;;;;;atg;123;gca;248;
tca;3;;;;;16s;54;23s°;100;-2
ttc;6;;;;;gca;114;16s°;321;134
atgj;11;;;;;23s;78;23s;100;
atgi;29;;;;;5s;100;16s°;320;
cca;7;;;;;CDS;;23s°;100;
cac;8;;;;;;;23s’;126;
aaa;353;;;;;;;5s;127;
;;;;;;;;cds;;

cdc8 cdc protéines[modifier | modifier le wikicode]

Alignement sur cdc[modifier | modifier le wikicode]
;cdc;;;;;;cdc8;;;;;
ordre;Peptoclostridium difficile CD196;;;;;;Peptoclostridium difficile M68;;;;;
0;dir    ;9857..10630;cds;179;774;SigB;dir    ;4194196..4196423;23s’;100;2228;
;dir    ;10810..12317;16s;52;1508;;dir    ;4196524..4197091;16s°;320;568;
;dir    ;12370..12445;gca;249;76;;dir    ;4197412..4199044;23s°;100;1633;
1;dir    ;12695..15596;23s;111;2902;;dir    ;4199145..4201593;23s’;126;2449;
;dir    ;15708..15824;5s;126;117;;dir    ;4201720..4201836;5s;127;117;
;dir    ;15951..16460;cds;11;510;NadR;dir    ;4201964..4202473;cds;11;510;NadR
;dir    ;16472..17353;cds;457;882;mecano;dir    ;4202485..4203366;cds;458;882;mecano
;dir    ;17811..19082;cds;319;1272;S-ligase;dir    ;4203825..4205096;cds;320;1272;S-ligase
;dir   ;19402..19857;cds;0;456;Nuc-de;dir    ;4205417..4205872;cds;0;456;Nuc-de
;dir   ;19858..19949;tcc;37;92;;dir    ;4205873..4205964;tcc;37;92;
2;dir   ;19987..20251;ncRNA;76;265;;dir    ;4206002..4206266;ncRNA;76;265;
;dir   ;20328..21965;cds;;1638;III-tau;dir    ;4206343..4207980;cds;;1638;III-tau
;;;;;;;;;;;;
;comp;23419..24624;cds;505;1206;Glyco-tr;dir   ;4306341..4307538;16s;0;1198;
;dir    ;25130..26637;16s;279;1508;;dir   ;4307539..4308225;cds;100;687;xylose
;dir    ;26917..29816;23s;180;2900;;dir   ;1..796;23s°;181;796;
;dir    ;29997..30113;5s;6;117;;dir   ;978..1094;5s;6;117;
3;dir    ;30120..30194;aac;6;75;;dir   ;1101..1175;aac;6;75;
;dir    ;;**41aas;12;;;dir   ;;**41aas;12;;
;dir    ;33877..33952;gta;75;76;;dir   ;4868..4943;gta;75;76;
;dir    ;34028..34441;cds;308;414;hp-414;dir   ;5019..5432;cds;308;414;hp-414
;dir    ;34750..38181;cds;;3432;pyruvate;dir   ;5741..9172;cds;;3432;pyruvate
;;;;;;;;;;;;
;;;;;;;dir;4300349..4300807;cds;554;459;Helix
;dir    ;127011..127715;cds;281;705;CwlD;dir   ;4301362..4303101;cds;0;1740;hp-1740
;dir    ;127997..129505;16s;279;1509;;dir   ;4303102..4303305;cds;167;204;hp-204
;dir    ;129785..132685;23s;131;2901;;dir   ;4303473..4304299;23s°;132;827;
;dir    ;132817..132933;5s;6;117;;dir   ;4304432..4304548;5s;6;117;
4;dir    ;132940..133014;aac;4;75;;dir   ;4304555..4304629;aac;4;75;
;dir    ;;**16aas;8;;;dir   ;;**16aas;8;;
;dir    ;134534..134610;atgj;114;77;;dir   ;4306150..4306226;atgj;114;77;
;dir    ;134725..136115;16s;68;1391;;;;;;;
;dir    ;136184..136259;gca;271;76;;dir    ;4232593..4234098;16s;217;1506;
;dir    ;136531..139430;23s;126;2900;;dir    ;4234316..4237215;23s;126;2900;
;dir    ;139557..139673;5s;213;117;;dir    ;4237342..4237458;5s;216;117;
;comp;139887..141071;cds;372;1185;B6;comp;4237675..4238859;cds;372;1185;B6
5;dir    ;141444..143795;cds;21;2352;Art-red;dir    ;4239232..4241583;cds;21;2352;Art-red
;dir    ;143817..144356;cds;776;540;Art-reda;dir    ;4241605..4242144;cds;778;540;Art-reda
;dir    ;145133..146640;16s;52;1508;;dir   ;94032..94736;cds;281;705;CwlD
;dir    ;146693..146768;gca;373;76;;dir   ;95018..95994;16s°;100;977;
;dir    ;147142..150041;23s;126;2900;;dir   ;96095..97613;23s°;126;1519;
;dir    ;150168..150284;5s;7;117;;dir   ;97740..97856;5s;7;117;
6;dir    ;150292..150366;aac;5;75;;dir   ;97864..97938;aac;6;75;
;dir    ;;**7aas;6;;;dir   ;;**7aas;6;;
;dir    ;150976..151049;aga;975;74;;dir   ;98542..98615;aga;954;74;
;dir    ;152025..152864;cds;;840;TIGR;dir   ;99570..100409;cds;;840;TIGR
;;;;;;;;;;;;
;dir   ;378341..380728;cds;583;2388;cad;dir   ;306829..309216;cds;733;2388;cad
;dir   ;381312..382819;16s;311;1508;;<> comp;309950..310076;cds;1;127;seleno
;dir   ;383131..386030;23s;126;2900;;dir   ;310078..311313;23s°;126;1236;
7;dir   ;386157..386273;5s;177;117;;dir   ;311440..311556;5s;177;117;
;dir   ;386451..387059;cds;;609;DedA;dir   ;311734..312342;cds;;609;DedA
;;;;;;;;;;;;
;comp;833130..833894;cds;258;765;DeoR;comp;861856..862620;cds;258;765;DeoR
8;dir    ;834153..834243;agc;87;91;;dir   ;862879..862969;agc;87;91;
;dir    ;834331..835119;cds;;789;flagellar;dir   ;863057..863845;cds;;789;flagellar
;;;;;;;;;;;;
;dir    ;1089165..1090139;cds;239;975;Mannosyl;dir    ;1106477..1107451;cds;238;975;Mannosyl
;dir    ;1090379..1091886;16s;320;1508;;dir    ;1107690..1109197;16s;320;1508;
;dir    ;1092207..1095106;23s;91;2900;;dir    ;1109518..1112416;23s;91;2899;
;dir    ;1095198..1095271;gga;8;74;;dir    ;1112508..1112581;gga;8;74;
9;dir    ;1095280..1095396;5s;273;117;;dir    ;1112590..1112706;5s;273;117;
;dir    ;1095670..1097688;cds;;2019;Ala amid;dir    ;1112980..1114998;cds;;2019;Ala amid
;;;;;;;;;;;;
;comp;1181549..1182958;cds;1374;1410;MBOAT;comp;1196804..1198213;cds;1378;1410;MBOAT
10;comp;1184333..1184415;ttg;318;83;;comp;1199592..1199674;ttg;318;83;
;dir    ;1184734..1187382;cds;;2649;PolyI;dir    ;1199993..1202641;cds;;2649;PolyI
;;;;;;;;;;;;
;dir   ;1835768..1837498;cds;109;1731; NhaC;dir    ;1850896..1852626;cds;109;1731; NhaC
11;dir   ;1837608..1837688;cta;231;81;;dir    ;1852736..1852816;cta;334;81;
;<dir   ;1837920..1838093;cds;;174;HXXEE;dir    ;1853151..1853666;cds;;516;HXXEE
;;;;;;;;;;;;
;dir   ;2981767..2982444;cds;159;678;SrtB;dir    ;3024038..3024715;cds;150;678;SrtB
;comp;2982604..2982678;aca;94;75;;comp;3024866..3024940;aca;93;75;
;comp;2982773..2985672;23s;184;2900;;comp;3025034..3027933;23s;184;2900;
12;comp;2985857..2987364;16s;340;1508;;comp;3028118..3029625;16s;374;1508;
;dir   ;2987705..2988643;cds;;939;lactam;dir    ;3030000..3030938;cds;;939;lactam
;;;;;;;;;;;;
;comp;3787361..3788431;cds;454;1071;ABC;comp;3875816..3876886;cds;452;1071;ABC
;comp;3788886..3789002;5s;126;117;;comp;3877339..3877455;5s;125;117;
13;comp;3789129..3792028;23s;281;2900;;comp;3877581..3880480;23s;261;2900;
;comp;3792310..3793817;16s;191;1508;;comp;3880742..3882249;16s;190;1508;
;comp;3794009..3794587;cds;;579;precorrin;comp;3882440..3883018;cds;;579;precorrin
;;;;;;;;;;;;
;comp;3944262..3944453;cds;119;192;DUF378;comp;4017523..4017714;cds;118;192;DUF378
;comp;3944573..3944689;5s;126;117;;comp;4017833..4017949;5s;126;117;
14;comp;3944816..3947715;23s;217;2900;;comp;4018076..4020975;23s;321;2900;
;comp;3947933..3949440;16s;282;1508;;comp;4021297..4022804;16s;292;1508;
;comp;3949723..3950004;cds;221;282;hp-282;comp;4023097..4023378;cds;221;282;hp-282
;comp;3950226..3951755;cds;;1530;K-ligase;comp;4023600..4025129;cds;;1530;K-ligase
;;;;;;;;;;;;
;dir    ;4084445..4085437;cds;382;993; DnaC;dir    ;4135881..4136873;cds;383;993; DnaC
;comp;4085820..4085894;aca;33;75;;comp;4137257..4137331;aca;33;75;
15;comp;4085928..4086003;gta;4;76;;comp;4137365..4137440;gta;4;76;
;comp;4086008..4086082;gaa;6;75;;comp;4137445..4137519;gaa;6;75;
;comp;4086089..4086164;aaa;326;76;;comp;4137526..4137601;aaa;331;76;
;comp;4086491..4087780;cds;;1290;succinate;comp;4137933..4139222;cds;;1290;succinate
Alignement sur cdc8[modifier | modifier le wikicode]
;cdc8;;;;;;;cdc8;;;;;;;psor;;;;
ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;;ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;adresse;gène;intercal;pbs;abrégé
insert;dir   ;4299490..4300134;cds;214;645;Y-r1;;0;dir    ;4178197..4178970;cds;179;774;SigB;127845..129260;CDS;100;1416;R-deca
insert;dir   ;4300349..4300807;cds;554;459;Helix;;insert;dir    ;4179150..4180587;16s;161;1438;;127628..127744;5s;78;;
;dir   ;4301362..4303101;cds;0;1740;hp-1740;;insert;comp;4180749..4180865;5s;201;117;;124628..127549;23s;114;;
;dir   ;4303102..4303305;cds;167;204;hp-204;;insert;comp;4181067..4183959;23s;217;2893;;124438..124513;gca;54;;
;dir   ;4303473..4304299;23s°;132;827;;;insert;comp;4184177..4185684;16s;108;1508;;122877..124383;16s;123;;
4;dir   ;4304432..4304548;5s;6;117;;;insert;comp;4185793..4185869;atgi;11;77;;122677..122753;atg;9;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4185881..4185969;tta;5;89;;122579..122667;tta;5;;
;dir   ;4304634..4304708;gaa;5;75;;;insert;comp;4185975..4186091;5s;201;117;;122457..122573;5s;193;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4186293..4189192;23s;375;2900;;119347..122263;23s;114;;
;dir   ;;**16aas;8;;;;insert;comp;4189568..4189643;gca;52;76;;119157..119232;gca;54;;
;dir   ;4306150..4306226;atgj;114;77;;;insert;comp;4189696..4190959;16s’;100;1264;;117596..119102;16s;123;;
;dir   ;4306341..4307538;16s;0;1198;;;insert;dir    ;4191060..4192225;16s’;52;1166;;117396..117472;atg;9;;
;dir   ;4307539..4308225;cds;100;687;xylose;;insert;dir    ;4192278..4192353;gca;248;76;;117298..117386;tta;5;;
;dir   ;1..796;23s°;181;796;;;insert;dir    ;4192602..4193197;23s°;100;596;;117176..117292;5s;193;;
3;dir   ;978..1094;5s;6;117;;;insert;dir    ;4193298..4193874;16s°;321;577;;114067..116982;23s;114;;
;dir    ;1101..1175;aac;6;75;;;insert;dir    ;4194196..4196423;23s’;100;2228;;113877..113952;gca;54;;
;dir    ;;**41aas;12;;;;;dir    ;4196524..4197091;16s°;320;568;;112316..113822;16s;431;;
;dir    ;4868..4943;gta;75;76;;;1;dir    ;4197412..4199044;23s°;100;1633;;111345..111884;CDS;;540;Art-reda
;dir    ;5019..5432;cds;308;414;hp-414;;;dir    ;4199145..4201593;23s’;126;2449;;;;;;
;dir    ;5741..9172;cds;;3432;pyruvate ;;;dir    ;4201720..4201836;5s;127;117;;;;;;
;;;;;;;;;dir    ;4201964..4202473;cds;11;510;NadR;;;;;
;dir   ;94032..94736;cds;281;705;CwlD;;;dir    ;4202485..4203366;cds;458;882;mecano;;;;;
;dir   ;95018..95994;16s°;100;977;;;;dir    ;4203825..4205096;cds;320;1272;S-ligase;;;;;
;dir   ;96095..97613;23s°;126;1519;;;;dir    ;4205417..4205872;cds;0;456;Nuc-de;;;;;
6;dir   ;97740..97856;5s;7;117;;;;dir    ;4205873..4205964;tcc;37;92;;;;;;
;dir   ;97864..97938;aac;6;75;;;2;dir    ;4206002..4206266;ncRNA;76;265;;;;;;
;dir   ;;**7aas;6;;;;;dir    ;4206343..4207980;cds;;1638;III-tau;;;;;
;dir   ;98542..98615;aga;954;74;;;;;;;;;;;;;;
;dir   ;99570..100409;cds;;840;TIGR;;insert;comp;4209435..4210639;cds;496;1205;Glyco-tr;;;;;
;;;;;;;;insert;;4211136..4212643;16s;321;1508;;;;;;
;<> cp;309950..310076;cds;1;127;seleno;;insert;;4212965..4213127;23s°;100;163;;;;;;
;dir   ;310078..311313;23s°;126;1236;;;insert;<>comp;4213228..4213849;cds;;622;CHAP;;;;;
7;dir   ;311440..311556;5s;177;117;;;insert;;;;;;;;;;;
;dir   ;311734..312342;cds;;609;DedA;;insert;comp;4213961..4214620;cds;228;660;A-1chlor;;;;;
;;;;;;;;insert;dir    ;4214849..4216199;16s;321;1351;;;;;;
;comp;861856..862620;cds;258;765;DeoR;;insert;dir    ;4216521..4217008;23s°;101;488;;;;;;
8;dir   ;862879..862969;agc;87;91;;;insert;comp;4217110..4218529;23s°;250;1420;;;;;;
;dir   ;863057..863845;cds;;789;flagellar;;insert;comp;4218780..4218855;gca;52;76;;;;;;
;;;;;;;;insert;comp;4218908..4219471;16s°;100;564;;;;;;
;dir    ;1106477..1107451;cds;238;975;Mannosyl;;insert;comp;4219572..4219856;23s°;217;285;;;;;;
;dir    ;1107690..1109197;16s;320;1508;;;insert;comp;4220074..4221581;16s;179;1508;;;;;;
;dir    ;1109518..1112416;23s;91;2899;;;insert;>comp;4221761..4222206;cds;386;446;SigB2;3452349..3452552;CDS;239;204;hp-204
;dir    ;1112508..1112581;gga;8;74;;;insert;dir    ;4222593..4224100;16s;321;1508;;3450603..3452109;16s;196;;
9;dir    ;1112590..1112706;5s;273;117;;;insert;dir    ;4224422..4227321;23s;181;2900;;3447492..3450406;23s;213;;
;dir    ;1112980..1114998;cds;;2019;Ala amid;;insert;dir    ;4227503..4227619;5s;6;117;;3447162..3447278;5s;5;;
;;;;;;;;insert;dir    ;4227626..4227700;aac;6;75;;3447068..3447156;tta;13;;
;comp;1196804..1198213;cds;1378;1410;MBOAT;;insert;dir    ;4227707..4227792;tta;15;86;;3446979..3447054;atg;15;;
10;comp;1199592..1199674;ttg;318;83;;;insert;dir    ;4227808..4227883;atgf;7;76;;3446889..3446963;gaa;9;;
;dir    ;1199993..1202641;cds;;2649;PolyI;;insert;dir    ;4227891..4227965;gaa;9;75;;3446806..3446879;gga;6;;
;;;;;;;;insert;dir    ;4227975..4228048;gga;5;74;;3446724..3446799;gta;5;;
;dir    ;1850896..1852626;cds;109;1731; NhaC;;insert;dir    ;4228054..4228129;gta;5;76;;3446642..3446718;gac;16;;
11;dir    ;1852736..1852816;cta;334;81;;;insert;dir    ;4228135..4228211;gac;9;77;;3446550..3446625;aac;31;;
;dir    ;1853151..1853666;cds;;516;HXXEE;;insert;dir    ;4228221..4228295;aca;14;75;;3446443..3446518;aac;4;;
;;;;;;;;insert;dir    ;4228310..4228394;tac;10;85;;3446364..3446438;aca;4;;
;dir    ;3024038..3024715;cds;150;678;SrtB;;insert;dir    ;4228405..4228488;cta;28;84;;3446275..3446359;tac;11;;
;comp;3024866..3024940;aca;93;75;;;insert;dir    ;4228517..4228593;aga;7;77;;3446190..3446263;gga;19;;
12;comp;3025034..3027933;23s;184;2900;;;insert;dir    ;4228601..4228676;caa;89;76;;3446094..3446170;aga;6;;
;comp;3028118..3029625;16s;374;1508;;;insert;dir    ;4228766..4228854;tca;3;89;;3446012..3446087;caa;12;;
;dir    ;3030000..3030938;cds;;939;lactam;;insert;dir    ;4228858..4228933;ttc;6;76;;3445924..3445999;aaa;6;;
;;;;;;;;insert;dir    ;4228940..4229016;atgj;11;77;;3445829..3445917;tca;11;;
;dir    ;3805298..3806743;cds;208;1446;Y-r2;;insert;dir    ;4229028..4229104;atgi;29;77;;3445727..3445817;agc;6;;
;comp;3806952..3807028;agg;61;77;;;insert;dir    ;4229134..4229210;cca;7;77;;3445644..3445720;cca;6;;
;<comp;3807090..3808790;cds;;1701;fdHa;;insert;dir    ;4229218..4229294;cac;8;77;;3445561..3445637;atg;11;;
;;;;;;;;insert;dir    ;4229303..4229378;aaa;353;76;;3445474..3445549;tgg;31;;
;comp;3875816..3876886;cds;452;1071;ABC;;insert;comp;4229732..4229848;5s;126;117;;3445366..3445442;cca;6;;
;comp;3877339..3877455;5s;125;117;;;insert;comp;4229975..4232010;23s’;582;2036;;3445283..3445359;atc;6;;
13;comp;3877581..3880480;23s;261;2900;;;;dir    ;4232593..4234098;16s;217;1506;;3445201..3445276;ttc;13;;
;comp;3880742..3882249;16s;190;1508;;;;dir    ;4234316..4237215;23s;126;2900;;3445111..3445187;atg;;;
;comp;3882440..3883018;cds;;579;precorrin;;;dir    ;4237342..4237458;5s;216;117;;;;;;
;;;;;;;;;comp;4237675..4238859;cds;372;1185;B6;;;;;
;comp;4017523..4017714;cds;118;192;DUF378;;5;dir    ;4239232..4241583;cds;21;2352;Art-red;;;;;
;comp;4017833..4017949;5s;126;117;;;;dir    ;4241605..4242144;cds;778;540;Art-reda;;;;;
14;comp;4018076..4020975;23s;321;2900;;;insert;dir    ;4242923..4244459;16s;261;1537;;;;;;
;comp;4021297..4022804;16s;292;1508;;;insert;dir    ;4244721..4247619;23s;201;2899;;;;;;
;comp;4023097..4023378;cds;221;282;hp-282;;insert;dir    ;4247821..4247937;5s;5;117;;111345..111884;CDS;431;540;Art-reda
;comp;4023600..4025129;cds;;1530;K-ligase;;insert;dir    ;4247943..4248031;tta;11;89;;112316..113822;16s;54;;
;;;;;;;;insert;dir    ;4248043..4248119;atgi;108;77;;113877..113952;gca;114;;
;dir    ;4135881..4136873;cds;383;993; DnaC;;insert;dir    ;4248228..4249735;16s;184;1508;;114067..116982;23s;193;;
;comp;4137257..4137331;aca;33;75;;;insert;dir    ;4249920..4250564;23s°;100;645;;117176..117292;5s;5;;
15;comp;4137365..4137440;gta;4;76;;;insert;<dir    ;4250665..4250923;cds;112;259;hp-259;117298..117386;tta;9;;
;comp;4137445..4137519;gaa;6;75;;;insert;comp;4251036..4253145;23s’;375;2110;;117396..117472;atg;123;;
;comp;4137526..4137601;aaa;331;76;;;insert;comp;4253521..4253596;gca;52;76;;117596..119102;16s;54;;
;comp;4137933..4139222;cds;;1290;succinate;;insert;comp;4253649..4254226;16s°;282;578;;119157..119232;gca;114;;
;;;;;;;;insert;dir    ;4254509..4254712;cds;12;204;hp-204;119347..122263;23s;193;;
;;;;;;;;insert;dir    ;4254725..4256002;cds;;1278;phagePP;122457..122573;5s;5;;
;;;;;;;;;;;;;;;122579..122667;tta;9;;
;;;;;;;;début;début;début;début;début;début;début;122677..122753;atg;123;;
;;;;;;;;insert;dir   ;4299490..4300134;cds;214;645;Y-r1;122877..124383;16s;54;;
;;;;;;;;insert;dir   ;4300349..4300807;cds;554;459;Helix;124438..124513;gca;114;;
;;;;;;;;;dir   ;4301362..4303101;cds;0;1740;hp-1740;124628..127549;23s;78;;
;;;;;;;;;dir   ;4303102..4303305;cds;167;204;hp-204;127628..127744;5s;100;;
;;;;;;;;4;dir   ;4303473..4304299;23s°;132;827;;127845..129260;CDS;;1416;R-deca

cdc8 cdc création de cds[modifier | modifier le wikicode]

;;création de cds;;;;
;cdc8;pbs;cdc;pbs;psor;pbs
seleno A;309950..310076;127;0;;-;
Y-r;457663..457878;216;457207..457422;216;-;
;1237414..1237986;573;1223841..1224413;573;;
;1291413..1292327;915;1277836..1278750;915;;
;1418672..1419580;909;1405262..1406170;909;;
;2120221..2121348;1128;;;;
;2785863..2786042;180;;;;
;3564835..3565434;600;;;;
Y-r2;3805298..3806743;1446;;;;
Y-r1;4299490..4300134;645;;;;
Helix;351106..351336;231;391813..392001;189;-;
;379952..380503;552;429510..430061;552;;
;456588..456776;189;461727..462398;672;;
;1187185..1187736;552;1169984..1170535;552;;
;1466364..1466783;420;1292255..1292926;672;;
;1467749..1468147;399;1454375..1454773;399;;
;1605760..1606344;585;1517855..1518619;765;;
;1694358..1694750;393;1592306..1592890;585;;
;1936722..1937267;546;1682266..1682658;393;;
;2105662..2106711;1050;1695592..1696284;693;;
;2196549..2198204;1656;1916424..1916630;207;;
;2342487..2342690;204;1922813..1923358;546;;
;2353934..2354578;645;2164151..2165806;1656;;
;2378761..2379891;1131;2308386..2308589;204;;
;2721795..2722316;522;2319833..2320477;645;;
;3485137..3486024;888;2344477..2345607;1131;;
;3570953..3571183;231;2501260..2501931;672;;
;3571660..3571878;219;2688255..2688776;522;;
;3804379..3804627;249;3459701..3460588;888;;
;3804878..3805279;402;3475449..3475589;141;;
;4286854..4287222;369;;;;
;4288799..4289518;720;;;;
;4300349..4300807;459;;;;
xylose;3383443..3384780;1338;3349843..3351180;1338;0;
;<4307539..4308225;687;;;;
CHAP;<4213228..>4213849;622;0;;-;
A-1chlor;4213961..4214620;660;0;;0;
SigB2;4221761..4222206;446;0;;0;
fdHa;4221761..4222206;1701;3711229..3713373;2145;-;
R-deca;0;;0;;127845..129260;1416
;;;;;876023..877522;1500
phagePP;1448919..1449983;1065;1435547..1436611;1065;1489507..1490769;1263
;1450539..1450985;447;1437167..1437613;447;;
;1709611..1711050;1440;1697521..1698963;1443;;
;1718404..1718844;441;1708192..1708632;441;;
;3560756..3561910;1155;3841162..3842367;1206;;
;4254725..4256002;1278;;;;
;4260531..4261586;1056;;;;
;4262058..4262474;417;;;;
hp-204;4254509..4254712;204;;;;
phagePP;4254725..4256002;1278;;;;
phageHM;4255980..4256741;762;;;;
hp;;;3840525..3841067;543;;
phagePP;;;3841162..3842367;1206;;
hydrolase;;;3842345..3842512;168;;
terminase;;;;;1487770..1489491;1722
phagePP;;;;;1489507..1490769;1263
Clp;;;;;1490762..1491607;846

cdc8 cdc abrégé protéines[modifier | modifier le wikicode]

A-1chlor;type A-1 chloramphenicol O-acetyltransferase
ABC;ABC transporter ATP-binding protein
Ala amid;N-acetylmuramoyl-L-alanine amidase
Art-red;anaerobic ribonucleoside triphosphate reductase
Art-reda;anaerobic ribonucleoside-triphosphate reductase activating protein
B6;pyridoxal phosphate-dependent aminotransferase
cad;cadmium-translocating P-type ATPase
CHAP;CHAP domain-containing protein
CwlD;N-acetylmuramoyl-L-alanine amidase CwlD
DedA;DedA family protein
DeoR;DeoR/GlpR transcriptional regulator
DnaC;DNA replication protein DnaC
DUF378;DUF378 domain-containing protein
fdHa;formate dehydrogenase subunit alpha
flagellar;flagellar motor protein
Glyco-tr;glycosyl transferase
Helix;helix-turn-helix domain-containing protein
hp-1740;hp-1740
hp-204;hp-204
hp-282;hp-282
hp-414;hp-414
HXXEE;HXXEE domain-containing protein
III-tau;DNA polymerase III subunit gamma/tau
K-ligase;lysine--tRNA ligase
S-ligase;serine--tRNA ligase
lactam;delta-lactam-biosynthetic de-N-acetylase
Mannosyl;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
MBOAT;MBOAT family protein
mecano;mechanosensitive ion channel
NadR;transcription repressor NadR
NhaC;Na+/H+ antiporter NhaC family protein
Nuc-de;nucleoside deaminase
phagePP;phage portal protein
PolyI;DNA polymerase I
precorrin;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
pyruvate;pyruvate carboxylase
R-deca;arginine decarboxylase
seleno;glycine/sarcosine/betaine reductase complex  selenoprotein A
SigB;SigB/SigF/SigG family RNA polymerase sigma factor
SigB2;B/F/G family RNA polymerase sigma-70 factor
SrtB;sortase SrtB
succinate;adenylosuccinate synthase
TIGR;TIGR00159 family protein
xylose;xylose isomerase
Y-r1;tyrosine-type recombinase/integrase – 1
Y-r2;tyrosine-type recombinase/integrase – 2

cdc8 cdc psor stats[modifier | modifier le wikicode]

NCBI du 13.11.19;cdc8;cdc;psor
date;15-MAR-2017;18-MAY-2017;08-JAN-2018
DNA circulaire;4 308 325;4 110 554;3 550 458
Genes (total)         ;4 025;3 807;3 528
CDS (total)           ;3 870;3 691;3 368
Genes (coding)        ;3 763;3 615;3 327
CDS (coding)          ;3 763;3 615;3 327
Genes (RNA)           ;155;116;160
RRNAs  (5S, 16S, 23S); 14, 16, 13; 9, 10, 10;17, 17, 17
complete rRNAs        ; 14, 16, 13; 9, 10, 10;17, 17, 17
tRNAs     ;108;83;105
ncRNAs    ;4;4;4
Pseudo Genes (total)  ;107;76;41
Pseudo Genes (ambiguous residues) ; 0 of 107; 0 of 76; 0 of 41
Pseudo Genes (frameshifted)       ; 60 of 107; 42 of 76; 4 of 41
Pseudo Genes (incomplete)         ; 35 of 107; 30 of 76; 18 of 41
Pseudo Genes (internal stop)      ; 31 of 107; 18 of 76; 22 of 41
Pseudo Genes (multiple problems)  ; 18 of 107; 12 of 76; 3 of 41
CRISPR Arrays         ;4;9; - 
;;;
Décompte du 19.11.19;;;
hypothetical protein;609;523;1 256
hp / cds (total);0,16;0,14;0,37

cdc8 distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;
cta;1;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;1;gga;
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;;aag;;agg;1;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cdc8;;5;;;;;5;;cdc8;4;;;;;;9

cbc[modifier | modifier le wikicode]

cbc opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  5;;52;doubles;intercalaires
Clostridium botulinum CDC_297;;;NCBI;gtRNAdb;;
comp;1309334..1309408;;Glu;gag;;
;;;;;;
comp;1385938..1386012;;Asn;aac;;8
comp;1386021..1386134;;5s;;;108
comp;1386243..1389140;;23s;;;228
comp;1389369..1390866;;16s;;@1;
;;;;;;
comp;1392997..1393072;;Phe;ttc;;7
comp;1393080..1393193;;5s;;;108
comp;1393302..1396199;;23s;;;228
comp;1396428..1397925;;16s;;;
;;;;;;
comp;1408673..1408762;;Ser;tcc;;
;;;;;;
comp;1412183..1412259;;Arg;agg;;
;;;;;;
comp;1415464..1415540;;Arg;cgt;;84
comp;1415625..1415715;;Ser;agc;+;20
comp;1415736..1415826;;Ser;tca;2 agc;306
comp;1416133..1416223;;Ser;agc;2 tca;20
comp;1416244..1416334;;Ser;tca;@4;
;;;;;;
comp;1425969..1426044;;Ala;gca;;3
comp;1426048..1426124;;Met;atgi;;8
comp;1426133..1426246;;5s;;;79
comp;1426326..1427823;;16s;;@2;117
comp;1427941..1428051;;MNEGCDRILIVVARWQVSKNKKMLTKIKKRATIIKH;CDS 108pb;;
;;;;;;
;1694943..1695017;;Gln;cag;;
;;;;;;
comp;1722580..1722664;;Tyr;tac;;5
comp;1722670..1722745;;Thr;aca;;
;;;;;;
comp;1841437..1841510;;Cys;tgc;;
;;;;;;
comp;1842698..1842811;;5s;;;108
comp;1842920..1845817;;23s;;;228
comp;1846046..1847543;;16s;;;
;;;;;;
;1890534..1890608;;Glu;gaa;+;17
;1890626..1890701;;Val;gta;3 gaa;9
;1890711..1890787;;Asp;gac;3 gta;4
;1890792..1890867;;Thr;aca;3 gac;5
;1890873..1890947;;Glu;gaa;2 aca;18
;1890966..1891041;;Val;gta;;7
;1891049..1891125;;Asp;gac;;57
;1891183..1891257;;Glu;gaa;;17
;1891275..1891350;;Val;gta;;9
;1891360..1891436;;Asp;gac;;4
;1891441..1891516;;Thr;aca;;
;;;;;;
comp;1948153..1948228;;Pro;cca;;
;;;;;;
;1969157..1969245;;Leu;tta;;4
;1969250..1969325;;Met;atgf;+;53
;1969379..1969454;;Met;atgf;2 atgf;10
;1969465..1969541;;Met;atg;;
;;;;;;
;1987541..1989040;;16s;;@3;226
;1989267..1992166;;23s;;;93
;1992260..1992375;;5s;;;7
;1992383..1992457;;Asn;aac;+;27
;1992485..1992559;;Asn;aac;;
;;;;;;
;2013239..2013313;;Gly;ggg;;18
;2013332..2013407;;Thr;acc;;
;;;;;;
;2222515..2222590;;Trp;tgg;;
;;;;;;
;2294767..2294842;;Pro;cca;+;7
;2294850..2294923;;Gly;gga;2 cca;6
;2294930..2295006;;Arg;aga;2 gga;5
;2295012..2295087;;Lys;aag;;26
;2295114..2295189;;Pro;cca;;29
;2295219..2295292;;Gly;gga;;24
;2295317..2295393;;Arg;cga;;
;;;;;;
;2402556..2402631;;Val;gta;;5
;2402637..2402713;;Asp;gac;;3
;2402717..2402792;;Phe;ttc;;4
;2402797..2402871;;Gly;ggc;;9
;2402881..2402954;;Cys;tgc;;
;;;;;;
;2517305..2517391;;Leu;ttg;;
;;;;;;
;2548708..2548792;;Leu;ctc;;
;;;;;;
;2583298..2583388;;SeC;tga;;

cbc cumuls[modifier | modifier le wikicode]

cbc* cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;5;1;0;0
;16 23 5s 0;1;20;22;1
;16 atc gca;0;40;3;1
;16 23 5s a;3;60;2;0
;max a;2;80;0;0
;a doubles;1;100;1;0
;spéciaux;1;120;0;0
;total aas;6;140;0;0
sans ;opérons;17;160;0;0
;1 aa;10;180;0;0
;max a;11;200;0;0
;a doubles;4;;0;0
;total aas;46;;28;2
total aas;;52;;;
remarques;;4;;;
avec jaune;;;moyenne;17;15
;;;variance;19;
sans jaune;;;moyenne;15;
;;;variance;14;

cbc blocs[modifier | modifier le wikicode]

cbc* blocs;;;;
aac;8;7;-;
5s;108;108;108;226
23s;228;228;228;93
16s;;;-;7
;;;;
gca;3;;;
atgi;8;;;
5s;79;;;
16s;;;;

cbc distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;2;1-3 aas
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;gca
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;atgi
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;aac
ttc;;tcc;1;tac;;tgc;1;;ttc;1;tcc;;tac;1;tgc;1;;ttc;;tcc;;tac;;tgc;;ttc
atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;2;;atc;;acc;;aac;;agc;;aac2
ctc;1;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;;cgt;;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;4;ggc;1;;gtc;;gcc;;gac;;ggc;;>1aa
tta;;tca;;taa;;tga;1;;tta;1;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;atgf2
ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;;aga;1;;ata;;aca;;aaa;;aga;;
cta;;cca;1;caa;;cga;;;cta;;cca;2;caa;;cga;1;;cta;;cca;;caa;;cga;;
gta;;gca;;gaa;;gga;;;gta;4;gca;;gaa;3;gga;2;;gta;;gca;;gaa;;gga;;
ttg;1;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;
atgj;;acg;;aag;;agg;1;;atgj;1;acg;;aag;1;agg;;;atgj;;acg;;aag;;agg;;
ctg;;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;
gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;
cbc*;;10;;;;;10;;cbc*;36;;;;;;34;;cbc*;2;;;;;;2;

cbn[modifier | modifier le wikicode]

cbn opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  10;86;doubles;intercal;aa;avec aa
;Clostridium botulinum BKT015925;;;;;;
;20666..20741;;acg;;;;
;;;;;;;
;36413..36487;;gaa;+;12;12;
;36500..36575;;gta;2 gaa;13;13;
;36589..36665;;gac;2 gta;5;5;
;36671..36746;;aca;2 gac;18;18;
;36765..36839;;gaa;2 aca;12;12;
;36852..36927;;gta;;13;13;
;36941..37017;;gac;;5;5;
;37023..37098;;aca;;;;
;;;;;;;
;137366..137441;;cca;;;;
;;;;;;;
;161964..162052;;tta;+;5;5;
;162058..162133;;atgf;3 tta;5;5;
;162139..162215;;atgj;3 atgf;46;46;
;162262..162350;;tta;2 atgj;5;5;
;162356..162431;;atgf;;30;30;
;162462..162538;;atgj;;46;46;
;162585..162673;;tta;;5;5;
;162679..162754;;atgf;;;;
;;;;;;;
;76258..176332;;aac;;;;
;;;;;;;
;180177..181695;;16s;@5;233;;
;181929..184836;;23s;;45;;
;184882..184956;;aac;+;14;;
;184971..185087;;5s;;7;;
;185095..185169;;aac;2 aac;;;
;;;;;;;
;222409..222484;;acc;;;;
;;;;;;;
comp;578417..578492;;cag;;;;
;;;;;;;
comp;944747..944833;;ttg;;;;
;;;;;;;
;955546..955630;;ctt;;;;
;;;;;;;
;1026946..1027021;;gta;;17;17;17
;1027039..1027115;;gac;;14;14;14
;1027130..1027205;;ttc;;4;4;4
;1027210..1027284;;ggc;;8;8;8
;1027293..1027367;;tgc;+;57;57;57
;1027425..1027499;;tgc;2 tgc;;;
;;;;;;;
comp;2030816..2030890;;aac;;45;;
comp;2030936..2033842;;23s;;96;;
comp;2033939..2034015;;atc;;7;;7
comp;2034023..2034098;;gca;;121;;
comp;2034220..2035734;;16s;;;;
;;;;;;;
comp;2283768..2283884;;5s;;95;;
comp;2283980..2286886;;23s;;233;;
comp;2287120..2288638;;16s;@3;464;;
comp;2289103..2289176;;gga;;15;;15
comp;2289192..2289268;;atc;;7;;7
comp;2289276..2289351;;gca;;;;
;;;;;;;
comp;2350598..2350674;;cga;+;21;21;
comp;2350696..2350769;;gga;4 gga;28;28;
comp;2350798..2350873;;aaa;2 aaa;4;4;
comp;2350878..2350952;;caa;2 caa;4;4;
comp;2350957..2351032;;cac;2 cac;5;5;
comp;2351038..2351112;;aag;3 aag;3;3;
comp;2351116..2351192;;aga;3 aga;6;6;
comp;2351199..2351272;;gga;2 cca;4;4;
comp;2351277..2351352;;cca;2 ggc;21;21;
comp;2351374..2351449;;aag;;5;5;
comp;2351455..2351531;;aga;;5;5;
comp;2351537..2351610;;gga;;5;5;
comp;2351616..2351690;;ggc;;3;3;
comp;2351694..2351777;;cta;;22;22;
comp;2351800..2351875;;aaa;;4;4;
comp;2351880..2351954;;caa;;4;4;
comp;2351959..2352034;;cac;;5;5;
comp;2352040..2352115;;aag;;5;5;
comp;2352121..2352197;;aga;;5;5;
comp;2352203..2352276;;gga;;5;5;
comp;2352282..2352356;;ggc;;6;6;
comp;2352363..2352438;;cca;;;;
;;;;;;;
comp;2432784..2432859;;tgg;;;;
;;;;;;;
comp;2454880..2454964;;tac;+;39;39;
comp;2455004..2455079;;gta;2 tac;8;8;
comp;2455088..2455172;;tac;;4;4;
comp;2455177..2455252;;aca;;;;
;;;;;;;
comp;2697795..2697911;;5s;@1;31;;
comp;2697943..2700847;;23s;;233;;
comp;2701081..2702599;;16s;;;;
;;;;;;;
comp;2703946..2704021;;aaa;;311;;311
comp;2704333..2704408;;ttc;;5;;
comp;2704414..2704530;;5s;;336;;
comp;2704867..2704942;;ttc;;5;;
comp;2704948..2705064;;5s;;97;;
comp;2705162..2708066;;23s;;233;;
comp;2708300..2709814;;16s;;;;
;;;;;;;
comp;2721253..2721328;;aaa;@2;5;;
comp;2721334..2721450;;5s;;95;;
comp;2721546..2724452;;23s;;233;;
comp;2724686..2726203;;16s;;;;
;;;;;;;
comp;2731902..2731976;;gag;;61;;61
comp;2732038..2732112;;caa;;6;;6
comp;2732119..2732195;;aga;;4;;4
comp;2732200..2732273;;gga;;19;;19
comp;2732293..2732376;;cta;;16;;16
comp;2732393..2732467;;gaa;;4;;
comp;2732472..2732588;;5s;;97;;
comp;2732686..2735592;;23s;@4;94;;
comp;2735687..2735763;;atc;;3;;
comp;2735767..2735842;;gca;;74;;
comp;2735917..2737435;;16s;;;;
;;;;;;;
comp;2742262..2742351;;tcc;;;;
;;;;;;;
comp;2743220..2743312;;tcg;;;;
;;;;;;;
comp;2743891..2743967;;agg;;;;
;;;;;;;
comp;2748534..2748610;;cgt;;144;144;
comp;2748755..2748845;;agc;;23;23;
comp;2748869..2748959;;tca;+;69;69;
comp;2749029..2749119;;tca;2 tca;;;
;;;;;;;
comp;2758688..2758763;;gca;;4;;4
comp;2758768..2758844;;atgi;;3;;
comp;2758848..2758964;;5s;;73;;
comp;2759038..2761942;;23s;;233;;
comp;2762176..2763694;;16s;;;;
;;;;;;;
comp;2150504..2150620;;5s;;31;;
comp;2150652..2153560;;23s;;233;;
comp;2153794..2155308;;16s;;;;
;;;;;;;
comp;2169525..2169641;;5s;;32;;
comp;2169674..2172579;;23s;;233;;
comp;2172813..2174331;;16s;;;;
;;;;;;;
sur plasmide;;;tgg;;;;

cbn cumuls[modifier | modifier le wikicode]

cbn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;10;1;0;0
;16 23 5s 0;3;20;34;9
;16 gca atc;2;40;7;0
;16 23 5s a;4;60;3;0
;max a;8;80;1;1
;a doubles;1;100;0;0
;spéciaux;1;120;0;0
;total aas;22;140;0;0
sans ;opérons;18;160;1;0
;1 aa;12;180;0;0
;max a;22;200;0;0
;a doubles;6;;0;0
;total aas;64;;46;10
total aas;;86;;;
remarques;;5;;;
avec jaune;;;moyenne;17;
;;;variance;25;
sans jaune;;;moyenne;14;14
;;;variance;15;17

cbn blocs[modifier | modifier le wikicode]

cbn blocs;;;;;;
5s;31;31;32;;;
23s;233;233;233;;;
16s;;;;;;
;;;;;ttc;5
;;;;;5s;336
aaa;5;3;;;ttc;5
5s;95;73;5s;95;5s;97
23s;233;233;23s;233;23s;233
16s;aaa;atgi;16s;464;16s;
;;;gga;15;;
16s;233;;;;;
23s;45;;;;;
aac;14;;;;;
5s;7;;;;;
aac;;;;;;
gaa;4;;;;;
5s;97;aac;45;;;
23s;94;23s;96;;;
atc;3;atc;7;;;
gca;74;gca;121;;;
16s;;16s;;;;

cbn distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;;avant 5s;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;2 aac;att;;act;;aat;;agt;
ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;1;tcc;;tac;2;tgc;;;ttc;;tcc;;tac;;tgc;2;4-8 aas;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;1;;atc;;acc;;aac;;agc;;gag;atc;;acc;;aac;;agc;
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;1;;ctc;;ccc;;cac;;cgt;;caa;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;3;ggc;3;;gtc;;gcc;;gac;;ggc;;aga;gtc;;gcc;;gac;;ggc;
tta;;tca;;taa;;tga;;;tta;3;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;;gga;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;2;aga;3;;ata;;aca;;aaa;;aga;;cta;ata;;aca;;aaa;;aga;1
cta;;cca;1;caa;;cga;;;cta;1;cca;2;caa;2;cga;1;;cta;;cca;;caa;;cga;;gaa;cta;1;cca;;caa;1;cga;
gta;;gca;;gaa;;gga;;;gta;4;gca;;gaa;2;gga;4;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;>1aa;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;;atgj;2;acg;;aag;3;agg;;;atgj;;acg;;aag;;agg;;tgc2;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;tca2;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;1;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cbn;;12;;;;;12;;cbn;48;;;;;;48;;cbn;4;;;;;;4;;cbn;;;;6;;;6

cbn intercalaires entre cds[modifier | modifier le wikicode]

cbn;2.2.21 Paris;;cbn 31.1.14;;;;;;;
cbn;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>frequence5
;'''négatif;176;7.1;'''négatif ;-11;10;-1 à -47;'''2 773 157;-1;176
;'''zéro;11;0.4;;;;;'''intercals;0;11
;'''1 à 200;1767;70.9;'''0 à 200;71;60;;'''313 764;5;116
;'''201 à 370;394;15.8;'''201 à 370;266;48;;'''11.3%;10;66
;'''371 à 600;117;4.7;'''371 à 600;464;65;;;15;121
;'''601 à max;26;1.0;'''601 à 1028;810;204;;;20;93
;'''total 2491;<201;78.4;'''total 2491;125;141;-47 à 1443;;25;87
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;79
624731;1443;-1;176;-70;0;;0;11;35;50
834812;1270;0;11;-60;0;;-1;°34;40;64
1909773;1149;1;°38;-50;0;;-2;0;45;44
1395656;1025;2;°32;-40;4;;-3;0;50;50
1366434;952;3;15;-30;4;'''min à -1;-4;°28;55;60
2662601;856;4;14;-20;21;176;-5;0;60;35
1385645;836;5;°17;-10;47;7.1%;-6;1;65;56
754437;826;6;13;0;111;;-7;5;70;41
1803918;777;7;12;10;182;;-8;°31;75;32
1826878;759;8;9;20;214;;-9;1;80;38
1307165;753;9;11;30;166;;-10;6;85;35
627889;751;10;°21;40;114;'''1 à 100;-11;°15;90;37
1388755;748;11;22;50;94;1201;-12;1;95;40
2579132;747;12;°32;60;95;48.2%;-13;2;100;46
1789056;745;13;22;70;97;;-14;°7;105;28
1830367;730;14;22;80;70;;-15;0;110;26
841754;723;15;°23;90;72;;-16;3;115;35
1855513;710;16;21;100;86;;-17;°11;120;31
2136552;703;17;17;110;54;;-18;0;125;41
390878;696;18;°20;120;66;;-19;2;130;33
943107;680;19;15;130;74;;-20;°7;135;25
2674137;655;20;20;140;54;;-21;1;140;29
1095841;652;21;°20;150;61;;-22;1;145;30
2644575;626;22;18;160;52;;-23;°2;150;31
261153;625;23;15;170;64;'''1 à 200;-24;0;155;21
1887215;619;24;14;180;52;1767;-25;1;160;31
2676061;600;25;°20;190;54;70.9%;-26;°2;5;34
2443011;582;26;12;200;46;;-27;1;170;30
1811650;581;27;°20;210;38;;-28;1;175;27
1933429;576;28;16;220;41;;-29;°5;180;25
1797999;574;29;14;230;41;;-30;0;185;23
2550424;574;30;°17;240;34;;-31;1;190;31
2050753;573;31;13;250;28;;-32;1;195;23
923904;572;32;7;260;30;'''0 à 200;;181;200;23
313619;570;33;°15;270;21;1778;reste;6;205;19
1471664;569;34;8;280;14;;total;187;210;19
1133306;567;35;7;290;19;;;;215;17
262285;563;36;11;300;32;;'''intercal;'''<u>frequencef;220;24
;;37;°13;310;11;;600;2465;225;25
;;38;9;320;12;;620;1;230;16
;;39;°17;330;16;;640;2;235;17
;;40;14;340;16;'''201 à 370;660;2;240;17
;;reste;1628;350;13;394;680;1;245;15
;;total;2491;360;14;15.8%;700;1;250;13
;;;;370;14;;720;2;255;15
;;;;380;13;;740;2;260;15
'''adresse;'''intercaln;'''décalage;'''long;390;7;;760;6;265;10
1144166;-47;shift 2;1795;400;9;;780;1;270;11
369225;-46;shift 2;3395;410;5;;800;0;275;9
1579583;-44;shift 2;487;420;6;;820;0;280;5
430053;-41;;;430;3;;840;2;285;9
1494403;-35;;;440;2;;860;1;290;10
1957540;-35;;;450;8;;880;0;295;15
733250;-32;;;460;6;;900;0;300;17
271633;-31;;;470;5;;920;0;305;6
913392;-29;;;480;5;;940;0;310;5
1503608;-29;;;490;6;;960;1;315;9
1620962;-29;;;500;7;;980;0;320;3
1725747;-29;;;510;6;;1000;0;325;13
1823162;-29;;;520;1;;1020;0;330;3
2449289;-28;;;530;1;'''371 à 600;1040;1;335;5
1086603;-27;;;540;11;117;1060;0;340;11
783920;-26;;;550;2;4.7%;1080;0;345;4
2471206;-26;;;560;2;;1100;0;350;9
2107067;-25;;;570;4;'''601 à max;1120;0;355;10
292336;-23;;;580;5;26;1140;0;360;4
2553714;-23;;;590;2;1.0%;1160;1;365;8
2686151;-22;;;600;1;;;24;370;6
1577865;-21;;;reste;26;;reste;2;reste;143
500363;-20;;;total;2491;;total;2491;total;2491

cbn autres intercalaires[modifier | modifier le wikicode]

deb;°CDS;20118;206;comp;;deb;°CDS;1865810;45;;;deb;°CDS;2453380;324;comp
;&tRNA;20666;214;;;;gene;1866395;88;;;;&tRNA;2454880;39;comp
fin;°CDS;20956;;;;fin;°CDS;1867620;;comp;;;&tRNA;2455004;8;comp
deb;°CDS;34861;307;comp;;deb;°CDS;2029941;104;;;;&tRNA;2455088;4;comp
;&tRNA;36413;12;;;;&tRNA;2030816;48;comp;;;&tRNA;2455177;255;comp
;&tRNA;36500;13;;;;$rRNA;2030939;97;comp;;fin;°CDS;2455508;;
;&tRNA;36589;5;;;;&tRNA;2033939;7;comp;;deb;°CDS;2696774;138;comp
;&tRNA;36671;18;;;;&tRNA;2034023;124;comp;;;$rRNA;2697803;34;comp
;&tRNA;36765;12;;;;$rRNA;2034223;423;comp;;;$rRNA;2697946;237;comp
;&tRNA;36852;13;;;fin;°CDS;2036154;;comp;;;$rRNA;2701084;423;comp
;&tRNA;36941;5;;;deb;°CDS;2149914;128;comp;;deb;°CDS;2703019;183;comp
;&tRNA;37023;106;;;;$rRNA;2150504;34;comp;;;&tRNA;2703946;311;comp
fin;°CDS;37205;;comp;;;$rRNA;2150655;237;comp;;;&tRNA;2704333;13;comp
deb;°CDS;135851;168;comp;;;$rRNA;2153797;424;comp;;;$rRNA;2704422;336;comp
;&tRNA;137366;131;comp;;fin;°CDS;2155729;;comp;;;&tRNA;2704867;15;comp
fin;°CDS;137573;;comp;;deb;°CDS;2168490;590;;;;$rRNA;2704958;100;comp
deb;°CDS;161395;158;;;;$rRNA;2169533;35;comp;;;$rRNA;2705165;237;comp
;&tRNA;161964;5;;;;$rRNA;2169677;237;comp;;;$rRNA;2708303;346;comp
;&tRNA;162058;5;;;;$rRNA;2172816;111;comp;;fin;°CDS;2710157;;comp
;&tRNA;162139;46;;;fin;°CDS;2174439;;;;deb;°CDS;2720030;80;comp
;&tRNA;162262;5;;;deb;°CDS;2281037;144;;;;&tRNA;2721253;5;comp
;&tRNA;162356;30;;;;$rRNA;2283779;98;comp;;;$rRNA;2721334;98;comp
;&tRNA;162462;46;;;;$rRNA;2283983;237;comp;;;$rRNA;2721549;237;comp
;&tRNA;162585;5;;;;$rRNA;2287123;111;comp;;;$rRNA;2724689;393;comp
;&tRNA;162679;480;;;deb;°CDS;2288746;117;comp;;fin;°CDS;2726593;;comp
fin;°CDS;163235;;comp;;;&tRNA;2289103;15;comp;;deb;°CDS;2730964;245;comp
deb;°CDS;174610;115;;;;&tRNA;2289192;7;comp;;;&tRNA;2731902;61;comp
;&tRNA;176258;275;;;;&tRNA;2289276;233;comp;;;&tRNA;2732038;6;comp
fin;°CDS;176608;;;;fin;°CDS;2289585;;comp;;;&tRNA;2732119;4;comp
deb;°CDS;178351;453;;;deb;°CDS;2349136;199;comp;;;&tRNA;2732200;19;comp
;$rRNA;180181;237;;;;&tRNA;2350598;21;comp;;;&tRNA;2732293;16;comp
;$rRNA;181930;48;;;;&tRNA;2350696;28;comp;;;&tRNA;2732393;4;comp
;&tRNA;184882;14;;;;&tRNA;2350798;4;comp;;;$rRNA;2732472;100;comp
;$rRNA;184971;7;;;;&tRNA;2350878;4;comp;;;$rRNA;2732689;95;comp
;&tRNA;185095;435;;;;&tRNA;2350957;5;comp;;;&tRNA;2735687;3;comp
fin;°CDS;185605;;comp;;;&tRNA;2351038;3;comp;;;&tRNA;2735767;77;comp
deb;°CDS;221558;140;;;;&tRNA;2351116;6;comp;;;$rRNA;2735920;402;comp
;&tRNA;222409;106;;;;&tRNA;2351199;4;comp;;fin;°CDS;2737834;;comp
fin;°CDS;222591;;;;;&tRNA;2351277;21;comp;;deb;°CDS;2740228;408;comp
deb;°CDS;577193;60;;;;&tRNA;2351374;5;comp;;;&tRNA;2742262;111;comp
;&tRNA;578417;67;comp;;;&tRNA;2351455;5;comp;;deb;°CDS;2742463;64;comp
fin;°CDS;578560;;comp;;;&tRNA;2351537;5;comp;;;&tRNA;2743220;69;comp
deb;°CDS;943937;261;comp;;;&tRNA;2351616;3;comp;;deb;°CDS;2743382;65;comp
;&tRNA;944747;348;comp;;;&tRNA;2351694;22;comp;;;&tRNA;2743891;130;comp
fin;°CDS;945182;;;;;&tRNA;2351800;4;comp;;fin;°CDS;2744098;;
deb;°CDS;954881;59;;;;&tRNA;2351880;4;comp;;deb;°CDS;2746633;95;comp
;&tRNA;955546;82;;;;&tRNA;2351959;5;comp;;;&tRNA;2748534;144;comp
fin;°CDS;955713;;;;;&tRNA;2352040;5;comp;;;&tRNA;2748755;23;comp
deb;°CDS;1025682;379;;;;&tRNA;2352121;5;comp;;;&tRNA;2748869;69;comp
;&tRNA;1026946;17;;;;&tRNA;2352203;5;comp;;;&tRNA;2749029;61;comp
;&tRNA;1027039;14;;;;&tRNA;2352282;6;comp;;fin;°CDS;2749181;;comp
;&tRNA;1027130;4;;;;&tRNA;2352363;73;comp;;deb;°CDS;2758098;125;comp
;&tRNA;1027210;8;;;fin;°CDS;2352512;;comp;;;&tRNA;2758688;4;comp
;&tRNA;1027293;57;;;deb;°CDS;2430767;295;comp;;;&tRNA;2758768;3;comp
;&tRNA;1027425;265;;;;&tRNA;2432784;58;comp;;;$rRNA;2758848;76;comp
fin;°CDS;1027765;;;;fin;°CDS;2432918;;comp;;;$rRNA;2759041;237;comp
deb;°CDS;1679540;6;;;;;;;;;;$rRNA;2762179;369;comp
;gene;1680008;128;comp;;;;;;;;fin;°CDS;2764060;;comp
fin;°CDS;1681704;;comp;;;;;;;;;;;;

cbn intercalaires tRNA-cds[modifier | modifier le wikicode]

cbn;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
comp’;206;;214;;59;58;;
comp’;307;comp’;106;;64;61;'''deb;
;168;;131;;65;67;<201;12
;158;comp’;480;;80;69;total;18
;115;;275;;98;73;taux;67%
;;comp’;435;;115;82;;
;140;;106;;125;106;'''fin;
comp’;60;;67;;140;111;<201;9
;261;comp’;348;;158;131;total;12
;59;;82;;168;214;taux;75%
;379;;265;;183;265;;
comp’;104;;;;199;275;'''total;
;199;;73;;245;;<201;21
;295;;58;;261;;total;30
;324;comp’;255;;295;;taux;70%
;183;;;;324;;;
;80;;;;379;;;
;245;;;;408;;'''comp’;'''cumuls
;408;;111;;60;106;'''deb;2
;64;;69;;104;130;;4
;65;comp’;130;;206;255;'''fin;2
;98;;61;;307;348;;6
;125;;;;'''-;435;'''total;
;;;;;'''-;480;<201;4
;;;;;;;total;10
;;;;;;;taux;40%
;;;;;;;;
;;;;;;;;
;;;;;;;;
;;deb;fin;total;;;;
;<201;14;11;25;;;;
;total;22;18;40;;;;
;taux;64%;61%;63%;;;;

cle[modifier | modifier le wikicode]

cle opérons[modifier | modifier le wikicode]

34.3%GC;30.6.19 Paris;16s  11;104;doubles;intercalaires;;
;Clostridium lentocellum DSM 5427;;;;;;
;10157..10246;;agc;@1;202;;
;10449..11981;;16s;;72;;
;12054..12171;;5s;;4;;
;12176..12248;;gca;;262;;
;12511..15414;;23s;;55;;
;15470..15543;;gac;;61;;61
;15605..15677;;gta;;7;;7
;15685..15757;;aca;;34;;34
;15792..15872;;tac;;12;;12
;15885..15961;;atgj;;3;;3
;15965..16040;;ttc;;3;;3
;16044..16116;;aaa;;;;
;;;;;30118;;
;46235..47767;;16s;@3;21284;;
;;;;;;;
;69052..71964;;23s;;;;
;;;;;4873;;
;76838..78371;;16s;;72;;
;78444..78561;;5s;;5;;
;78567..78639;;gca;;282;;
;78922..81829;;23s;;;;
;;;;;904;;
;82734..82851;;5s;;4;;
;82856..82928;;ggc;;;;
;;;;;1463;;
;84392..85929;;16s;;72;;
;86002..86119;;5s;;4;;
;86124..86196;;gca;;280;;
;86477..89386;;23s;;;;
;;;;;7380;;
;96767..96884;;5s;;89;;
;96974..97047;;ggc;;;;
;;;;;5082;;
;102130..102204;;cag;;;;
;;;;;;;
;104716..104799;;tta;;13;13;
;104813..104898;;tca;;;;
;;;;;;;
;141499..143034;;16s;;138;;
;143173..143290;;5s;;7;;
;143298..143374;;atc; ;258;;
;143633..146538;;23s;;;;
;;;;;;;
;150968..151085;;5s;@4;4;;
;151090..151161;;gaa;;457;;
;151619..153160;;16s;;605;;
;153766..156671;;23s;;475;;
;157147..157219;;aaa;;9;;9
;157229..157299;;gga;;6;;6
;157306..157379;;aga;;;;
;;;;;4223;;
;161603..161720;;5s;;4;;
;161725..161797;;ggc;;;;
;;;;;11104;;
;172902..172973;;gaa;;23;23;
;172997..173071;;cca;;45;45;
;173117..173189;;aaa;;11;11;
;173201..173274;;gac;;56;56;
;173331..173403;;gta;;7;7;
;173411..173494;;tta;;187;187;
;173682..173754;;aca;;26;26;
;173781..173861;;tac;;10;10;
;173872..173948;;atgj;;31;31;
;173980..174052;;ttc;;;;
;;;;;248498;;
;422551..424086;;16s;;;;
;;;;;113898;;
;537985..540890;;23s;;;;
;;;;;25153;;
;566044..566117;;cac;;23;23;
;566141..566212;;caa;;32;32;
;566245..566330;;tca;;;;
;;;;;;;
;571984..573519;;16s;;72;;
;573592..573709;;5s;;4;;
;573714..573786;;gca;;282;;
;574069..576975;;23s;;;;
;;;;;25302;;
;602278..603812;;16s;;137;;
;603950..604067;;5s;;;;
;;;;;11014;;
;615082..617987;;23s;;;;
;;;;;21159;;
;639147..639362;;16s°;@5;;;
;;;;;98139;;
;737502..737619;;5s;;4;;
;737624..737696;;ggc;;;;
;;;;;3291;;
;740988..741058;;gga;;;;
;;;;;;;
;759839..759920;;cta;;;;
;;;;;;;
;911999..912083;;ctt;+;148;148;
;912232..912316;;ctt;2 ctt;;;
;;;;;;;
;1035192..1035265;;cga;;;;
;;;;;;;
;1061152..1061225;;agg;;;;
;;;;;;;
comp;1136376..1136448;;ccc;;;;
;;;;;;;
;1229184..1230718;;16s;@2;72;;
;1230791..1230908;;5s;;7;;
;1230916..1230989;;atc;;53;;53
;1231043..1231115;;gca;;261;;
;1231377..1234282;;23s;;110;;
;1234393..1234464;;aac;+;9;;9
;1234474..1234545;;gaa;2 tgc ;6;;6
;1234552..1234622;;tgc;2 aac;23;;23
;1234646..1234717;;aac;;58;;58
;1234776..1234846;;tgc;;;;
;;;;;;;
;1280211..1280283;;atgf;;;;
;;;;;;;
;1283250..1283320;;gga;+;5;5;
;1283326..1283399;;aga;2 gga;5;5;
;1283405..1283478;;cac;2 aga;31;31;
;1283510..1283581;;caa;2 caa;23;23;
;1283605..1283677;;aaa;;30;30;
;1283708..1283792;;cta;;23;23;
;1283816..1283886;;gga;;5;5;
;1283892..1283965;;aga;;6;6;
;1283972..1284043;;caa;;;;
;;;;;;;
;1299560..1299632;;ggc;;4;4;
;1299637..1299711;;cca;;;;
;;;;;;;
;1346208..1346290;;ctg;;;;
;;;;;;;
;1363346..1363428;;ctg;;;;
;;;;;;;
;1515234..1515305;;gaa;;62;62;
;1515368..1515442;;cca;;22;22;
;1515465..1515537;;aaa;;;;
;;;;;;;
;1597292..1597364;;acg;;;;
;;;;;;;
;1611976..1612042;;acg;;;;
;;;;;;;
;2065352..2065425;;ata;;;;
;;;;;;;
comp;2090478..2090550;;acc;;;;
;;;;;;;
;2394421..2394501;;tac;;3;3;
;2394505..2394577;;ttc;;;;
;;;;;;;
;2592342..2592422;;ttg;;;;
;;;;;;;
;2606024..2606104;;ttg;;;;
;;;;;;;
comp;2737232..2737304;;gcc;;;;
;;;;;;;
comp;2798802..2798874;;aag;;;;
;;;;;;;
comp;2881571..2881642;;gag;;;;
;;;;;;;
comp;3215471..3215545;;cca;;;;
;;;;;;;
comp;3252582..3252655;;atgj;;7;7;
comp;3252663..3252735;;gta;;4;4;
comp;3252740..3252813;;gac;;10;10;
comp;3252824..3252896;;tgg;;20;20;
comp;3252917..3252988;;aac;;;;
;;;;;683;;
comp;3253672..3253748;;atgj;;7;;7
comp;3253756..3253828;;gta;;9;;9
comp;3253838..3253910;;tgg;;18;;18
comp;3253929..3254000;;aac;;60;;
comp;3254061..3256967;;23s;;;;
;;;;;362637;;
comp;3619605..3619677;;aca;+;4;;4
comp;3619682..3619755;;cgt;2 cgt;50;;50
comp;3619806..3619879;;cgt;2 aca;27;;27
comp;3619907..3619990;;tta;;3;;3
comp;3619994..3620069;;gta;;47;;47
comp;3620117..3620190;;gac;;22;;22
comp;3620213..3620289;;atgi;;23;;23
comp;3620313..3620385;;aca;;14;;14
comp;3620400..3620471;;gaa;;9;;9
comp;3620481..3620552;;aac;;110;;
comp;3620663..3623568;;23s;;261;;
comp;3623830..3623902;;gca;;53;;53
comp;3623956..3624029;;atc;;7;;
comp;3624037..3624154;;5s;;72;;
comp;3624227..3625761;;16s;;149;;
comp;3625911..3625999;;tcc;;33;;33
comp;3626033..3626118;;tca;;;;
;;;;;;;
comp;3714637..3714709;;gta;;1;1;
comp;3714711..3714787;;atgj;;;;

cle cumuls[modifier | modifier le wikicode]

cle cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;19;1;1;0
;16 5 aa 23;5;20;14;15
;16 5 atc gca;2;40;10;6
;solo;11;60;2;5
;max a;14;80;1;1
;a doubles;2;100;0;0
;indéterminé;1;120;0;0
;total aas;46;140;0;0
sans ;opérons;29;160;1;0
;1 aa;19;180;0;0
;max a;10;200;1;0
;a doubles;2;;0;0
;total aas;59;;30;27
total aas;;105;;;
remarques;;5;;;
avec jaune;;;moyenne;29;
;;;variance;41;
sans jaune;;;moyenne;19;22
;;;variance;16;19

cle blocs[modifier | modifier le wikicode]

cle blocs;;;
Solitaires;;;
16s;*2;16s°;@5
;;;
23s;*3;;
;;;
5s;3*4;89;
ggc;;;
;;;
aac;60;;
23s;;;
;;;
16s;137;;
5s;;;
;;;
16s;72;72;72
5s;5;4;4
gca;282;280;282
23s;;;
;;;
;;agc;202
16s;138;16s;72
5s;7;5s;4
atc;258;gca;262
23s;;23s;55
;;gac;61
;;;
;;;
;;aac;110
16s;72;23s;261
5s;7;gca;53
atc;53;atc;7
gca;261;5s;72
23s;110;16s;149
aac;9;tcc;33
;;;
;;;
5s;4;;@4
gaa;457;;
16s;605;;
23s;475;;
aaa;9;;

cle distribution[modifier | modifier le wikicode]

atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;
att;;act;;aat;;agt;;après 16s;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;1-3;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;(atcgca)2;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;;aaa;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gca4;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;aga;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;atc1;ttc;2;tcc;;tac;2;tgc;;;ttc;;tcc;;tac;;tgc;;gga;ttc;1;tcc;;tac;1;tgc;2
atc;;acc;1;aac;;agc;;;atc;;acc;;aac;1;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;4;agc;
ctc;;ccc;1;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;;;ctc;;ccc;;cac;;cgt;;après 5s;ctc;;ccc;;cac;;cgt;2
gtc;;gcc;1;gac;;ggc;;16s5saa23s;gtc;;gcc;;gac;2;ggc;1;;gtc;;gcc;;gac;;ggc;;4 ggc;gtc;;gcc;;gac;2;ggc;
tta;;tca;;taa;;tga;;;tta;2;tca;2;taa;;tga;;;tta;;tca;;taa;;tga;;gaa;tta;1;tca;;taa;;tga;
ata;1;aca;;aaa;;aga;;;ata;;aca;1;aaa;3;aga;2;;ata;;aca;;aaa;;aga;;;ata;;aca;3;aaa;1;aga;
cta;1;cca;1;caa;;cga;1;;cta;1;cca;3;caa;3;cga;;;cta;;cca;;caa;;cga;;cgt2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;1;;gta;3;gca;;gaa;2;gga;2;;gta;;gca;;gaa;;gga;;ctt2;gta;3;gca;;gaa;2;gga;
ttg;2;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1
atgj;;acg;2;aag;1;agg;1;;atgj;3;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;16s5saa23s;atgj;2;acg;;aag;;agg;
ctg;2;ccg;;cag;1;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
cle;;19;;;;;19;;cle;38;;;;;;38;;cle;2;;;;;;2;;cle;;;;26;3;9;26
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8  1-3aas;;;

hmo[modifier | modifier le wikicode]

hmo opérons[modifier | modifier le wikicode]

57%GC;24.7.19 Paris;16s ;109;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Heliobacterium modesticaldum Ice1 ATCC 51547 ;;;;;;;;;;
;103699..104088;;CDS;;380;;;;130;
;;;;;;;;;;
;104469..105695;;CDS;;186;186;;;409;186
comp;105882..105956;;ggc;;1;;1;;;
comp;105958..106044;;ctg;;321;321;;;;
comp;106366..106929;;CDS;@1;241;241;;;188;241
comp;107171..107246;;aca;;202;202;;;;202
comp;107449..108183;;CDS;;111772;;;;245;
;;;;;;;;;;
comp;219956..220483;;CDS;;260;260;;;176;260
comp;220744..220820;;gac;;5;;;5;;
comp;220826..220901;;gta;;10;;;10;;
comp;220912..220987;;gaa;;4;;;4;;
comp;220992..221067;;aaa;;18;;;18;;
comp;221086..221160;;caa;;103;;;;;
comp;221264..224182;;23s;;237;;;;;
comp;224420..224495;;gcc;;64;;;;;
comp;224560..224676;;5s;@2;328;;;;;
comp;225005..226536;;16s;;651;651;;;;
comp;227188..228162;;CDS;;98792;;;;325;
;;;;;;;;;;
comp;326955..328340;;CDS;;178;178;;;462;178
comp;328519..328601;;cta;;65;;65;;;
comp;328667..328743;;aga;;60;;60;;;
comp;328804..328880;;cca;;568;568;;;;
comp;329449..330090;;CDS;;57730;;;;214;
;;;;;;;;;;
comp;387821..388105;;CDS;;135;135;;;95;
;388241..388317;;ccc;;7;;7;;;
;388325..388410;;tac;;47;47;;;;47
comp;388458..388742;;CDS;;588493;;;;95;
;;;;;;;;;;
comp;977236..978504;;CDS;;439;439;;;423;
comp;978944..981860;;23s;;237;;;;;
comp;982098..982173;;gcc;;64;;;;;
comp;982238..982354;;5s;;328;;;;;
comp;982683..984208;;16s;;460;;;;;
comp;984669..984744;;tgg;@3;5;;;5;;
comp;984750..984824;;cgg;;207;207;;;;207
comp;985032..987656;;CDS;;26258;;;;875;
;;;;;;;;;;
comp;1013915..1014760;;CDS;;105;105;;;282;105
comp;1014866..1014942;;gac;;75;;75;;;
comp;1015018..1015093;;gaa;;265;265;;;;
comp;1015359..1016642;;CDS;;40115;;;;428;
;;;;;;;;;;
;1056758..1058014;;CDS;;121;121;;;419;121
comp;1058136..1058233;;tga;;173;173;;;;
;1058407..1058733;;CDS;;62951;;;;109;
;;;;;;;;;;
;1121685..1122878;;CDS;;588;588;;;398;
;1123467..1124998;;16s;;328;;;;;
;1125327..1125443;;5s;;64;;;;;
;1125508..1125583;;gcc;;233;;;;;
;1125817..1128734;;23s;;337;337;;;;337
>;1129072..1129785;;CDS;;24938;;;;238;
;;;;;;;;;;
;1154724..1155224;;CDS;;99;99;;;167;
;1155324..1155413;;tca;;56;56;;;;56
comp;1155470..1156627;;CDS;;13350;;;;386;
;;;;;;;;;;
;1169978..1171828;;CDS;;129;129;;;617;129
;1171958..1172034;;cgt;;85;;85;;;
;1172120..1172196;;agg;;181;181;;;;
;1172378..1172812;;CDS;;62;62;;;145;62
;1172875..1172966;;tcg;;548;548;;;;
;1173515..1174330;;CDS;;6655;;;;272;
;;;;;;;;;;
comp;1180986..1182974;;CDS;;444;444;;;663;
;1183419..1183512;;tcc;;39;39;;;;39
;1183552..1183817;;ncRNA;;11908;;;;89;
;;;;;;;;;;
;1195726..1195998;;CDS;;181;181;;;91;
;1196180..1196255;;gcg;;151;151;;;;151
;1196407..1197051;;CDS;;86894;;;;215;
;;;;;;;;;;
comp;1283946..1285331;;CDS;;177;177;;;462;177
;1285509..1285584;;atgf;;5;;5;;;
;1285590..1285667;;atgj;;7;;7;;;
;1285675..1285750;;gaa;;542;542;;;;
;1286293..1287630;;CDS;;63447;;;;446;
;;;;;;;;;;
;1351078..1352549;;CDS;;704;704;;;491;
;1353254..1354786;;16s;;252;;;;;
;1355039..1355155;;5s;;64;;;;;
;1355220..1355296;;atc;;194;;;;;
;1355491..1358408;;23s;;112;;;;;
;1358521..1358595;;aac;;109;109;;;;109
comp;1358705..1358926;;CDS;;139555;;;;74;
;;;;;;;;;;
;1498482..1498898;;CDS;;535;535;;;139;
comp;1499434..1499509;;acg;;238;238;;;;238
;1499748..1500836;;CDS;;262182;;;;363;
;;;;;;;;;;
;1763019..1763858;;CDS;;68;68;;;280;68
;1763927..1764003;;gac;;4;;4;;;
;1764008..1764083;;ttc;;3;;3;;;
;1764087..1764161;;ggc;;92;92;;;;
comp;1764254..1764493;;CDS;;72;72;;;80;72
;1764566..1764641;;tgc;;18;;18;;;
;1764660..1764746;;tta;;253;253;;;;
comp;1765000..1765467;;CDS;;52131;;;;156;
;;;;;;;;;;
;1817599..1818318;;CDS;;487;487;;;240;
;1818806..1820337;;16s;;252;;;;;
;1820590..1820706;;5s;;64;;;;;
;1820771..1820847;;atc;;6;;;6;;
;1820854..1820929;;gca;;229;;;;;
;1821159..1824076;;23s;;112;;;;;
;1824189..1824263;;aac;;6;;;6;;
;1824270..1824345;;atgf;;243;243;;;;243
;1824589..1825014;;CDS;;168198;;;;142;
;;;;;;;;;;
;1993213..1994328;;CDS;;99;99;;;372;
;1994428..1994502;;atgi;;41;41;;;;41
;1994544..1995368;;CDS;;284281;;;;275;
;;;;;;;;;;
;2279650..2279997;;CDS ;;541;541;;;116;
;2280539..2282070;;16s;;253;;;;;
;2282324..2282440;;5s;;64;;;;;
;2282505..2282580;;gcc;;234;;;;;
;2282815..2285735;;23s;;119;;;;;
;2285855..2285948;;tcc;;6;;;6;;
;2285955..2286031;;ccg;;10;;;10;;
;2286042..2286115;;gga;;14;;;14;;
;2286130..2286205;;cac;;1;;;1;;
;2286207..2286281;;tgc;;9;;;9;;
;2286291..2286367;;gtc;;3;;;3;;
;2286371..2286446;;ttc;;6;;;6;;
;2286453..2286537;;tac;;4;;;4;;
;2286542..2286616;;caa;;17;;;17;;
;2286634..2286709;;aaa;;4;;;4;;
;2286714..2286789;;gaa;;5;;;5;;
;2286795..2286870;;gta;;5;;;5;;
;2286876..2286952;;gac;;7;;;7;;
;2286960..2287050;;agc;;43;;;43;;
;2287094..2287170;;ccc;;30;;;30;;
;2287201..2287287;;ctg;;3;;;3;;
;2287291..2287365;;ggc;;4;;;4;;
;2287370..2287446;;cgt;;4;;;4;;
;2287451..2287526;;acc;;352;352;;;;352
;2287879..2288343;;CDS ;;33184;;;;155;
;;;;;;;;;;
comp;2321528..2322544;;CDS ;;268;268;;;339;
comp;2322813..2322889;;gtc;;9;;9;;;
comp;2322899..2322973;;cgg;;81;81;;;;81
comp;2323055..2323243;;CDS ;;3375;;;;63;
;;;;;;;;;;
;2326619..2327947;;CDS ;;464;464;;;443;464
;2328412..2329943;;16s;;327;;;;;
;2330271..2330387;;5s;;226;;;;;
;2330614..2333532;;23s;;98;;;;;
;2333631..2333706;;aaa;;4;;;4;;
;2333711..2333786;;acc;;8;;;8;;
;2333795..2333877;;ctc;;89;89;;;;89
comp;2333967..2334704;;CDS;;7389;;;;246;
;;;;;;;;;;
;2342094..2342804;;CDS;;155;155;;;237;155
comp;2342960..2343030;;ttc;;213;213;;;;
;2343244..2343936;;CDS;;563;563;;;231;
;2344500..2346025;;16s;;252;;;;;
;2346278..2346394;;5s;;64;;;;;
;2346459..2346535;;atc;;141;;;;;
;2346677..2349594;;23s;;100;;;;;
;2349695..2349769;;aac;;6;;;6;;
;2349776..2349851;;atgf;;102;102;;;;102
;2349954..2350976;;CDS;;113601;;;;341;
;;;;;;;;;;
;2464578..2465114;;CDS;;271;271;;;179;271
comp;2465386..2465461;;aca;;432;432;;;;
;2465894..2466226;;CDS;;4722;;;;111;
;;;;;;;;;;
;2470949..2471977;;CDS;;69;69;;;343;69
;2472047..2472133;;ctg;;678;678;;;;
;2472812..2473192;;CDS;;22232;;;;127;
;;;;;;;;;;
;2495425..2496048;;CDS;;402;402;;;208;
comp;2496451..2496527;;gtc;;4;;4;;;
comp;2496532..2496609;;atgj;;175;175;;;;175
;2496785..2497120;;CDS;;217;217;;;112;
comp;2497338..2497420;;ctc;;7;;7;;;
comp;2497428..2497503;;acc;;18;;18;;;
comp;2497522..2497596;;tgg;;14;;14;;;
comp;2497611..2497684;;ggg;;19;;19;;;
comp;2497704..2497778;;ggc;;7;;7;;;
comp;2497786..2497873;;ttg;;8;;8;;;
comp;2497882..2497958;;gtg;;-10;-10;;;;-10
comp;2497949..2498185;;CDS;;66;66;;;79;66
;2498252..2498328;;ccg;;314;314;;;;
comp;2498643..2499506;;CDS;;55292;;;;288;
;;;;;;;;;;
;2554799..2554984;;CDS;;109;109;;;62;109
;2555094..2555169;;gaa;;2;;2;;;
;2555172..2555247;;ttc;;6;;6;;;
;2555254..2555338;;tac;;4;;4;;;
;2555343..2555417;;caa;;18;;18;;;
;2555436..2555511;;aaa;;4;;4;;;
;2555516..2555590;;ggc;;9;;9;;;
;2555600..2555675;;cac;;117;117;;;;
comp;2555793..2557049;;CDS;;235940;;;;419;
;;;;;;;;;;
comp;2792990..2793442;;CDS;;219;219;;;151;219
comp;2793662..2796583;;23s;;236;;;;;
comp;2796820..2796895;;gca;;6;;;6;;
comp;2796902..2796978;;atc;;64;;;;;
comp;2797043..2797159;;5s;;328;;;;;
comp;2797488..2799019;;16s;;505;;;;;
comp;2799525..2799599;;ggc;+;1;;;1;;
comp;2799601..2799687;;ctg;2 ggc;32;;;32;;
comp;2799720..2799796;;ccc;;42;;;42;;
comp;2799839..2799915;;cgt;;4;;;4;;
comp;2799920..2799994;;ggc;;120;;;120;;
comp;2800115..2800192;;atgj;;42;;;42;;
comp;2800235..2800325;;agc;;16;;;16;;
comp;2800342..2800417;;atgf;;6;;;6;;
comp;2800424..2800498;;aac;;7;;;7;;
comp;2800506..2800581;;gaa;;4;;;4;;
comp;2800586..2800661;;aaa;;18;;;18;;
comp;2800680..2800754;;caa;;4;;;4;;
comp;2800759..2800843;;tac;;91;;;91;;
comp;2800935..2801011;;gtc;;7;;;7;;
comp;2801019..2801093;;tgc;;325;325;;;;
;2801419..2801724;;CDS;;230813;;;;102;
;;;;;;;;;;
;3032538..3032729;;CDS;;109;109;;;64;109
comp;3032839..3035757;;23s;;233;;;;;
comp;3035991..3036066;;gcc;;64;;;;;
comp;3036131..3036247;;5s;;253;;;;;
comp;3036501..3038026;;16s;;779;779;;;;
comp;3038806..3040017;;CDS;;232;;;;404;
;;;;;;;;;;
comp;3040250..3042013;;CDS;;;;;;588;

hmo cumuls[modifier | modifier le wikicode]

hmo cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;1;2;1;1;40;1;100;10
;16 5s gcc 23;5;20;20;34;50;3;80;8;200;16
;16 5s atc 23;2;40;0;2;100;11;120;7;300;14
;16 5 23s a;1;60;1;3;150;9;160;4;400;8
;max a;20;80;2;0;200;9;200;4;500;11
;a doubles;1;100;1;1;250;8;240;4;600;0
;16 5s atc gca;2;120;0;1;300;5;280;4;700;2
;total aas;60;140;0;0;350;4;320;0;800;0
sans ;opérons;24;160;0;0;400;1;360;2;900;1
;1 aa;12;180;0;0;450;4;400;0;1000;0
;max a;7;200;0;0;500;2;440;0;1100;0
;a doubles;0;;0;0;;11;;1;;0
;total aas;49;;25;43;;68;;35;;62
total aas;;109;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;8;8;;196;;137;;230
;;;variance;6;7;;120;;71;;128

hmo blocs[modifier | modifier le wikicode]

hmo blocs;;;;;tgg
CDS ;541;651;588;779;460
16s;253;328;328;253;328
5s;64;64;64;64;64
gcc;234;237;233;233;237
23s;119;103;337;109;439
tcc;tcc;caa;cds;cds;cds
;;;;;
CDS;704;563;;CDS ;464
16s;252;252;;16s;327
5s;64;64;;5s;226
atc;194;141;;23s;98
23s;112;100;;aaa;
aac;aac;aac;;;
;;;;;
;;ggc;;;
CDS;487;505;;;
16s;252;328;;;
5s;64;64;;;
atc;6;6;;;
gca;229;236;;;
23s;112;219;;;
aac;aac;cds;;;

hmo distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;;;;;;;;;1-3 aas;atgi;;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;ctc;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;acc;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;3 aac;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;;;ttc;2;tcc;;tac;2;tgc;1;;;;;;;;;;aaa;ttc;1;tcc;1;tac;2;tgc;2
atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;;;;;;;;;;;2 atgf;atc;;acc;1;aac;1;agc;2
ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;1;cac;1;cgt;1;;;;;;;;;;tgg;ctc;;ccc;2;cac;1;cgt;2
gtc;;gcc;;gac;;ggc;;;gtc;2;gcc;;gac;2;ggc;4;;;;;;;;;;cgg;gtc;2;gcc;;gac;2;ggc;3
tta;;tca;1;taa;;tga;1;;tta;1;tca;;taa;;tga;;;;;;;;;;;;tta;;tca;;taa;;tga;
ata;;aca;2;aaa;;aga;;;ata;;aca;;aaa;1;aga;1;;;;;;;;;;;ata;;aca;;aaa;3;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;1;cga;;;;;;;;;;;;cta;;cca;;caa;3;cga;
gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;3;gga;;;;;;;;;;;;gta;2;gca;;gaa;3;gga;1
ttg;;tcg;1;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1;;;;;;;;;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;;;atgj;2;acg;;aag;;agg;1;;;;;;;;;;;atgj;1;acg;;aag;;agg;
ctg;1;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;;;;;;;;;;ctg;2;ccg;1;cag;;cgg;
gtg;;gcg;1;gag;;ggg;;;gtg;1;gcg;;gag;;ggg;1;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
hmo;;12;;;;;12;;hmo;37;;;;;;37;;;;;;;;;;;hmo;;;;39;;11;39
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;10 1-3 aas;;;

cbei[modifier | modifier le wikicode]

cbei opérons[modifier | modifier le wikicode]

29.65%GC;29.7.19 Paris;16s 16 ;;;;;;;;
Clostridium beijerinckii strain NCIMB 14988;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
;6477551..6480031;;CDS;;496;496;;;827;
;6480528..6482044;;16s;;213;;;;;
;6482258..6485171;;23s;;108;;;;;
;6485280..6485394;;5s;;14;;;;;
;15..91;;atgi;;1;;;1;;
;93..168;;gca;;85;85;;;;85
;254..769;;CDS;;1940;;;;172;
;;;;;;;;;;
;2710..2937;;CDS;;119;119;;;76;119
;3057..3147;;tca;+;30;;30;;;
;3178..3268;;agc;2 tca;241;;*241;;;
;3510..3600;;tca;2 agc;18;;18;;;
;3619..3709;;agc;;125;125;;;;
;3835..4350;;CDS;;9470;;;;172;
;;;;;;;;;;
;13821..14726;;CDS;;187;187;;;302;
;14914..14988;;cgt;;34;34;;;;34
comp;15023..15913;;CDS;;109014;;;;297;
;;;;;;;;;;
;124928..125338;;CDS;;275;275;;;137;275
;125614..125702;;tta;+;20;;20;;;
;125723..125798;;atgf;4 tta;7;;7;;;
;125806..125882;;atgj;4 atgf;6;;6;;;
;125889..125977;;tta;2 atgj;22;;22;;;
;126000..126075;;atgf;;7;;7;;;
;126083..126159;;atgj;;6;;6;;;
;126166..126254;;tta;;21;;21;;;
;126276..126351;;atgf;;70;;70;;;
;126422..126510;;tta;;21;;21;;;
;126532..126607;;atgf;;664;664;;;;
;127272..129683;;CDS;;8954;;;;804;
;;;;;;;;;;
;138638..140143;;CDS;;307;307;;;502;
;140451..140525;;aac;+;234;;*234;;;
;140760..140834;;aac;3 aac;439;;*439;;;
;141274..141348;;aac;@6;299;299;;;;299
;141648..143039;;CDS;;1587;;;;464;
;;;;;;;;;;
comp;144627..145649;;CDS;;543;543;;;341;
;146193..147709;;16s;;140;;;;;
;147850..147925;;gca;;3;;;3;;
;147929..148005;;atc;;111;;;;;
;148117..151030;;23s;;70;;;;;
;151101..151217;;5s;;5;;;5;;
;151223..151298;;ttc;;4;;;;;
;151303..151377;;tgc;;167;167;;;;167
;151545..151841;;CDS;;25608;;;;99;
;;;;;;;;;;
;177450..178097;;CDS;;76;76;;;216;
;178174..178249;;acc;;65;65;;;;65
;178315..179508;;CDS;;134221;;;;398;
;;;;;;;;;;
;313730..316207;;CDS;;90;90;;;826;90
;316298..316382;;cta;;4;;4;;;
;316387..316461;;ggg;;120;120;;;;
comp;316582..316986;;CDS;;85487;;;;135;
;;;;;;;;;;
;402474..402953;;CDS;;125;125;;;160;125
;403079..403154;;cca;+;17;;17;;;
;403172..403245;;gga;2x;149;;*149;;;
;403395..403471;;aga;cca gga aga;6;;6;;;
;403478..403553;;cca;;16;;16;;;
;403570..403643;;gga;;35;;35;;;
;403679..403755;;aga;;5;;5;;;
;403761..403836;;cac;;3;;3;;;
;403840..403914;;caa;2x;7;;7;;;
;403922..403997;;aaa;caa aaa cta ;18;;18;;;
;404016..404100;;cta;ggc gga ;5;;5;;;
;404106..404180;;ggc;;25;;25;;;
;404206..404279;;gga;;5;;5;;;
;404285..404360;;aag;;57;;57;;;
;404418..404492;;caa;;7;;7;;;
;404500..404575;;aaa;;18;;18;;;
;404594..404678;;cta;;5;;5;;;
;404684..404758;;ggc;;25;;25;;;
;404784..404857;;gga;;46;;46;;;
;404904..404980;;cga;;325;325;;;;
<;405306..405467;;CDS;;8393;;;;54;
;;;;;;;;;;
;413861..415921;;CDS;;385;385;;;687;
;416307..417823;;16s;@5;132;;;;;
;417956..418032;;atc;;84;;;;;
;418117..421031;;23s;;71;;;;;
;421103..421177;;aac;;345;345;;;;345
;421523..422449;;CDS;;63814;;;;309;
;;;;;;;;;;
;486264..486668;;CDS;;159;159;;;135;159
;486828..486912;;tac;+;9;;9;;;
;486922..486997;;gta;3 tac;27;;27;;;
;487025..487099;;aca;2 gta;12;;12;;;
;487112..487196;;tac;2 aca;9;;9;;;
;487206..487281;;gta;;30;;30;;;
;487312..487386;;aca;;12;;12;;;
;487399..487483;;tac;;451;451;;;;
;487935..489110;;CDS;;50956;;;;392;
;;;;;;;;;;
;540067..540969;;CDS;;187;187;;;301;187
;541157..541231;;tgg;;208;208;;;;
;541440..541820;;CDS;;97;;;;127;
;;;;;;;;;;
comp;541918..542985;;CDS;;252;252;;;356;252
;543238..543312;;tgg;;354;354;;;;
;543667..544683;;CDS;;347735;;;;339;
;;;;;;;;;;
;892419..893339;;CDS;;560;560;;;307;
;893900..895416;;16s;;137;;;;;
;895554..895629;;gca;;118;;;;;
;895748..898661;;23s;;204;;;;;
;898866..898982;;5s;;552;552;;;;*552
;899535..900446;;CDS;;351;;;;304;
;;;;;;;;;;
;900798..902048;;CDS;;704;704;;;417;
;902753..904269;;16s;;339;;;;;
;904609..907522;;23s;;273;;;;;
;907796..907912;;5s;;69;69;;;;69
comp;907982..908449;;CDS;;43545;;;;156;
;;;;;;;;;;
;951995..952630;;CDS;;97;97;;;212;97
;952728..952813;;ctc;;396;396;;;;
;953210..954919;;CDS;;784414;;;;570;
;;;;;;;;;;
;1739334..1739933;;CDS;;380;380;;;200;380
;1740314..1740389;;cac;;3;;3;;;
;1740393..1740467;;cag;;5;;5;;;
;1740473..1740548;;aaa;;443;443;;;;
comp;1740992..1742350;;CDS;;151829;;;;453;
;;;;;;;;;;
;1894180..1895406;;CDS;;34;34;;;409;34
comp;1895441..1895527;;ttg;;574;574;;;;
;1896102..1896794;;CDS;;200701;;;;231;
;;;;;;;;;;
;2097496..2097915;;CDS;;722;722;;;140;
;2098638..2100154;;16s;;502;;;;;
;2100657..2103569;;23s;;205;;;;;
;2103775..2103891;;5s;;315;315;;;;315
;2104207..2104905;;CDS;;234313;;;;233;
;;;;;;;;;;
;2339219..2340322;;CDS;;662;662;;;368;
;2340985..2342501;;16s;;338;;;;;
;2342840..2345755;;23s;;140;;;;;
;2345896..2345970;;aac;;3;;;;;
;2345974..2346090;;5s;;429;429;;;;429
;2346520..2348088;;CDS;;3574;;;;523;
;;;;;;;;;;
;2351663..2352139;;CDS;;568;568;;;159;
;2352708..2354224;;16s;;338;;;;;
;2354563..2357477;;23s;;140;;;;;
;2357618..2357692;;aac;;3;;;;;
;2357696..2357812;;5s;;90;90;;;;90
;2357903..2358316;;CDS;;406783;;;;138;
;;;;;;;;;;
;2765100..2765525;;CDS;;625;625;;;142;
;2766151..2767667;;16s;;503;;;;;
;2768171..2771082;;23s;;202;;;;;
;2771285..2771401;;5s;;5;;;;;
;2771407..2771482;;ttc;;6;;;6;;
;2771489..2771565;;gac;;25;;;25;;
;2771591..2771665;;gaa;;448;448;;;;448
;2772114..2774864;;CDS;;781818;;;;917;
;;;;;;;;;;
;3556683..3557051;;CDS;;565;565;;;123;*565
;3557617..3557691;;gag;;925;925;;;;
comp;3558617..3559759;;CDS;;192275;;;;381;
;;;;;;;;;;
comp;3752035..3752652;;CDS;;245;245;;;206;245
comp;3752898..3752985;;agt;@1;711;711;;;;
comp;3753697..3755112;;CDS;;501326;;;;472;
;;;;;;;;;;
comp;4256439..4258403;;CDS;;267;267;;;655;267
comp;4258671..4258746;;aaa;;79;;79;;;
comp;4258826..4258901;;cac;;7;;7;;;
comp;4258909..4258985;;aga;;35;;35;;;
comp;4259021..4259094;;gga;;752;752;;;;
;4259847..4260392;;CDS;;619853;;;;182;
;;;;;;;;;;
comp;4880246..4880488;;CDS;;508;508;;;81;*508
comp;4880997..4881113;;5s;;274;;;;;
comp;4881388..4884300;;23s;;578;;;;;
comp;4884879..4886395;;16s;;703;703;;;;
comp;4887099..4888034;;CDS;;1272704;;;;312;
;;;;;;;;;;
comp;6160739..6161977;;CDS;;343;343;;;413;
;6162321..6162396;;cca;;242;242;;;;242
;6162639..6163283;;CDS;;2040;;;;215;
;;;;;;;;;;
;6165324..6165734;;CDS;;222;222;;;137;
comp;6165957..6166032;;ttc;;5;;;;;
comp;6166038..6166154;;5s;@2;188;188;;;;188
;6166343..6167074;;CDS;;8085;;;;244;
;;;;;;;;;;
comp;6175160..6175597;;CDS;;249;249;;;146;249
comp;6175847..6175922;;gca;;1;;;1;;
comp;6175924..6176000;;atgi;;44;;;;;
comp;6176045..6176161;;5s;;138;;;;;
comp;6176300..6179216;;23s;;339;;;;;
comp;6179556..6181072;;16s;;567;567;;;;
comp;6181640..6182446;;CDS;;223;;;;269;
;;;;;;;;;;
;6182670..6183419;;CDS;;190;190;;;250;190
comp;6183610..6183685;;aaa;+;5;;;;;
comp;6183691..6183807;;5s;2 aaa;159;159;;;;159
comp;6183967..6184914;;CDS;@3;294;294;;;316;294
comp;6185209..6185284;;aaa;;7;;;;;
comp;6185292..6185408;;5s;;138;;;;;
comp;6185547..6188463;;23s;;339;;;;;
comp;6188803..6190319;;16s;;771;771;;;;
comp;6191091..6192203;;CDS;;7306;;;;371;
;;;;;;;;;;
comp;6199510..6202059;;CDS;;661;661;;;850;
comp;6202721..6202837;;5s;@4;139;;;;;
comp;6202977..6205893;;23s;;339;;;;;
comp;6206233..6207749;;16s;;1102;;;;;
comp;6208852..6208968;;5s;;138;;;;;
comp;6209107..6212023;;23s;;339;;;;;
comp;6212363..6213879;;16s;;502;502;;;;*502
comp;6214382..6215329;;CDS;;90019;;;;316;
;;;;;;;;;;
comp;6305349..6306314;;CDS;;123;123;;;322;123
comp;6306438..6306527;;tcc;;281;281;;;;
comp;6306809..6307984;;CDS;;66527;;;;392;
;;;;;;;;;;
;6374512..6375684;;CDS;;125;125;;;391;125
comp;6375810..6375884;;agg;;303;303;;;;
comp;6376188..6378578;;CDS;;13398;;;;797;
;;;;;;;;;;
comp;6391977..6392753;;CDS;;114;114;;;259;114
comp;6392868..6392984;;5s;;134;;;;;
comp;6393119..6396033;;23s;;214;;;;;
comp;6396248..6397764;;16s;;1120;;;;;
comp;6398885..6399001;;5s;;139;;;;;
comp;6399141..6402055;;23s;;214;;;;;
comp;6402270..6403786;;16s;;748;748;;;;
comp;6404535..6405107;;CDS;;31702;;;;191;
;;;;;;;;;;
;6436810..6437790;;CDS;;192;192;;;327;
comp;6437983..6438059;;gac;+;6;;6;;;
comp;6438066..6438141;;gta;3x;14;;14;;;
comp;6438156..6438230;;gaa;gac gta ;29;;29;;;
comp;6438260..6438334;;aca;gaa aca – 1;10;;10;;;
comp;6438345..6438421;;gac;;6;;6;;;
comp;6438428..6438503;;gta;;16;;16;;;
comp;6438520..6438594;;gaa;;29;;29;;;
comp;6438624..6438698;;aca;;10;;10;;;
comp;6438709..6438785;;gac;;6;;6;;;
comp;6438792..6438867;;gta;;14;;14;;;
comp;6438882..6438956;;gaa;;162;162;;;;162
comp;6439119..6439685;;CDS;;37865;;;;189;

cbei cumuls[modifier | modifier le wikicode]

cbei cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;2;1;0;1;0;100;4
;16 23 5s 0;7;20;34;3;50;2;50;2;200;19
;16 atc gca;1;40;12;1;100;7;100;6;300;11
;16 23 5s a;4;60;2;0;150;7;150;5;400;20
;max a;4;80;2;0;200;9;200;7;500;6
;a doubles;1;100;0;0;250;5;250;3;600;3
;autres;6;120;0;0;300;6;300;5;700;2
;total aas;19;140;0;0;350;6;350;2;800;1
sans ;opérons;20;160;1;0;400;4;400;1;900;4
;1 aa;11;180;0;0;450;3;450;2;1000;1
;max a;19;200;0;0;500;2;500;0;1100;0
;a doubles;5;;3;0;;21;;4;;0
;total aas;74;;54;6;;72;;37;;71
total aas;;93;;;;;;;;;
remarques;;6;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;18;7;;350;;195;;328
;;;variance;17;9;;225;;111;;206

cbei blocs[modifier | modifier le wikicode]

cbei blocs;;;;
16s;213;503;339;
23s;108;202;138;
5s;14;5;44;
atgi;atgi;ttc;atgi;
;;;;
16s;339;502;578;
23s;273;205;274;
5s;;;;
;;;;
aaa;5;;;
5s;159;5s;139;134
cds;294;23s;339;214
aaa;7;16s;1102;1120
5s;138;5s;138;139
23s;339;23s;339;214
16s;;16s;;
;;;;
16s;338;338;16s;140
23s;140;140;gca;3
aac;3;3;atc;111
5s;aac;aac;23s;70
;;;5s;5
;;;ttc;
;;;;
16s;137;;16s;132
gca;118;;atc;84
23s;204;;23s;71
5s;;;aac;
;;;;
ttc;5;;;
5s;;;;

cbei distribution[modifier | modifier le wikicode]

;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;4
aac 3 -5 et 3 >1;att;;act;;aat;;agt;1;;att;;act;;aat;;agt;
aaa 2 +5 et 4 >1;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gca 2+16s, 2+5s;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
;ttc;;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;3;tgc;
les +5s sont;atc;;acc;1;aac;;agc;;;atc;;acc;;aac;3;agc;2
des 1-3aas;ctc;1;ccc;;cac;;cgt;1;;ctc;;ccc;;cac;3;cgt;
;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;3;ggc;2
;tta;;tca;;taa;;tga;;;tta;4;tca;2;taa;;tga;
;ata;;aca;;aaa;;aga;;;ata;;aca;4;aaa;4;aga;3
;cta;;cca;1;caa;;cga;;;cta;3;cca;2;caa;2;cga;1
;gta;;gca;;gaa;;gga;;;gta;5;gca;;gaa;3;gga;5
;ttg;1;tcg;;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;
;atgj;;acg;;aag;;agg;1;;atgj;2;acg;;aag;1;agg;
;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;1;cgg;
;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;1
;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total
;cbei;;11;;;;;11;;cbei;63;;;;;;63

cbei intercalaires entre cds[modifier | modifier le wikicode]

cbei;2.2.21 Paris;;cbei 31.7.20;;;;;;;;;
cbei;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>frequence5;intercal;<u>frequencez
;'''négatif;400;7.1;'''négatif ;-11;12;-1 à -64;'''6 485 394;-1;400;610;14
;'''zéro;19;0.3;;;;;'''intercals;0;19;620;19
;'''1 à 200;2957;52.6;'''0 à 200;83;61;;'''1 159 420;5;174;630;8
;'''201 à 370;1240;22.1;'''201 à 370;275;48;;'''17.9%;10;81;640;14
;'''371 à 600;714;12.7;'''371 à 600;464;66;;;15;236;650;10
;'''601 à max;293;5.2;'''601 à 1028;808;203;;;20;151;660;8
;'''total 5623;<201;60.0;'''total 5620;205;211;-64 à 1555;;25;121;670;13
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;90;680;7
1860894;2121;-1;400;-70;1;;0;19;35;71;690;9
1898453;1881;0;19;-60;4;;-1;°71;40;65;700;14
4639922;1555;1;°58;-50;1;;-2;0;45;61;710;7
6361933;1545;2;°40;-40;8;;-3;0;50;68;720;8
5176736;1499;3;23;-30;10;'''min à -1;-4;°85;55;81;730;6
2532196;1482;4;36;-20;44;400;-5;1;60;69;740;12
3181990;1469;5;17;-10;94;7.1%;-6;0;65;68;750;5
4033167;1431;6;17;0;257;;-7;8;70;60;760;6
4590435;1429;7;8;10;255;;-8;°73;75;70;770;7
3571512;1391;8;15;20;387;;-9;0;80;50;780;4
4428508;1372;9;23;30;211;;-10;5;85;61;790;8
5504697;1348;10;18;40;136;;-11;°38;90;58;800;4
1486045;1326;11;°51;50;129;;-12;0;95;76;810;2
2570075;1302;12;°53;60;150;;-13;4;100;58;820;6
4602139;1289;13;41;70;128;'''1 à 200;-14;°21;105;68;830;5
3981561;1239;14;°47;80;120;1769;-15;0;110;69;840;5
4621836;1226;15;°44;90;119;31.5%;-16;3;115;53;850;3
4088892;1221;16;31;100;134;;-17;°21;120;65;860;2
4296061;1207;17;25;110;137;;-18;0;125;48;870;2
6061011;1205;18;°38;120;118;;-19;2;130;65;880;5
2648455;1201;19;25;130;113;;-20;°11;135;65;890;2
4064421;1178;20;32;140;123;;-21;1;140;58;900;4
4839562;1176;21;°34;150;134;;-22;1;145;67;910;4
3909835;1173;22;25;160;133;;-23;°9;150;67;920;4
2456047;1153;23;18;170;118;'''1 à 200;-24;0;155;65;930;1
3569689;1127;24;21;180;108;2957;-25;2;160;68;940;2
3023607;1112;25;°23;190;101;52.6%;-26;°11;165;64;950;0
4726206;1107;26;°23;200;103;;-27;0;170;54;960;3
1550735;1102;27;18;210;101;;-28;4;175;53;970;3
4395515;1078;28;12;220;99;;-29;°5;180;55;980;1
1099864;1072;29;18;230;88;;-30;0;185;44;990;2
3075992;1065;30;°19;240;86;;-31;0;190;57;1000;4
3857530;1064;31;°18;250;82;'''0 à 200;-32;0;195;51;1010;3
776201;1058;32;14;260;83;2976;;395;200;52;1020;4
2291086;1058;33;12;270;79;;reste;24;205;53;1030;2
5939293;1054;34;°14;280;83;;total;419;210;48;1040;3
2680682;1051;35;°13;290;66;;;;215;38;1050;0
3035780;1051;36;10;300;79;;;;220;61;1060;5
4035399;1040;37;8;310;59;;'''intercal;'''<u>frequencef;225;45;1070;2
6351672;1032;38;13;320;62;;600;5330;230;43;1080;2
2453621;1031;39;°17;330;69;;650;65;235;40;1090;0
5871985;1027;40;°17;340;53;'''201 à 370;700;51;240;46;1100;0
5197163;1021;reste;4215;350;58;1240;750;38;245;39;1110;2
;;total;5623;360;43;22.1%;800;29;250;43;1120;1
;;;;370;50;;850;21;255;46;1130;1
;;;;380;53;;900;15;260;37;1140;0
;;;;390;57;;950;11;265;38;1150;0
'''adresse;'''intercaln;'''décalage;'''long;400;38;;1000;13;270;41;1160;1
4624137;-110;shift 2;673;410;48;;1050;12;275;48;1170;0
1868484;-64;shift 2;608;420;44;;1100;9;280;35;1180;3
3204859;-64;shift 2;665;430;32;;1150;4;285;37;1190;0
2485518;-62;shift 2;184;440;36;;1200;4;290;29;1200;0
3963063;-60;;;450;42;;1250;6;295;41;reste;21
2029018;-50;;;460;39;;1300;1;300;38;total;293
5912545;-49;;;470;28;;1350;3;305;30;;
5354783;-47;;;480;27;;1400;2;310;29;;
1515675;-46;;;490;24;;1450;2;315;28;;
4067020;-44;;;500;28;;1500;3;320;34;;
5920392;-44;;;510;23;;1550;1;325;33;;
1552479;-43;;;520;19;;1600;1;330;36;;
330305;-41;;;530;23;;;291;335;26;;
4488902;-40;;;540;27;'''371 à 600;;;340;27;;
2489800;-38;;;550;18;714;;;345;33;;
2856876;-38;;;560;27;12.7%;;;350;25;;
4401424;-38;;;570;21;;;;355;26;;
4678887;-38;;;580;20;'''601 à max;;;360;17;;
5785183;-38;;;590;20;293;;;365;28;;
3964014;-37;;;600;20;5.2%;;;370;22;;
1257344;-35;;;reste;293;;reste;2;reste;1007;;
4675094;-35;;;total;5623;;total;5623;total;5623;;

cbei autres intercalaires[modifier | modifier le wikicode]

cbei;autres intercalaires;;adresses1;;;cbei;autres intercalaires;;adresses2;;;cbei;autres intercalaires;;adresses3;;
;&tRNA;15;1;;;deb;°CDS;540067;187;;;deb;°CDS;4256439;267;comp;
;&tRNA;93;85;;;;&tRNA;541157;208;;;;&tRNA;4258671;79;comp;
fin;°CDS;254;;;;fin;°CDS;541440;;;;;&tRNA;4258826;7;comp;
deb;°CDS;2710;119;;;deb;°CDS;541918;252;comp;;;&tRNA;4258909;35;comp;
;&tRNA;3057;30;;;;&tRNA;543238;354;;;;&tRNA;4259021;752;comp;
;&tRNA;3178;241;;;fin;°CDS;543667;;;;fin;°CDS;4259847;;;
;&tRNA;3510;18;;;deb;°CDS;772270;262;;;deb;°CDS;4880246;508;comp;
;&tRNA;3619;125;;;;tmRNA;774356;871;;;;$rRNA;4880997;274;comp;
fin;°CDS;3835;;;;fin;°CDS;775585;;;;;$rRNA;4881388;578;comp;
deb;°CDS;13821;187;;;deb;°CDS;892419;565;;;;$rRNA;4884879;703;comp;
;&tRNA;14914;34;;;;$rRNA;893905;137;;;fin;°CDS;4887099;;comp;
fin;°CDS;15023;;comp;;;&tRNA;895554;118;;;deb;°CDS;6160739;343;comp;
deb;°CDS;124928;275;;;;$rRNA;895748;204;;;;&tRNA;6162321;242;;
;&tRNA;125614;20;;;;$rRNA;898866;552;;;fin;°CDS;6162639;;;
;&tRNA;125723;7;;;fin;°CDS;899535;;;;deb;°CDS;6165324;222;;
;&tRNA;125806;6;;;deb;°CDS;900798;709;;;;&tRNA;6165957;5;comp;
;&tRNA;125889;22;;;;$rRNA;902758;339;;;;$rRNA;6166038;188;comp;
;&tRNA;126000;7;;;;$rRNA;904609;273;;;fin;°CDS;6166343;;;
;&tRNA;126083;6;;;;$rRNA;907796;69;;;deb;°CDS;6175160;249;comp;
;&tRNA;126166;21;;;fin;°CDS;907982;;comp;;;&tRNA;6175847;1;comp;
;&tRNA;126276;70;;;deb;°CDS;951995;97;;;;&tRNA;6175924;44;comp;
;&tRNA;126422;21;;;;&tRNA;952728;396;;;;$rRNA;6176045;138;comp;
;&tRNA;126532;664;;;fin;°CDS;953210;;;;;$rRNA;6176300;339;comp;
fin;°CDS;127272;;;;deb;°CDS;1017389;70;;;;$rRNA;6179556;572;comp;
deb;°CDS;138638;307;;;;ncRNA;1017765;758;;;fin;°CDS;6181640;;comp;
;&tRNA;140451;234;;;fin;°CDS;1018872;;;;deb;°CDS;6182670;190;;
;&tRNA;140760;439;;;deb;°CDS;1646835;56;;;;&tRNA;6183610;5;comp;
;&tRNA;141274;299;;;;ncRNA;1647290;182;;;;$rRNA;6183691;159;comp;
fin;°CDS;141648;;;;fin;°CDS;1647666;;comp;;deb;°CDS;6183967;294;comp;
deb;°CDS;144627;548;;;deb;°CDS;1739334;380;;;;&tRNA;6185209;7;comp;
;$rRNA;146198;140;;;;&tRNA;1740314;3;;;;$rRNA;6185292;138;comp;
;&tRNA;147850;3;;;;&tRNA;1740393;5;;;;$rRNA;6185547;339;comp;
;&tRNA;147929;111;;;;&tRNA;1740473;443;;;;$rRNA;6188803;776;comp;
;$rRNA;148117;70;;;fin;°CDS;1740992;;comp;;fin;°CDS;6191091;;comp;
;$rRNA;151101;5;;;deb;°CDS;1846157;-183;;;deb;°CDS;6199510;661;comp;
;&tRNA;151223;4;;;;gene;1847876;588;;;;$rRNA;6202721;139;comp;
;&tRNA;151303;681;;;fin;°CDS;1848647;;;;;$rRNA;6202977;339;comp;
fin;°CDS;152059;;;;deb;°CDS;1894180;34;;;;$rRNA;6206233;1107;comp;
deb;°CDS;177450;76;;;;&tRNA;1895441;574;comp;;;$rRNA;6208852;138;comp;
;&tRNA;178174;65;;;fin;°CDS;1896102;;;;;$rRNA;6209107;339;comp;
fin;°CDS;178315;;;;deb;°CDS;2097496;727;;;;$rRNA;6212363;507;comp;
deb;°CDS;313730;90;;;;$rRNA;2098643;502;;;fin;°CDS;6214382;;comp;
;&tRNA;316298;4;;;;$rRNA;2100657;205;;;deb;°CDS;6256716;154;;
;&tRNA;316387;120;;;;$rRNA;2103775;315;;;;ncRNA;6257755;316;comp;
fin;°CDS;316582;;comp;;fin;°CDS;2104207;;;;fin;°CDS;6258338;;comp;
deb;°CDS;402474;125;;;deb;°CDS;2296804;104;;;deb;°CDS;6305349;135;comp;
;&tRNA;403079;17;;;;ncRNA;2297577;380;comp;;;&tRNA;6306438;281;comp;
;&tRNA;403172;149;;;fin;°CDS;2298150;;;;fin;°CDS;6306809;;comp;
;&tRNA;403395;6;;;deb;°CDS;2305297;275;;;deb;°CDS;6374512;125;;
;&tRNA;403478;16;;;;ncRNA;2306778;230;comp;;;&tRNA;6375810;303;comp;
;&tRNA;403570;35;;;fin;°CDS;2307274;;;;fin;°CDS;6376188;;comp;
;&tRNA;403679;5;;;deb;°CDS;2339219;667;;;deb;°CDS;6391977;114;comp;
;&tRNA;403761;3;;;;$rRNA;2340990;338;;;;$rRNA;6392868;134;comp;
;&tRNA;403840;7;;;;$rRNA;2342840;140;;;;$rRNA;6393119;214;comp;
;&tRNA;403922;18;;;;&tRNA;2345896;3;;;;$rRNA;6396248;1125;comp;
;&tRNA;404016;5;;;;$rRNA;2345974;429;;;;$rRNA;6398885;139;comp;
;&tRNA;404106;25;;;fin;°CDS;2346520;;;;;$rRNA;6399141;214;comp;
;&tRNA;404206;5;;;deb;°CDS;2351663;573;;;;$rRNA;6402270;753;comp;
;&tRNA;404285;57;;;;$rRNA;2352713;338;;;fin;°CDS;6404535;;comp;
;&tRNA;404418;7;;;;$rRNA;2354563;140;;;deb;°CDS;6436810;192;;
;&tRNA;404500;18;;;;&tRNA;2357618;3;;;;&tRNA;6437983;6;comp;
;&tRNA;404594;5;;;;$rRNA;2357696;90;;;;&tRNA;6438066;14;comp;
;&tRNA;404684;25;;;fin;°CDS;2357903;;;;;&tRNA;6438156;29;comp;
;&tRNA;404784;46;;;deb;°CDS;2765706;282;;;;&tRNA;6438260;10;comp;
;&tRNA;404904;325;;;;$rRNA;2766156;503;;;;&tRNA;6438345;6;comp;
fin;°CDS;405306;;;;;$rRNA;2768171;202;;;;&tRNA;6438428;16;comp;
deb;°CDS;413861;390;;;;$rRNA;2771285;5;;;;&tRNA;6438520;29;comp;
;$rRNA;416312;132;;;;&tRNA;2771407;6;;;;&tRNA;6438624;10;comp;
;&tRNA;417956;84;;;;&tRNA;2771489;25;;;;&tRNA;6438709;6;comp;
;$rRNA;418117;71;;;;&tRNA;2771591;448;;;;&tRNA;6438792;14;comp;
;&tRNA;421103;345;;;fin;°CDS;2772114;;;;;&tRNA;6438882;162;comp;
fin;°CDS;421523;;;;deb;°CDS;3556683;565;;;fin;°CDS;6439119;;comp;
deb;°CDS;486264;159;;;;&tRNA;3557617;505;;;deb;°CDS;6477551;501;;erreur à corriger
;&tRNA;486828;9;;;fin;°CDS;3558197;;comp;;;$rRNA;6480533;213;;
;&tRNA;486922;27;;;deb;°CDS;3752035;248;comp;;;$rRNA;6482258;108;;
;&tRNA;487025;12;;;;&tRNA;3752901;13;comp;;;$rRNA;6485280;14;;
;&tRNA;487112;9;;;fin;°CDS;3752999;;comp;;;;;;;
;&tRNA;487206;30;;;;;;;;;;;;;;
;&tRNA;487312;12;;;;;;;;;;;;;;
;&tRNA;487399;451;;;;;;;;;;;;;;
fin;°CDS;487935;;;;;;;;;;;;;;;

cbei intercalaires tRNA-cds[modifier | modifier le wikicode]

cbei;intercalaires tRNA-cds;;;;;;;
comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;85;;76;13;;
;119;;125;;90;65;deb;
;187;comp’;34;;97;85;<201;9
;275;;664;;119;125;total;17
;307;;299;;125;162;taux;53%
;;;681;;135;208;;
;76;;65;;159;242;fin;
;90;comp’;120;;187;281;<201;5
;125;;325;;187;299;total;18
;;;345;;248;303;taux;28%
;159;;451;;249;325;;
;187;;208;;267;345;total;
comp’;252;;354;;275;354;<201;14
;97;;396;;294;396;total;35
;380;comp’;443;;307;448;taux;40%
comp’;34;comp’;574;;380;451;;
;;;448;;565;664;;
;565;comp’;505;;-;681;comp’;cumuls
;248;;13;;34;120;deb;4
;267;comp’;752;;125;443;;7
comp’;343;;242;;190;505;fin;1
comp’;222;;;;192;574;;5
;249;;;;222;752;total;
comp’;190;;;;252;-;<201;5
;294;;;;343;-;total;12
;135;;281;;;;taux;42%
comp’;125;;303;;;;;
comp’;192;;162;;;;;
;;;;;;;;
;;deb;fin;total;;;;
;<201;13;6;19;;;;
;total;24;23;47;;;;
;taux;54%;26%;40%;;;;

afn[modifier | modifier le wikicode]

afn opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Acid_ferm_DSM_20731/;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_013740.1;afn;;;;
56%GC;30.6.19 Paris;16s  6;60;doubles;intercalaires
;Acidaminococcus fermentans DSM 20731;;;;
;24678..26242;;16s;@1;359
;26602..29507;;23s;;228
;29736..29852;;5s;;
;;;;;
;36819..36894;;acg;;
;;;;;
;57713..59277;;16s;;359
;59637..62543;;23s;;228
;62772..62888;;5s;;
;;;;;
;169459..169534;;gcc;;
;;;;;
;249791..249867;;agg;;
;;;;;
comp;274627..274703;;cgt;;
;;;;;
;311123..311198;;aca;;22
;311221..311305;;tac;;5
;311311..311386;;atg;;3
;311390..311465;;acc;;6
;311472..311548;;atgf;;
;;;;;
;380482..382046;;16s;;251
;382298..385204;;23s;;229
;385434..385550;;5s;;
;;;;;
;461553..461627;;aac;;3
;461631..461705;;gaa;;8
;461714..461789;;gta;;50
;461840..461916;;cca;;11
;461928..462001;;gga;;8
;462010..462086;;aga;;
;;;;;
;526984..527070;;ctg;+;30
;527101..527186;;ctc;2 ctg;52
;527239..527325;;ctg;;
;;;;;
;578049..578123;;ggc;;
;;;;;
;636984..638548;;16s;@2;94
;638643..638719;;atc;;66
;638786..638861;;gca;;273
;639135..642040;;23s;;139
;642180..642296;;5s;;
;;;;;
;712229..712304;;cac;;18
;712323..712398;;caa;;3
;712402..712477;;aaa;;16
;712494..712577;;cta;;
;;;;;
comp;724421..724497;;gtc;;
;;;;;
;774880..774956;;gac;;4
;774961..775036;;ttc;;8
;775045..775119;;ggc;;9
;775129..775202;;tgc;;13
;775216..775304;;tta;;
;;;;;
;796654..796728;;cgg;;
;;;;;
;842393..842469;;gac;;2
;842472..842547;;ttc;;8
;842556..842630;;ggc;;9
;842640..842713;;tgc;;
;;;;;
;889670..889746;;ccc;;
;;;;;
;906136..906210;;aac;;
;;;;;
;1022783..1022859;;gac;;2
;1022862..1022936;;ggc;;1
;1022938..1023011;;tgg;;
;;;;;
;1555201..1555277;;ccg;;
;;;;;
comp;1567911..1567999;;tca;;
;;;;;
comp;1613773..1613863;;agc;;
;;;;;
;1702659..1702744;;ttg;;
;;;;;
comp;1711770..1711886;;5s;;228
comp;1712115..1715021;;23s;;359
comp;1715381..1716945;;16s;;
;;;;;
comp;1823852..1823927;;gta;;6
comp;1823934..1824008;;gaa;;8
comp;1824017..1824092;;aag;;
;;;;;
;1909446..1909536;;tcc;;
;;;;;
comp;1911342..1911429;;tcg;;
;;;;;
comp;1974984..1975058;;atgi;;
;;;;;
comp;1984782..1984856;;gag;;12
comp;1984869..1984942;;cag;+;111
comp;1985054..1985127;;cag;2 cag;
;;;;;
comp;2072279..2072395;;5s;;228
comp;2072624..2075529;;23s;;298
comp;2075828..2075903;;gca;;66
comp;2075970..2076046;;atc;;94
comp;2076141..2077705;;16s;;
;;;;;
;2148343..2148418;;gcg;;
;;;;;
comp;2287117..2287192;;aaa;;
;;;;;
comp;2303018..2303094;;gtg;;
;;;;;
comp;2323563..2323636;;ggg;;

afn cumuls[modifier | modifier le wikicode]

afn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;6;1;1;-
;16 23 5s 0;4;20;21;
;16 atc gca;2;40;2;
;16 23 5s a;0;60;2;
;max a;2;80;0;
;a doubles;0;100;0;
;spéciaux;0;120;1;
;total aas;4;140;0;
sans ;opérons;29;160;0;
;1 aa;20;180;0;
;max a;6;200;0;
;a doubles;2;;0;
;total aas;56;;27;0
total aas;;60;;;
remarques;;2;;;
avec jaune;;;moyenne;16;
;;;variance;23;
sans jaune;;;moyenne;12;
;;;variance;13;

afn blocs[modifier | modifier le wikicode]

afn blocs;;;;;;
16s;359;1565;359;1565;251;1565
23s;228;2906;228;2907;229;2907
5s;;117;;117;;117
;;;;;;
16s;94;1565;;5s;228;117
atc;66;;;23s;298;2906
gca;273;;;gca;66;
23s;139;2906;;atc;94;
5s;;117;;16s;;1565
;;;;;;
5s;228;117;;;;
23s;359;2907;;;;
16s;;1565;;;;

afn remarques[modifier | modifier le wikicode]

afn;;;;;;;60
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;2
atc;2;acc;1;aac;2;agc;1
ctc;1;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;3;ggc;4
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;2;aga;1
cta;1;cca;1;caa;1;cga;
gta;2;gca;2;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;2;ccg;1;cag;2;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

negativicutes distribution[modifier | modifier le wikicode]

22.1.21 Paris;;tRNAs total des negatives;;;;;;;;;;;;;;
genomes;;total;;;total;ttt;tgt;;1-3aas;;;;total;;ttt;tgt
9;;582;;;571;;;;;;;;58;;;
atgi;8;tct;;tat;;atgf;15;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;17;tcc;10;tac;16;tgc;13;;ttc;;tcc;;tac;1;tgc;
atc;17;acc;11;aac;26;agc;11;;atc;18;acc;;aac;6;agc;1
ctc;11;ccc;7;cac;10;cgt;16;;ctc;;ccc;;cac;2;cgt;2
gtc;8;gcc;7;gac;24;ggc;33;;gtc;;gcc;;gac;;ggc;
tta;11;tca;10;taa;;tga;1;;tta;;tca;;taa;;tga;
ata;;aca;13;aaa;20;aga;9;;ata;;aca;;aaa;;aga;
cta;9;cca;11;caa;13;cga;2;;cta;;cca;;caa;1;cga;
gta;24;gca;21;gaa;25;gga;10;;gta;;gca;21;gaa;1;gga;
ttg;11;tcg;9;tag;;tgg;13;;ttg;;tcg;;tag;;tgg;4
atgj;12;acg;9;aag;10;agg;9;;atgj;;acg;1;aag;;agg;
ctg;10;ccg;7;cag;11;cgg;9;;ctg;;ccg;;cag;;cgg;
gtg;4;gcg;5;gag;5;ggg;8;;gtg;;gcg;;gag;;ggg;
;;186;;263;;122;571;;;;7;;11;;1;19
9-23;;;;total;;ttt;tgt;;-rRNA;;;;total;;ttt;tgt
;;;;92;;;;;attention au -2;;;;421;;;
atgi;1;tct;;tat;;atgf;3;;atgi;7;tct;;tat;;atgf;12
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;6;tcc;2;tac;3;tgc;2;;ttc;11;tcc;8;tac;12;tgc;11
atc;1;acc;;aac;5;agc;2;;atc;-2;acc;11;aac;15;agc;8
ctc;2;ccc;;cac;3;cgt;4;;ctc;9;ccc;7;cac;5;cgt;10
gtc;;gcc;;gac;7;ggc;3;;gtc;8;gcc;7;gac;17;ggc;30
tta;4;tca;1;taa;;tga;;;tta;7;tca;9;taa;;tga;1
ata;;aca;5;aaa;5;aga;;;ata;;aca;8;aaa;15;aga;9
cta;1;cca;2;caa;5;cga;;;cta;8;cca;9;caa;7;cga;2
gta;7;gca;;gaa;5;gga;4;;gta;17;gca;0;gaa;19;gga;6
ttg;2;tcg;;tag;;tgg;2;;ttg;9;tcg;9;tag;;tgg;7
atgj;1;acg;;aag;2;agg;;;atgj;11;acg;8;aag;8;agg;9
ctg;2;ccg;;cag;;cgg;;;ctg;8;ccg;7;cag;11;cgg;9
gtg;;gcg;;gag;;ggg;;;gtg;4;gcg;5;gag;5;ggg;8
;;24;;64;;4;92;;;;118;;188;;117;423
;;;;;;;;;;;116;;188;;117;421

afn distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;;ttc;1;tcc;1;tac;1;tgc;2;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;1;;atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;
ctc;;ccc;1;cac;;cgt;1;;ctc;1;ccc;;cac;1;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;1;;gtc;;gcc;;gac;3;ggc;3;;gtc;;gcc;;gac;;ggc;
tta;;tca;1;taa;;tga;;;tta;1;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;;aaa;1;aga;;;ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;2;gca;;gaa;2;gga;1;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;;atgj;1;acg;;aag;1;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;1;;ctg;2;ccg;;cag;;cgg;;;ctg;;ccg;;cag;2;cgg;
gtg;1;gcg;1;gag;;ggg;1;;gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;
clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos;duplicata;1aa;-5s;+5s;-16s;+16s;total
afn;;20;;;;;20;;afn;34;;;;;;34;;afn;2;;;;;;2

afn intercalaires entre cds[modifier | modifier le wikicode]

afn;5.2.21 Paris;;afn 30.8.20;;;;;;;
afn;intercalaires;;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>fréquenceffrequence5
;'''négatif;307;15.1;'''négatif ;-10;14;-1 à -83;'''2 329 769;-1;307
;'''zéro;11;0.5;;;;;'''intercals;0;11
;'''1 à 200;1325;65.0;'''0 à 200;66;58;;'''220 467;5;127
;'''201 à 370;304;14.9;'''201 à 370;267;49;;'''9.5%;10;57
;'''371 à 600;69;3.4;'''371 à 600;449;59;;;15;164
;'''601 à max;23;1.1;'''601 à 992;743;108;;;20;87
;'''total 2039;<201;80.6;'''total 2035;105;133;-83 à 992;;25;65
adresse;intercal;intercal;<u>fréquence1;intercal;<u>fréquenceffréquence6;cumul et %;intercal;<u>fréquenceffréquence-1;30;47
1555671;2261;-1;307;-70;5;;0;11;35;37
1949615;1154;0;11;-60;3;;-1;°38;40;32
1841522;1130;1;°39;-50;3;;-2;0;45;25
1001677;992;2;27;-40;4;;-3;0;50;28
434858;957;3;20;-30;10;'''min à -1;-4;°130;55;31
865205;922;4;°28;-20;17;307;-5;0;60;29
463581;845;5;13;-10;48;15.1%;-6;1;65;23
1969579;795;6;9;0;228;;-7;6;70;25
1287774;772;7;5;10;184;;-8;°41;75;32
843665;744;8;7;20;251;;-9;1;80;17
1081454;736;9;°20;30;112;;-10;1;85;25
34;721;10;16;40;69;;-11;°19;90;28
1347444;718;11;29;50;53;;-12;0;95;16
2155062;701;12;°46;60;60;;-13;5;100;29
1227328;693;13;30;70;48;;-14;°8;105;20
893831;683;14;22;80;49;;-15;0;110;22
1185969;679;15;°37;90;53;'''1 à 100;-16;3;115;28
1657318;677;16;24;100;45;924;-17;°10;120;22
1282010;667;17;10;110;42;36.3%;-18;0;125;29
872797;649;18;°25;120;50;;-19;2;130;29
1240102;647;19;13;130;58;;-20;°6;135;24
1246797;636;20;15;140;55;;-21;0;140;31
117980;628;21;°21;150;42;;-22;0;145;20
867763;580;22;14;160;41;;-23;°4;150;22
406827;567;23;11;170;38;'''1 à 200;-24;0;155;18
1121221;551;24;°10;180;24;1325;-25;0;160;23
2231462;551;25;9;190;26;65%;-26;4;165;21
901417;550;26;6;200;25;;-27;0;170;17
39288;548;27;°15;210;25;;-28;0;175;11
791634;544;28;10;220;32;;-29;°3;180;13
1481233;542;29;5;230;34;;-30;0;185;8
691218;519;30;°11;240;33;'''0 à 200;-31;2;190;18
1388835;517;31;7;250;18;1336;-32;2;195;16
2163709;515;32;7;260;16;;total;297;200;9
1189403;513;33;5;270;21;;reste;21;205;15
1783994;508;34;°10;280;16;;;318;210;10
1749779;507;35;8;290;11;;;;215;18
847959;503;36;6;300;17;;intercal;<u>fréquencef;220;14
1268481;502;37;8;310;15;;600;2016;225;23
;;38;6;320;8;;620;;230;11
;;39;8;330;13;;640;2;235;14
;;40;4;340;9;'''201 à 370;660;2;240;19
;;reste;1105;350;12;304;680;3;245;7
;;total;2039;360;10;14.9%;700;2;250;11
;;;;370;14;;720;2;255;5
2109623;-113;shift2;425;380;8;;740;2;260;11
598105;-83;comp;;390;7;;760;1;265;7
1667526;-79;shift2;915;400;7;;780;1;270;14
2031132;-74;shift2;614;410;1;;800;1;275;5
935587;-71;shift2;518;420;5;;820;;280;11
2283155;-68;shift2;1952;430;2;;840;;285;8
846262;-67;shift2;132;440;4;;860;1;290;3
1528664;-67;shift2;108;450;4;;880;;295;7
1794682;-59;shift2;1601;460;3;;900;;300;10
808710;-53;shift2;1034;470;1;;920;;305;10
1101239;-50;shift2;2423;480;5;;940;1;310;5
287845;-45;;;490;1;;960;1;315;4
532761;-44;;;500;5;;980;;320;4
50634;-41;;;510;4;;1000;1;325;8
434100;-40;;;520;4;;1020;;330;5
276227;-38;;;530;0;;1040;;335;3
629222;-38;;;540;0;'''371 à 600;1060;;340;6
1090320;-37;;;550;4;69;1080;;345;9
503812;-35;;;560;2;3.4%;1100;;350;3
1225885;-35;;;570;1;;1120;;355;3
1260789;-35;;;580;1;'''601 à max;1140;1;360;7
706234;-32;;;590;0;23;1160;1;365;8
2148489;-32;;;600;0;1.1%;;22;370;6
460032;-31;;;reste;23;;reste;1;reste;92
1743849;-31;;;total;2039;;total;2039;total;2039

afn autres intercalaires[modifier | modifier le wikicode]

afn;autres intercalaires;;adresses1;;;afn;autres intercalaires;;adresses1;;;afn;autres intercalaires;;adresses1;
deb;°CDS;23699;319;;;deb;°CDS;635289;300;;;deb;°CDS;1485384;59;comp
;$rRNA;24678;359;;;;$rRNA;636984;94;;;;misc_binding;1487132;146;comp
;$rRNA;26602;228;;;;&tRNA;638643;66;;;fin;°CDS;1487523;;comp
;$rRNA;29736;286;;;;&tRNA;638786;273;;;deb;°CDS;1536256;68;
fin;°CDS;30139;;;;;$rRNA;639135;139;;;;regulatory;1537998;113;
deb;°CDS;35919;105;;;;$rRNA;642180;296;;;fin;°CDS;1538188;;
;&tRNA;36819;105;;;fin;°CDS;642593;;;;deb;°CDS;1553542;24;
fin;°CDS;37000;;;;deb;°CDS;677296;181;;;;&tRNA;1555201;393;
deb;°CDS;56077;346;;;;misc_feature;678359;368;;;fin;°CDS;1555671;;comp
;$rRNA;57713;359;;;fin;°CDS;678779;;;;deb;°CDS;1567689;21;comp
;$rRNA;59637;228;;;deb;°CDS;711704;96;;;;&tRNA;1567911;93;comp
;$rRNA;62772;266;;;;&tRNA;712229;18;;;fin;°CDS;1568093;;comp
fin;°CDS;63155;;comp;;;&tRNA;712323;3;;;deb;°CDS;1612826;158;
deb;°CDS;168443;122;;;;&tRNA;712402;16;;;;&tRNA;1613773;215;comp
;&tRNA;169459;361;;;;&tRNA;712494;61;;;fin;°CDS;1614079;;comp
fin;°CDS;169896;;comp;;fin;°CDS;712639;;comp;;deb;°CDS;1668440;42;comp
deb;°CDS;181646;89;comp;;deb;°CDS;723480;80;;;;ncRNA;1668962;51;comp
;misc_binding;182746;130;comp;;;&tRNA;724421;134;comp;;fin;°CDS;1669196;;comp
fin;°CDS;183117;;comp;;fin;°CDS;724632;;;;deb;°CDS;1701767;76;
deb;°CDS;183775;510;comp;;deb;°CDS;774399;214;;;;&tRNA;1702659;91;
;misc_binding;185671;146;;;;&tRNA;774880;4;;;fin;°CDS;1702836;;comp
fin;°CDS;186056;;;;;&tRNA;774961;8;;;deb;°CDS;1710214;512;
deb;°CDS;249164;195;;;;&tRNA;775045;9;;;;$rRNA;1711770;228;comp
;&tRNA;249791;51;;;;&tRNA;775129;13;;;;$rRNA;1712115;359;comp
fin;°CDS;249919;;comp;;;&tRNA;775216;111;;;;$rRNA;1715381;391;comp
deb;°CDS;253385;90;;;fin;°CDS;775416;;;;fin;°CDS;1717337;;comp
;misc_binding;254915;84;;;deb;°CDS;796146;73;;;deb;°CDS;1823002;379;comp
fin;°CDS;255255;;;;;&tRNA;796654;159;;;;&tRNA;1823852;6;comp
deb;°CDS;273899;200;comp;;fin;°CDS;796888;;;;;&tRNA;1823934;8;comp
;&tRNA;274627;188;comp;;deb;°CDS;841590;119;;;;&tRNA;1824017;83;comp
fin;°CDS;274892;;;;;&tRNA;842393;2;;;fin;°CDS;1824176;;comp
deb;°CDS;310188;131;;;;&tRNA;842472;8;;;deb;°CDS;1907578;182;comp
;&tRNA;311123;22;;;;&tRNA;842556;9;;;;&tRNA;1909446;53;comp
;&tRNA;311221;5;;;;&tRNA;842640;127;;;;ncRNA;1909590;115;
;&tRNA;311311;3;;;fin;°CDS;842841;;;;deb;°CDS;1909805;136;
;&tRNA;311390;6;;;deb;°CDS;881739;121;;;;&tRNA;1911342;23;
;&tRNA;311472;74;;;;repeat_region;882151;278;;;fin;°CDS;1911453;;
fin;°CDS;311623;;;;fin;°CDS;886449;;;;deb;°CDS;1912058;43;comp
deb;°CDS;359181;58;;;deb;°CDS;889017;71;;;;misc_binding;1913025;130;comp
;regulatory;360286;52;;;;&tRNA;889670;156;;;fin;°CDS;1913387;;
fin;°CDS;360447;;;;fin;°CDS;889903;;;;deb;°CDS;1973889;222;comp
deb;°CDS;378908;485;;;deb;°CDS;905286;58;;;;&tRNA;1974984;39;comp
;$rRNA;380482;251;;;;&tRNA;906136;102;;;fin;°CDS;1975098;;comp
;$rRNA;382298;229;;;fin;°CDS;906313;;;;deb;°CDS;1983694;122;comp
;$rRNA;385434;262;;;deb;°CDS;913707;78;;;;&tRNA;1984782;12;comp
fin;°CDS;385813;;comp;;;regulatory;916065;91;;;;&tRNA;1984869;111;comp
deb;°CDS;414288;246;;;fin;°CDS;916256;;;;;&tRNA;1985054;106;comp
;regulatory;416478;98;;;deb;°CDS;947642;32;;;fin;°CDS;1985234;;comp
fin;°CDS;416689;;;;;ncRNA;948598;38;;;deb;°CDS;2070538;193;
deb;°CDS;460654;266;;;fin;°CDS;948982;;;;;$rRNA;2072279;228;comp
;&tRNA;461553;3;;;deb;°CDS;1017827;92;comp;;;$rRNA;2072624;298;comp
;&tRNA;461631;8;;;;misc_binding;1018936;36;;;;&tRNA;2075828;66;comp
;&tRNA;461714;50;;;fin;°CDS;1019167;;;;;&tRNA;2075970;94;comp
;&tRNA;461840;11;;;deb;°CDS;1020207;137;;;;$rRNA;2076141;265;comp
;&tRNA;461928;8;;;;&tRNA;1022783;2;;;fin;°CDS;2077971;;comp
;&tRNA;462010;145;;;;&tRNA;1022862;1;;;deb;°CDS;2147697;91;
fin;°CDS;462232;;;;;&tRNA;1022938;112;;;;&tRNA;2148343;70;
deb;°CDS;466993;232;;;fin;°CDS;1023124;;;;fin;°CDS;2148489;;comp
;misc_binding;468950;36;;;deb;°CDS;1111497;73;comp;;deb;°CDS;2285667;451;comp
fin;°CDS;469185;;;;;misc_binding;1112790;267;comp;;;&tRNA;2287117;45;comp
deb;°CDS;526396;54;;;fin;°CDS;1113303;;;;fin;°CDS;2287238;;comp
;&tRNA;526984;30;;;deb;°CDS;1305277;298;;;deb;°CDS;2301950;486;comp
;&tRNA;527101;52;;;;regulatory;1306436;70;;;;&tRNA;2303018;45;comp
;&tRNA;527239;268;;;fin;°CDS;1306616;;;;fin;°CDS;2303140;;comp
fin;°CDS;527594;;comp;;deb;°CDS;1328649;26;;;deb;°CDS;2322585;393;comp
deb;°CDS;570200;65;comp;;;tmRNA;1328957;406;;;;&tRNA;2323563;196;comp
;regulatory;571573;209;comp;;fin;°CDS;1329712;;comp;;fin;°CDS;2323833;;
fin;°CDS;571879;;;;deb;°CDS;1403493;52;comp;;;;;;
deb;°CDS;577378;131;;;;misc_binding;1404547;111;comp;;;;;;
;&tRNA;578049;194;;;fin;°CDS;1404901;;comp;;;;;;
fin;°CDS;578318;;;;;;;;;;;;;;

afn intercalaires tRNA[modifier | modifier le wikicode]

comp’;aa;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;;;;;;
;;;105;;105;;21;23;deb;
;;;122;comp’;361;;24;39;<201;20
;;;195;comp’;51;;54;45;total;25
;3 8 50 11 8;;200;comp’;188;;58;70;%;80%
;;;131;;145;;71;83;;
;30 52;;54;comp’;268;;73;93;fin;
;;;131;;194;;76;102;<201;17
;18 3 16;;96;comp’;61;;91;105;total;18
;;comp’;80;comp’;134;;96;106;%;94%
;4 8 9 13;;214;;111;;105;111;;
;;;73;;159;;119;112;total;
;2  8  9;;119;;127;;122;127;<201;37
;;;71;;156;;122;145;total;43
;;;58;;102;;131;156;%;86%
;2  1;;137;;112;;131;159;;
;;;24;comp’;393;;136;194;;
;;;21;;93;;137;196;;
;;comp’;158;;215;;182;215;;
;;;76;comp’;91;;195;;;
;6  8;;379;;83;;200;;;
;;;182;;;;214;;;
;;;136;;23;;222;;;
;;;222;;39;;379;;;
;12  111;;122;;106;;393;;;
;;;91;comp’;70;;451;;comp’;cumuls
;;;451;;45;;80;51;deb;2
;;;393;comp’;196;;158;61;<201;100%
;;;;;;;;91;fin;
;;;;;;;;134;<201;5
;deb;fin;total;;;;;188;total;8
<201;22;22;44;;;;;268;%;63%
total;27;26;53;;;;;361;total;10
taux;81%;85%;83%;;;;;393;<201;70%

afn par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;afn;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;11;3;2;;;;16;
16;moyen;5;12;;;;4;21;
14;fort;4;19;;;;;23;
; ;20;34;2;;;4;60;
10;g+cga;6;2;2;;;;10;
2;agg+cgg;2;;;;;;2;
4;carre ccc;3;1;;;;;4;
5;autres;;;;;;;;
;;11;3;2;;;;16;
;total tRNAs  ‰ ;;;;;;;;
;afn;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;183;50;33;;;;267;26
16;moyen;83;200;0;;;67;350;324
14;fort;67;317;0;;;;383;650
; ;333;567;33;;;67;60;729
10;g+cgg;100;33;33;;;;167;10
2;agg+cga;33;;;;;;33;
4;carre ccc;50;17;;;;;67;16
5;autres;;;;;;;;
;;183;50;33;;;;267;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;afn;1aa;>1aa;dup;;ref. ‰;1aa;>1aa;dup
21;faible;196;54;36;286;26;55;9;
16;moyen;89;214;;304;324;25;35;
14;fort;71;339;;411;650;20;56;
; ;357;607;36;56;729;20;34;
10;g+cgg;107;36;36;179;10;55;;
2;agg+cga;36;;;36;;18;;
4;carre ccc;54;18;;71;16;27;;
5;autres;;;;;;;;
;;196;54;36;286;;11;;

negativicutes, estimation des -rRNAs[modifier | modifier le wikicode]

negativicutes;;;;;;;;;;;;;;;;;;;;;;;;;
9 génomes total avec rRNA;;;;nega;total;ttt;tgt;;100 génomes total avec rRNA;;;;nega;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;9;149; ; ;;indices;;;;9;1656;0;0;;neg1;effectifs;;1aa+>1aa+dup;;;;56
atgi;1;tct;;tat;;atgf;3;;atgi;11;tct;;tat;;atgf;33;;atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;6;tcc;2;tac;4;tgc;2;;ttc;67;tcc;22;tac;44;tgc;22;;ttc;2;tcc;1;tac;1;tgc;2
atc;18;acc;;aac;11;agc;3;;atc;200;acc;;aac;122;agc;33;;atc;;acc;1;aac;2;agc;1
ctc;2;ccc;;cac;5;cgt;6;;ctc;22;ccc;;cac;56;cgt;67;;ctc;1;ccc;1;cac;1;cgt;1
gtc;;gcc;;gac;7;ggc;3;;gtc;;gcc;;gac;78;ggc;33;;gtc;1;gcc;1;gac;3;ggc;4
tta;4;tca;1;taa;;tga;;;tta;44;tca;11;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;;aca;5;aaa;5;aga;;;ata;;aca;56;aaa;56;aga;;;ata;;aca;1;aaa;2;aga;1
cta;1;cca;2;caa;6;cga;;;cta;11;cca;22;caa;67;cga;;;cta;1;cca;1;caa;1;cga;
gta;7;gca;21;gaa;6;gga;4;;gta;78;gca;233;gaa;67;gga;44;;gta;2;gca;;gaa;2;gga;1
ttg;2;tcg;;tag;;tgg;6;;ttg;22;tcg;;tag;;tgg;67;;ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;2;agg;;;atgj;11;acg;11;aag;22;agg;;;atgj;1;acg;1;aag;1;agg;1
ctg;2;ccg;;cag;;cgg;;;ctg;22;ccg;;cag;;cgg;;;ctg;2;ccg;1;cag;2;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;1;gcg;1;gag;1;ggg;1
;;69;;75;;5;149;;;;767;;833;;56;1656;;;;16;;24;;16;56
11.1.21 Paris;;;;nega;total;ttt;tgt;;22.1.21 Paris;;;;nega;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;143;6935;0;0;;indices;;;;9;571;;;;neg1;indices;;1aa+>1aa+dup;;;;5600
atgi;78;tct;;tat;;atgf;133;;atgi;89;tct;;tat;;atgf;167;;atgi;100;tct;;tat;;atgf;100
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;122;tcc;89;tac;133;tgc;122;;ttc;189;tcc;111;tac;178;tgc;144;;ttc;200;tcc;100;tac;100;tgc;200
atc;-11;acc;122;aac;167;agc;89;;atc;189;acc;122;aac;289;agc;122;;atc;;acc;100;aac;200;agc;100
ctc;100;ccc;78;cac;56;cgt;111;;ctc;122;ccc;78;cac;111;cgt;178;;ctc;100;ccc;100;cac;100;cgt;100
gtc;89;gcc;78;gac;189;ggc;333;;gtc;89;gcc;78;gac;267;ggc;367;;gtc;100;gcc;100;gac;300;ggc;400
tta;78;tca;100;taa;;tga;11;;tta;122;tca;111;taa;;tga;11;;tta;100;tca;100;taa;;tga;
ata;;aca;89;aaa;167;aga;100;;ata;;aca;144;aaa;222;aga;100;;ata;;aca;100;aaa;200;aga;100
cta;89;cca;100;caa;78;cga;22;;cta;100;cca;122;caa;144;cga;22;;cta;100;cca;100;caa;100;cga;
gta;189;gca;0;gaa;211;gga;67;;gta;267;gca;233;gaa;278;gga;111;;gta;200;gca;;gaa;200;gga;100
ttg;100;tcg;100;tag;;tgg;78;;ttg;122;tcg;100;tag;;tgg;144;;ttg;100;tcg;100;tag;;tgg;100
atgj;122;acg;89;aag;89;agg;100;;atgj;133;acg;100;aag;111;agg;100;;atgj;100;acg;100;aag;100;agg;100
ctg;89;ccg;78;cag;122;cgg;100;;ctg;111;ccg;78;cag;122;cgg;100;;ctg;200;ccg;100;cag;200;cgg;100
gtg;44;gcg;56;gag;56;ggg;89;;gtg;44;gcg;56;gag;56;ggg;89;;gtg;100;gcg;100;gag;100;ggg;100
;;1300;;2089;;1300;4689;;;;2067;;2922;;1356;6344;;;;1600;;2400;;1600;5600
rapports;;63;;71;;96;74;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;neg1;indices;;1aa+>1aa+dup;;différence;;
atgi;88;tct;;tat;;atgf;80;;fiches;50.667;;;fréquences;;;;;atgi;22;tct;;tat;;atgf;25
att;;act;;aat;;agt;;;total des aas sans rRNA;456;;;0/0;2;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;avec;152;;;10;11;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;genom;9;;;20;13;;;;gtt;;gct;;gat;;ggt;
ttc;65;tcc;80;tac;75;tgc;85;;;;;;30;9;;;;ttc;39;tcc;11;tac;25;tgc;39
atc;-6;acc;100;aac;58;agc;73;;neg1;56;;;40;5;;;;atc;100;acc;18;aac;17;agc;11
ctc;82;ccc;100;cac;50;cgt;63;;sans;56;;;50;3;41;;;ctc;0;ccc;22;cac;44;cgt;10
gtc;100;gcc;100;gac;71;ggc;91;;avec;4;;;60;2;;;;gtc;11;gcc;22;gac;37;ggc;17
tta;64;tca;90;taa;;tga;100;;genom;1;;;70;0;;;;tta;22;tca;0;taa;;tga;100
ata;;aca;62;aaa;75;aga;100;;;;;;80;0;;;;ata;;aca;11;aaa;17;aga;0
cta;89;cca;82;caa;54;cga;100;;L’estimation par nega;;;;90;0;;;;cta;11;cca;0;caa;22;cga;100
gta;71;gca;0;gaa;76;gga;60;;est  10% au dessus;;;;100;3;;;;gta;6;gca;;gaa;5;gga;33
ttg;82;tcg;100;tag;;tgg;54;;des aas sans;;;;;0;;;;ttg;0;tcg;0;tag;;tgg;22
atgj;92;acg;89;aag;80;agg;100;;;;;;;48;;;;atgj;18;acg;11;aag;11;agg;0
ctg;80;ccg;100;cag;100;cgg;100;;;;;;;;;;;ctg;56;ccg;22;cag;39;cgg;0
gtg;;gcg;;gag;100;ggg;100;;;;;;;;;;;gtg;56;gcg;44;gag;44;ggg;11
;;;;;;;;;;;;;;;;;;;;275;;263;;294;832

clostridia synthèse[modifier | modifier le wikicode]

clostridia distribution par génome[modifier | modifier le wikicode]

clos;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
psor;12;5;4;72;;7;;4;104
cdc;4;4;2;70;;3;;;83
cdc8;4;5;2;89;;4;;4;108
cbc*;36;10;;0;;0;;6;52
cbn;52;12;2;6;3;4;;7;86
cle;40;19;;26;3;9;;8;105
hmo;37;12;;39;;11;;10;109
cbei;63;11;3;0;;4;;12;93
;;;;;;;;;
total;248;78;13;302;6;42;0;51;740

clostridia distribution du total[modifier | modifier le wikicode]

clos8;;;;;;;628;;;;;;;;;57;;;;;;;;;55
atgi;10;tct;;tat;;atgf;22;;atgi;8;tct;;tat;;atgf;2;;atgi;;tct;;tat;;atgf;2
att;;act;;aat;;agt;1;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;3;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;19;tcc;7;tac;23;tgc;16;;ttc;6;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;;tgc;2
atc;3;acc;9;aac;22;agc;13;;atc;1;acc;1;aac;7;agc;1;;atc;11;acc;;aac;5;agc;
ctc;3;ccc;4;cac;16;cgt;11;;ctc;1;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;4;gcc;1;gac;32;ggc;20;;gtc;;gcc;;gac;1;ggc;4;;gtc;;gcc;5;gac;;ggc;
tta;22;tca;19;taa;;tga;3;;tta;4;tca;1;taa;;tga;;;tta;;tca;2;taa;;tga;
ata;1;aca;30;aaa;31;aga;24;;ata;;aca;;aaa;6;aga;1;;ata;;aca;3;aaa;;aga;
cta;19;cca;25;caa;22;cga;4;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;41;gca;;gaa;36;gga;29;;gta;;gca;5;gaa;2;gga;2;;gta;;gca;26;gaa;;gga;5
ttg;9;tcg;2;tag;;tgg;11;;ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;23;acg;4;aag;6;agg;6;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;6;ccg;2;cag;4;cgg;1;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;
gtg;1;gcg;1;gag;4;ggg;3;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos8;>1aa;1aa;-5s;+5s;-16s;+16s;total;;clos8;dupli;1aa;-5s;+5s;-16s;+16s;total
;248;78;13;302;6;42;740;;;;;;51;6;;57;;total;8;;13;;;42;55
;;;;;;;;;;;;;1-3aas;;;;;;;;;;;;

clostridia distribution par type[modifier | modifier le wikicode]

clos8;;;;;;;628;;clos8;1208;;;;;;78;;clos8;;;;;;;240;;clos8;;;;;;;8;;clos8;;;;;;;302
atgi;10;tct;0;tat;0;atgf;22;;atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;8;;atgi;;tct;;tat;;atgf;2;;atgi;9;tct;;tat;;atgf;11
att;0;act;0;aat;0;agt;1;;att;;act;;aat;;agt;1;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;3;cct;0;cat;0;cgc;0;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;2;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;19;tcc;7;tac;23;tgc;16;;ttc;1;tcc;6;tac;;tgc;1;;ttc;6;tcc;;tac;10;tgc;3;;ttc;;tcc;;tac;;tgc;2;;ttc;12;tcc;1;tac;13;tgc;10
atc;3;acc;9;aac;22;agc;13;;atc;;acc;3;aac;1;agc;3;;atc;;acc;3;aac;5;agc;5;;atc;;acc;;aac;;agc;;;atc;3;acc;3;aac;16;agc;5
ctc;3;ccc;4;cac;16;cgt;11;;ctc;2;ccc;1;cac;;cgt;1;;ctc;1;ccc;1;cac;8;cgt;3;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;2;cac;8;cgt;7
gtc;4;gcc;1;gac;32;ggc;20;;gtc;;gcc;1;gac;;ggc;;;gtc;2;gcc;;gac;15;ggc;11;;gtc;;gcc;;gac;;ggc;;;gtc;2;gcc;;gac;17;ggc;9
tta;22;tca;19;taa;0;tga;3;;tta;;tca;1;taa;;tga;3;;tta;11;tca;6;taa;;tga;;;tta;;tca;2;taa;;tga;;;tta;11;tca;10;taa;;tga;
ata;1;aca;30;aaa;31;aga;24;;ata;1;aca;2;aaa;;aga;;;ata;;aca;15;aaa;14;aga;10;;ata;;aca;;aaa;;aga;;;ata;;aca;13;aaa;17;aga;14
cta;19;cca;25;caa;22;cga;4;;cta;5;cca;4;caa;;cga;1;;cta;6;cca;10;caa;8;cga;3;;cta;;cca;;caa;;cga;;;cta;8;cca;11;caa;14;cga;
gta;41;gca;0;gaa;36;gga;29;;gta;;gca;;gaa;;gga;1;;gta;20;gca;;gaa;17;gga;13;;gta;;gca;;gaa;;gga;;;gta;21;gca;;gaa;19;gga;15
ttg;9;tcg;2;tag;0;tgg;11;;ttg;8;tcg;2;tag;;tgg;5;;ttg;1;tcg;;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;4
atgj;23;acg;4;aag;6;agg;6;;atgj;;acg;4;aag;1;agg;5;;atgj;10;acg;;aag;5;agg;1;;atgj;;acg;;aag;;agg;;;atgj;13;acg;;aag;;agg;
ctg;6;ccg;2;cag;4;cgg;1;;ctg;3;ccg;1;cag;3;cgg;;;ctg;1;ccg;;cag;1;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;2;ccg;1;cag;;cgg;
gtg;1;gcg;1;gag;4;ggg;3;;gtg;;gcg;1;gag;3;ggg;;;gtg;1;gcg;;gag;;ggg;3;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;1;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total
;248;78;13;302;6;42;740;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;;;;;*;;;

clostridia par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;clos8;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;31;19;2;6;2;5;65;
16;moyen;36;66;4;101;20;42;269;
14;fort;11;155;2;195;29;14;406;
; ;78;240;8;302;51;61;740;
10;g+cga;16;13;;2;;;31;
2;agg+cgg;5;2;;;1;;8;
4;carre ccc;4;4;;4;1;5;13;
5;autres;6;;2;;;;8;
;;31;19;2;6;2;5;65;
;total tRNAs  ‰ ;;;;;;;;
;clos8;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;42;26;3;8;3;7;88;26
16;moyen;49;89;5;136;27;57;364;324
14;fort;15;209;3;264;39;19;549;650
; ;105;324;11;408;69;82;740;729
10;g+cga;22;18;;3;;;42;10
2;agg+cgg;7;3;;;1;;11;
4;carre ccc;5;5;;5;1;7;18;16
5;autres;8;0;3;0;;;11;
;;42;26;3;8;3;7;88;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;clos8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;95;58;6;160;26;40;8;
16;moyen;110;202;12;325;324;46;28;
14;fort;34;475;6;515;650;14;65;
; ;239;736;25;326;729;78;240;
10;g+cga;49;40;;89;10;52;;
2;agg+cgg;15;6;;21;;16;;
4;carre ccc;12;12;;25;16;13;;
5;autres;18;;6;25;;19;;
;;95;58;6;160;;31;;

clostridia, estimation des -rRNAs[modifier | modifier le wikicode]

clostridia;;;;;;;;;;;;;;;;;;;;;;;;;
43 génomes total avec rRNA;;;;clos;total;ttt;tgt;;100 génomes total avec rRNA;;;;clos;total;ttt;tgt;;;;;;;;;
effectifs;sans +16s;;;43;856; ; ;;indices;;;;43;1991;;;;clos8;effectifs;;1aa+>1aa+dup;;;;326
atgi;29;tct;;tat;;atgf;30;;atgi;67;tct;;tat;;atgf;70;;atgi;1;tct;;tat;;atgf;11
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;1
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;3;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;44;tcc;1;tac;26;tgc;16;;ttc;102;tcc;2.3;tac;60;tgc;37;;ttc;7;tcc;6;tac;10;tgc;6
atc;72;acc;10;aac;64;agc;11;;atc;167;acc;23;aac;149;agc;26;;atc;;acc;6;aac;6;agc;8
ctc;2;ccc;3;cac;12;cgt;8;;ctc;4.7;ccc;7.0;cac;28;cgt;19;;ctc;3;ccc;2;cac;8;cgt;4
gtc;4;gcc;12;gac;40;ggc;23;;gtc;9.3;gcc;28;gac;93;ggc;53;;gtc;2;gcc;1;gac;15;ggc;11
tta;19;tca;13;taa;;tga;;;tta;44;tca;30;taa;;tga;;;tta;11;tca;9;taa;;tga;3
ata;;aca;29;aaa;48;aga;21;;ata;;aca;67;aaa;112;aga;49;;ata;1;aca;17;aaa;14;aga;10
cta;18;cca;17;caa;25;cga;1;;cta;42;cca;40;caa;58;cga;2.3;;cta;11;cca;14;caa;8;cga;4
gta;38;gca;92;gaa;45;gga;31;;gta;88;gca;214;gaa;105;gga;72;;gta;20;gca;;gaa;17;gga;14
ttg;;tcg;1;tag;;tgg;9;;ttg;;tcg;2.3;tag;;tgg;21;;ttg;9;tcg;2;tag;;tgg;7
atgj;18;acg;3;aag;2;agg;1;;atgj;42;acg;7.0;aag;4.7;agg;2.3;;atgj;10;acg;4;aag;6;agg;6
ctg;5;ccg;2;cag;1;cgg;3;;ctg;12;ccg;4.7;cag;2.3;cgg;7.0;;ctg;4;ccg;1;cag;4;cgg;1
gtg;1;gcg;;gag;4;ggg;2;;gtg;2.3;gcg;;gag;9.3;ggg;4.7;;gtg;1;gcg;1;gag;3;ggg;3
;;346;;468;;42;856;;;;805;;1088;;98;1991;;;;107;;168;;51;326
27.5.20 Tanger;;;;clos;total;ttt;tgt;;27.5.20 Tanger;;;;clos8;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;11144;4.0;0.6;;indices;sans +16s;;;174;11144;4.0;0.6;;clos8;indices;;1aa+>1aa+dup;;;;
atgi;92;tct;1.1;tat;;atgf;117;;atgi;159;tct;1.1;tat;;atgf;187;;atgi;13;tct;;tat;;atgf;138
att;1.1;act;;aat;;agt;0.6;;att;1.1;act;;aat;;agt;0.6;;att;;act;;aat;;agt;13
ctt;15.5;cct;2.3;cat;;cgc;;;ctt;15.5;cct;2.3;cat;;cgc;;;ctt;38;cct;;cat;;cgc;
gtt;0.6;gct;;gat;;ggt;;;gtt;0.6;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;104;tcc;101;tac;127;tgc;114;;ttc;206;tcc;103;tac;187;tgc;151;;ttc;88;tcc;75;tac;125;tgc;75
atc;-15;acc;79;aac;99;agc;107;;atc;152;acc;102;aac;248;agc;133;;atc;;acc;75;aac;75;agc;100
ctc;76;ccc;55;cac;112;cgt;97;;ctc;81;ccc;62;cac;140;cgt;116;;ctc;38;ccc;25;cac;100;cgt;50
gtc;44;gcc;33;gac;149;ggc;167;;gtc;53;gcc;61;gac;242;ggc;220;;gtc;25;gcc;13;gac;188;ggc;138
tta;128;tca;112;taa;1.1;tga;55;;tta;172;tca;142;taa;1.1;tga;55;;tta;138;tca;113;taa;;tga;38
ata;2.9;aca;151;aaa;159;aga;125;;ata;2.9;aca;218;aaa;271;aga;174;;ata;13;aca;213;aaa;175;aga;125
cta;106;cca;123;caa;98;cga;46;;cta;148;cca;163;caa;156;cga;48;;cta;138;cca;175;caa;100;cga;50
gta;198;gca;5;gaa;134;gga;171;;gta;286;gca;219;gaa;239;gga;243;;gta;250;gca;;gaa;213;gga;175
ttg;108;tcg;81;tag;2.3;tgg;99;;ttg;108;tcg;83;tag;2.3;tgg;120;;ttg;113;tcg;25;tag;;tgg;88
atgj;90;acg;70;aag;115;agg;94;;atgj;132;acg;77;aag;120;agg;96;;atgj;125;acg;50;aag;75;agg;75
ctg;64;ccg;59;cag;75;cgg;53;;ctg;76;ccg;64;cag;77;cgg;60;;ctg;50;ccg;13;cag;50;cgg;13
gtg;32;gcg;35;gag;74;ggg;65;;gtg;34;gcg;35;gag;83;ggg;70;;gtg;13;gcg;13;gag;38;ggg;38
;;1426;;1894;;1080;4400;;;;2231;;2982;;1177;6390;;;;1325;;2100;;638;4063
rapports;;64;;64;;92;69;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;clos8;indices;;1aa+>1aa+dup;;différence;;
atgi;58;tct;;tat;;atgf;63;;fiches;47.674;;;fréquences;;;;;atgi;86;tct;100;tat;;atgf;15
att;;act;;aat;;agt;;;total des aas sans rRNA;2050;;;0/0;;;;;att;100;act;;aat;;agt;95
ctt;100;cct;;cat;;cgc;;;avec;888;;;10;11;;;;ctt;59;cct;100;cat;;cgc;
gtt;;gct;;gat;;ggt;;;genom;43;;;20;6;;;;gtt;100;gct;;gat;;ggt;
ttc;50;tcc;98;tac;68;tgc;75;;;;;;30;10;;;;ttc;16;tcc;26;tac;1;tgc;34
atc;-10;acc;77;aac;40;agc;81;;clos8;40.75;;;40;5;;;;atc;100;acc;5;aac;24;agc;7
ctc;94;ccc;89;cac;80;cgt;84;;sans;326;;;50;4;36;;;ctc;51;ccc;55;cac;11;cgt;49
gtc;82;gcc;54;gac;62;ggc;76;;avec;752;;;60;3;;;;gtc;43;gcc;62;gac;21;ggc;17
tta;74;tca;79;taa;;tga;100;;genom;8;;;70;4;;;;tta;7;tca;1;taa;100;tga;32
ata;100;aca;69;aaa;59;aga;72;;;;;;80;3;;;;ata;77;aca;29;aaa;9;aga;0
cta;72;cca;75.7;caa;63;cga;95;;L’estimation par clos8;;;;90;1;;;;cta;23;cca;29;caa;2;cga;9
gta;69;gca;2;gaa;56;gga;70;;est  15 % en dessous;;;;100;2;;;;gta;21;gca;100;gaa;37;gga;2
ttg;100;tcg;97;tag;;tgg;83;;des aas sans;;;;;0;;;;ttg;4;tcg;69;tag;100;tgg;12
atgj;68;acg;91;aag;96;agg;98;;43;;100;;;49;;;;atgj;28;acg;29;aag;35;agg;20
ctg;85;ccg;93;cag;97;cgg;88;;atc;59;152;;;;;;;ctg;22;ccg;79;cag;33;cgg;76
gtg;93;gcg;100;gag;89;ggg;93;;gca;73;219;;;;;;;gtg;61;gcg;64;gag;49;ggg;43
;;;;;;;;;;;;;;;;;;;;265;;272;;944;1481

gamma[modifier | modifier le wikicode]

Shewanella[modifier | modifier le wikicode]

spl opérons[modifier | modifier le wikicode]

39.1%GC;30.6.19 Paris;16s  11;147;doubles;intercalaires
;Shewanella pealeana;;;;
;45136..46685;;16s;@1;339
;47025..49946;;23s;;112
;50059..50174;;5s;;
;;;;;
;51490..53039;;16s;;339
;53379..56298;;23s;;114
;56413..56528;;5s;;
;;;;;
;182271..183820;;16s;@2;71
;183892..183968;;atc;;65
;184034..184109;;gca;;364
;184474..187395;;23s;;112
;187508..187623;;5s;;100
;187724..187800;;gac;;
;;;;;
;191614..191689;;aca;;8
;191698..191782;;tac;;35
;191818..191891;;gga;;
;;;;;
;235182..236731;;16s;;374
;237106..240025;;23s;;114
;240140..240255;;5s;;
;;;;;
;243631..245180;;16s;;338
;245519..248440;;23s;;113
;248554..248669;;5s;;68
;248738..248813;;acc;;17
;248831..248946;;5s;;
;;;;;
;416766..416842;;cgg;;39
;416882..416957;;cac;;41
;416999..417075;;cca;+;58
;417134..417210;;cca;2 cca;
;;;;;
;493711..495260;;16s;;339
;495600..498519;;23s;;114
;498634..498749;;5s;;
;;;;;
;641376..641466;;tca;@3;1172
;642639..642729;;tca;;
;;;;;
;645847..647396;;16s;;71
;647468..647544;;atc;;65
;647610..647685;;gca;;329
;648015..650937;;23s;;156
;651094..651209;;5s;;
;;;;;
;728115..728199;;ttg;;
;;;;;
comp;1168942..1169018;;atgi;;
;;;;;
comp;1339706..1339781;;aca;+;52
comp;1339834..1339909;;ttc;2 ttc;539
comp;1340449..1340524;;aca;2 aca;52
comp;1340577..1340652;;ttc;;
;;;;;
comp;1342467..1342542;;aca;;52
comp;1342595..1342670;;ttc;;
;;;;;
;1456724..1456815;;agc;;21
;1456837..1456913;;cgt;+;30
;1456944..1457020;;cgt;7 cgt;32
;1457053..1457129;;cgt;3 agc;30
;1457160..1457236;;cgt;;33
;1457270..1457346;;cgt;;9
;1457356..1457447;;agc;;76
;1457524..1457600;;cgt;;35
;1457636..1457712;;cgt;;9
;1457722..1457813;;agc;;
;;;;;
comp;1627363..1627438;;agg;;
;;;;;
comp;1770483..1770558;;gta;+;37
comp;1770596..1770671;;gta;11 gta;37
comp;1770709..1770784;;gta;;37
comp;1770822..1770897;;gta;;37
comp;1770935..1771010;;gta;;37
comp;1771048..1771123;;gta;;37
comp;1771161..1771236;;gta;;37
comp;1771274..1771349;;gta;;37
comp;1771387..1771462;;gta;;37
comp;1771500..1771575;;gta;;39
comp;1771615..1771690;;gta;;
;;;;;
;1773910..1773985;;gcc;+;80
;1774066..1774141;;gaa;13 gaa;102
;1774244..1774319;;gaa;2 gcc;102
;1774422..1774497;;gaa;;102
;1774600..1774675;;gaa;;102
;1774778..1774853;;gaa;;102
;1774956..1775031;;gaa;;102
;1775134..1775209;;gaa;;102
;1775312..1775387;;gaa;;253
;1775641..1775716;;gaa;;102
;1775819..1775894;;gaa;;102
;1775997..1776072;;gaa;;102
;1776175..1776250;;gaa;;102
;1776353..1776428;;gaa;;47
;1776476..1776551;;gcc;;
;;;;;
;2081297..2082846;;16s;;338
;2083185..2086104;;23s;;114
;2086219..2086334;;5s;;
;;;;;
comp;2143274..2143350;;ccc;;
;;;;;
comp;2366164..2366240;;atgf;+;40
comp;2366281..2366357;;atgf;4 atgf;40
comp;2366398..2366474;;atgf;;40
comp;2366515..2366591;;atgf;;
;;;;;
;2376218..2376308;;tca;;
;;;;;
;2379767..2379842;;ggc;;13
;2379856..2379929;;tgc;;85
;2380015..2380100;;tta;;
;;;;;
;2550857..2550932;;ggc;;13
;2550946..2551019;;tgc;+;95
;2551115..2551200;;tta;3 tgc;634
;2551835..2551908;;tgc;3 tta;95
;2552004..2552089;;tta;;479
;2552569..2552642;;tgc;;132
;2552775..2552860;;tta;;
;;;;;
;2558019..2558109;;tca;;
;;;;;
comp;2717566..2717655;;tcc;;
;;;;;
comp;2759730..2759806;;atgf;+;189
comp;2759996..2760072;;atgf;4 atgf;45
comp;2760118..2760194;;gtc;2 gtc;2
comp;2760197..2760273;;atgf;;35
comp;2760309..2760385;;gtc;;13
comp;2760399..2760475;;atgf;;
;;;;;
;2858823..2858907;;tac;+;30
;2858938..2859022;;tac;5 tac;85
;2859108..2859192;;tac;;107
;2859300..2859384;;tac;;107
;2859492..2859576;;tac;;
;;;;;
;2866268..2866343;;aac;+;45
;2866389..2866464;;aac;7aac;41
;2866506..2866581;;aac;;26
;2866608..2866683;;aac;;32
;2866716..2866791;;aac;;33
;2866825..2866900;;aac;;40
;2866941..2867016;;aac;;
;;;;;
comp;2929429..2929505;;gac;+;97
comp;2929603..2929679;;gac;4 gac;97
comp;2929777..2929853;;gac;;83
comp;2929937..2930013;;gac;;
;;;;;
comp;3120289..3120364;;aaa;+;58
comp;3120423..3120498;;aaa;12 aaa;58
comp;3120557..3120632;;aaa;;58
comp;3120691..3120766;;aaa;;59
comp;3120826..3120901;;aaa;;57
comp;3120959..3121034;;aaa;;58
comp;3121093..3121168;;aaa;;58
comp;3121227..3121302;;aaa;;59
comp;3121362..3121437;;aaa;;58
comp;3121496..3121571;;aaa;;59
comp;3121631..3121706;;aaa;;59
comp;3121766..3121841;;aaa;;
;;;;;
comp;3269860..3269935;;cac;;8
comp;3269944..3270020;;aga;;63
comp;3270084..3270160;;cca;;
;;;;;
comp;3757983..3758059;;atgf;;
comp;3758163..3758249;;ctc;;
;;;;;
comp;3835257..3835331;;caa;+;51
comp;3835383..3835467;;cta;5 caa;131
comp;3835599..3835673;;caa;5 cta;20
comp;3835694..3835778;;cta;3 atg;96
comp;3835875..3835949;;caa;;49
comp;3835999..3836083;;cta;;211
comp;3836295..3836371;;atg;;5
comp;3836377..3836451;;caa;;47
comp;3836499..3836583;;cta;;55
comp;3836639..3836715;;atg;;5
comp;3836721..3836795;;caa;;47
comp;3836843..3836927;;cta;;55
comp;3836983..3837059;;atg;;
;;;;;
comp;3862885..3862961;;tgg;+;167
comp;3863129..3863205;;tgg;2 tgg;
;;;;;
comp;3867049..3867164;;5s;;114
comp;3867279..3870198;;23s;;338
comp;3870537..3872086;;16s;;
;;;;;
;3882154..3882229;;ttc;;
;;;;;
comp;4331488..4331563;;ggc;+;130
comp;4331694..4331769;;ggc;6 ggc;47
comp;4331817..4331892;;ggc;;162
comp;4332055..4332130;;ggc;;16
comp;4332147..4332222;;ggc;;48
comp;4332271..4332346;;ggc;;
;;;;;
comp;4616881..4616996;;5s;;112
comp;4617109..4620030;;23s;;364
comp;4620395..4620470;;gca;;65
comp;4620536..4620612;;atc;;71
comp;4620684..4622233;;16s;;
;;;;;
comp;5129770..5129846;;gac;;100
comp;5129947..5130062;;5s;;115
comp;5130178..5133097;;23s; ;339
comp;5133437..5134986;;16s;;

spl cumuls[modifier | modifier le wikicode]

spl cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;0;;1;;1;;100;
;16 23 5s 0;6;20;12;;50;;20;;200;
;16 atc gca;3;40;27;;100;;40;;300;
;16 23 5s a;2;60;28;;150;;60;;400;
;max a;3;80;3;;200;;80;;500;
;a doubles;0;100;8;;250;;100;;600;
;spéciaux;0;120;13;;300;;120;;700;
;total aas;9;140;3;;350;;140;;800;
sans ;opérons;29;160;0;;400;;160;;900;
;1 aa;8;180;2;;450;;180;;1000;
;max a;15;200;1;;500;;200;;1100;
;a doubles;15;;6;;;;;;;
;total aas;133;;103;;;0;;0;;0
total aas;;142;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;88;;;;;;;
;;;variance;143;;;;;;;
sans jaune;;;moyenne;58;;;;;;;
;;;variance;35;;;;;;;

spl blocs[modifier | modifier le wikicode]

spl blocs;;;;;;;
16s;339;339;374;339;338;338;
23s;112;114;114;114;114;114;
5s;;;;;;;
;;;;;;;
16s;71;71;71;16s;338;16s;339
atc;65;65;65;23s;113;23s;115
gca;364;329;364;5s;68;5s;100
23s;112;156;112;acc;17;gac;
5s;100;;;5s;;;
gac;;;;;;;

spl distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;6;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;1-3 aas;att;;act;;aat;;agt;;spl;att;;act;;aat;;agt;;spl;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;après 5s;ctt;;cct;;cat;;cgc;;gta11;ctt;;cct;;cat;;cgc;;gta11;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;acc;gtt;;gct;;gat;;ggt;;tca2;gtt;;gct;;gat;;ggt;;tca2;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;;2 gac;ttc;3;tcc;;tac;;tgc;4;cca2;ttc;;tcc;;tac;5;tgc;;cca2;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;3;tac5;atc;;acc;;aac;7;agc;;tac5;atc;;acc;1;aac;;agc;
ctc;;ccc;1;cac;;cgt;;;ctc;1;ccc;;cac;2;cgt;;aac7;ctc;;ccc;;cac;;cgt;7;aac7;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;séquences;gtc;2;gcc;2;gac;;ggc;;gac4 ;gtc;;gcc;;gac;4;ggc;8;gac4 ;gtc;;gcc;;gac;2;ggc;
tta;;tca;2;taa;;tga;;(aca ttc)2;tta;4;tca;;taa;;tga;;aaa12;tta;;tca;2;taa;;tga;;aaa12;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;(tgc tta)3;ata;;aca;4;aaa;;aga;1;gaa13;ata;;aca;;aaa;12;aga;;gaa13;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;(atf gtc)2;cta;5;cca;1;caa;5;cga;;atgf4+2;cta;;cca;2;caa;;cga;;atgf4+2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;(caa cta atgj)3 ;gta;;gca;;gaa;;gga;1;cgt5+2;gta;11;gca;;gaa;13;gga;;cgt5+2;gta;;gca;;gaa;;gga;
ttg;1;tcg;;tag;;tgg;;ou;ttg;;tcg;;tag;;tgg;;ggc8;ttg;;tcg;;tag;;tgg;2;ggc8;ttg;;tcg;;tag;;tgg;
atgj;;acg;;aag;;agg;1;(caa cta)5;atgj;3;acg;;aag;;agg;;tgg2;atgj;;acg;;aag;;agg;;tgg2;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
spl;;8;;;;;8;;spl;46;;;;;;46;;spl;79;;;;;;79;;spl;;;;3;;;3

spl intercalaires entre cds[modifier | modifier le wikicode]

spl;31.1.21 Paris;NCBI;spl 24-9-2020;;;;;;;;;
spl;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>frequence5;intercal;<u>frequencez
;'''négatif;426;10.1;'''négatif ;-7;10;-1 à -98;'''5 174 581;-1;426;610;5
;'''zéro;18;0.4;;;;;'''intercals;0;18;620;10
;'''1 à 200;2448;58.1;'''0 à 200;82;58;;'''730 981;5;168;630;7
;'''201 à 370;776;18.4;'''201 à 370;274;48;;'''14.1%;10;124;640;6
;'''371 à 600;378;9.0;'''371 à 600;462;62;;;15;138;650;6
;'''601 à max;167;4.0;'''601 à 1028;849;331;;;20;74;660;6
;'''total 4213;<201;68.6;'''total 4213;173;207;-98 à 3180;;25;69;670;7
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;64;680;6
3787762;3180;-1;426;-70;2;;0;18;35;68;690;3
2676990;2727;0;18;-60;0;;-1;°126;40;47;700;5
4795292;1942;1;°46;-50;4;;-2;2;45;49;710;6
3628609;1722;2;°53;-40;2;;-3;0;50;42;720;6
1384243;1674;3;°30;-30;5;'''min à -1;-4;°141;55;52;730;2
5168395;1593;4;22;-20;16;426;-5;0;60;67;740;7
1692692;1489;5;17;-10;70;10.1%;-6;0;65;56;750;4
4989087;1401;6;15;0;345;;-7;10;70;66;760;1
5017524;1331;7;16;10;292;;-8;°48;75;77;770;3
1530827;1329;8;°30;20;212;;-9;0;80;91;780;3
4000859;1318;9;°30;30;133;;-10;8;85;67;790;4
1999942;1254;10;°33;40;115;'''1 à 100;-11;°28;90;78;800;4
1605218;1225;11;°29;50;91;1561;-12;0;95;65;810;2
897237;1221;12;°36;60;119;37.1%;-13;5;100;81;820;3
1570703;1178;13;23;70;122;;-14;°15;105;41;830;1
4927424;1166;14;°30;80;168;;-15;1;110;61;840;3
1817514;1161;15;20;90;145;;-16;3;115;52;850;2
3532660;1157;16;10;100;146;;-17;°9;120;75;860;1
1716642;1154;17;16;110;102;;-18;0;125;64;870;4
1413389;1150;18;°22;120;127;;-19;1;130;64;880;2
2276940;1141;19;15;130;128;;-20;°7;135;37;890;3
600202;1140;20;11;140;82;;-21;0;140;45;900;1
1996502;1103;21;°14;150;78;;-22;0;145;45;910;2
3325479;1046;22;13;160;82;;-23;°4;150;33;920;2
223647;1016;23;13;170;80;'''1 à 200;-24;0;155;43;930;1
3589524;1016;24;°23;180;89;2448;-25;0;160;39;940;3
967539;1009;25;6;190;67;58.1%;-26;°2;165;42;950;3
4112640;1007;26;9;200;70;;-27;0;170;38;960;3
4903734;975;27;°23;210;61;;-28;1;175;45;970;1
3472661;968;28;9;220;64;;-29;°2;180;44;980;1
750412;959;29;12;230;58;;-30;0;185;34;990;0
2804938;959;30;11;240;59;;-31;0;190;33;1000;0
2670476;957;31;°20;250;48;;-32;°3;195;35;1010;2
2620635;946;32;13;260;52;;;434;200;35;1020;2
2967190;944;33;11;270;54;;reste;10;205;33;1030;0
4243039;944;34;°14;280;47;'''0 à 200;total;444;210;28;1040;0
2002234;937;35;10;290;56;2466;;;215;23;1050;1
3578230;936;36;7;300;44;;'''intercal;'''<u>frequencef;220;41;1060;0
4121391;933;37;°10;310;36;;600;4046;225;35;1070;0
1500535;926;38;°15;320;35;;650;34;230;23;1080;0
4952031;915;39;8;330;29;;700;27;235;32;1090;0
2490814;912;40;7;340;36;'''201 à 370;750;25;240;27;1100;0
2028503;909;reste;3017;350;30;776;800;15;245;25;1110;1
4150415;904;total;4213;360;30;18.4%;850;11;250;23;1120;0
2127775;897;;;370;37;;900;11;255;26;1130;0
1003095;887;;;380;19;;950;11;260;26;1140;1
2921392;885;;;390;24;;1000;5;265;31;1150;2
2262088;884;;;400;19;;1050;5;270;23;1160;2
2877064;877;;;410;32;;1100;0;275;24;1170;2
4984821;874;;;420;31;;1150;4;280;23;1180;1
4474909;866;;;430;24;;1200;5;285;30;1190;0
1417740;865;;;440;20;;1250;2;290;26;1200;0
4759907;862;;;450;20;;1300;1;295;19;reste;14
3297697;861;;;460;20;;1350;3;300;25;total;167
;;;;470;19;;1400;0;305;20;;
;;;;480;12;;1450;1;310;16;;
'''adresse;'''intercaln;'''décalage;'''long;490;12;;1500;1;315;20;;
4734113;-98;shift2;629;500;19;;1550;0;320;15;;
4557422;-77;shift2;764;510;13;;1600;1;325;15;;
2893452;-56;shift2;1688;520;14;;1650;0;330;14;;
4567483;-53;shift2;4142;530;12;;1700;1;335;17;;
5067715;-53;shift2;2369;540;12;'''371 à 600;1750;1;340;19;;
4015714;-52;comp;;550;9;378;1800;0;345;15;;
1735201;-43;;;560;11;9.0%;1850;0;350;15;;
1578876;-41;;;570;15;;1900;0;355;15;;
164778;-38;;;580;7;'''601 à max;1950;1;360;15;;
5173629;-34;;;590;7;167;;165;365;19;;
73781;-32;;;600;7;4.0%;;;370;18;;
2497076;-32;;;reste;167;;reste;2;reste;545;;
2892533;-32;;;total;4213;;total;4213;total;4213;;

spl autres intercalaires[modifier | modifier le wikicode]

spl;autres intercalaires;;adresses1;;;spl;autres intercalaires;;adresses2;;;spl;autres intercalaires;;adresses3;;;spl;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;43968;614;comp;;deb;°CDS;1337892;500;;;deb;°CDS;2379066;152;;;deb;°CDS;3757370;157;comp
;$rRNA;45140;349;;;;&tRNA;1339706;52;comp;;;&tRNA;2379767;13;;;;&tRNA;3757983;103;comp
;$rRNA;47032;132;;;;&tRNA;1339834;539;comp;;;&tRNA;2379856;85;;;;&tRNA;3758163;114;comp
;$rRNA;50059;1319;;;;&tRNA;1340449;52;comp;;;&tRNA;2380015;530;;;fin;°CDS;3758364;;comp
;$rRNA;51494;349;;;;&tRNA;1340577;545;comp;;fin;°CDS;2380631;;;;deb;°CDS;3834636;162;comp
;$rRNA;53386;132;;;deb;°CDS;1341198;34;;;deb;°CDS;2548825;595;;;;&tRNA;3835257;51;comp
;$rRNA;56413;339;;;;&tRNA;1342467;52;comp;;;&tRNA;2550857;13;;;;&tRNA;3835383;131;comp
fin;°CDS;56868;;comp;;;&tRNA;1342595;441;comp;;;&tRNA;2550946;95;;;;&tRNA;3835599;20;comp
deb;°CDS;146328;-16;comp;;fin;°CDS;1343112;;comp;;;&tRNA;2551115;634;;;;&tRNA;3835694;96;comp
;regulatory;146483;188;comp;;deb;°CDS;1455613;913;;;;&tRNA;2551835;95;;;;&tRNA;3835875;49;comp
fin;°CDS;146933;;;;;&tRNA;1456724;21;;;;&tRNA;2552004;479;;;;&tRNA;3835999;211;comp
deb;°CDS;181132;687;comp;;;&tRNA;1456837;30;;;;&tRNA;2552569;132;;;;&tRNA;3836295;5;comp
;$rRNA;182275;74;;;;&tRNA;1456944;32;;;;&tRNA;2552775;545;;;;&tRNA;3836377;47;comp
;&tRNA;183892;65;;;;&tRNA;1457053;30;;;fin;°CDS;2553406;;comp;;;&tRNA;3836499;55;comp
;&tRNA;184034;371;;;;&tRNA;1457160;33;;;deb;°CDS;2556685;89;;;;&tRNA;3836639;5;comp
;$rRNA;184481;132;;;;&tRNA;1457270;9;;;;&tRNA;2558019;184;;;;&tRNA;3836721;47;comp
;$rRNA;187508;100;;;;&tRNA;1457356;76;;;fin;°CDS;2558294;;comp;;;&tRNA;3836843;55;comp
;&tRNA;187724;606;;;;&tRNA;1457524;35;;;deb;°CDS;2716829;98;;;;&tRNA;3836983;495;comp
fin;°CDS;188407;;;;;&tRNA;1457636;9;;;;&tRNA;2717566;178;;;fin;°CDS;3837555;;comp
deb;°CDS;190429;234;comp;;;&tRNA;1457722;1058;;;fin;°CDS;2717834;;comp;;deb;°CDS;3862357;180;comp
;&tRNA;191614;8;;;fin;°CDS;1458872;;;;deb;°CDS;2758794;192;comp;;;&tRNA;3862885;167;comp
;&tRNA;191698;35;;;deb;°CDS;1564741;165;comp;;;&tRNA;2759262;128;comp;;;&tRNA;3863129;160;comp
;&tRNA;191818;195;;;;tmRNA;1566139;110;comp;;;&tRNA;2759496;128;comp;;fin;°CDS;3863366;;comp
fin;°CDS;192087;;;;fin;°CDS;1566605;;comp;;;&tRNA;2759730;189;comp;;deb;°CDS;3865578;454;
deb;°CDS;233942;647;;;deb;°CDS;1625951;581;comp;;;&tRNA;2759996;45;comp;;;$rRNA;3867049;132;comp
;$rRNA;235186;384;;;;&tRNA;1627363;176;comp;;;&tRNA;2760118;2;comp;;;$rRNA;3867297;348;comp
;$rRNA;237113;132;;;fin;°CDS;1627615;;comp;;;&tRNA;2760197;35;comp;;;$rRNA;3870540;807;comp
;$rRNA;240140;454;;;deb;°CDS;1769998;257;comp;;;&tRNA;2760309;13;comp;;fin;°CDS;3872890;;
deb;°CDS;240710;1908;comp;;;&tRNA;1770483;37;;;;&tRNA;2760399;353;comp;;deb;°CDS;3879732;289;comp
;$rRNA;243635;348;;;;&tRNA;1770596;37;;;fin;°CDS;2760829;;comp;;;&tRNA;3882154;187;
;$rRNA;245526;133;;;;&tRNA;1770709;37;;;deb;°CDS;2858049;291;comp;;fin;°CDS;3882417;;comp
;$rRNA;248554;68;;;;&tRNA;1770822;37;;;;&tRNA;2858823;30;;;deb;°CDS;3930329;122;comp
;&tRNA;248738;17;;;;&tRNA;1770935;37;;;;&tRNA;2858938;85;;;;regulatory;3932305;233;comp
;$rRNA;248831;703;;;;&tRNA;1771048;37;;;;&tRNA;2859108;107;;;fin;°CDS;3932761;;comp
fin;°CDS;249650;;;;;&tRNA;1771161;37;;;;&tRNA;2859300;107;;;deb;°CDS;4051244;82;
deb;°CDS;282426;135;;;;&tRNA;1771274;37;;;;&tRNA;2859492;315;;;;ncRNA;4051647;251;
;ncRNA;283404;313;;;;&tRNA;1771387;37;;;fin;°CDS;2859892;;;;fin;°CDS;4052080;;comp
fin;°CDS;284069;;comp;;;&tRNA;1771500;39;;;deb;°CDS;2863253;1011;comp;;deb;°CDS;4130284;211;comp
deb;°CDS;413908;236;comp;;;&tRNA;1771615;705;;;;&tRNA;2866268;45;;;;regulatory;4131260;506;comp
;&tRNA;416766;39;;;deb;°CDS;1772396;104;;;;&tRNA;2866389;41;;;fin;°CDS;4131919;;comp
;&tRNA;416882;41;;;;&tRNA;1773910;80;;;;&tRNA;2866506;26;;;deb;°CDS;4146436;183;
;&tRNA;416999;58;;;;&tRNA;1774066;102;;;;&tRNA;2866608;32;;;;regulatory;4146892;94;
;&tRNA;417134;320;;;;&tRNA;1774244;102;;;;&tRNA;2866716;33;;;fin;°CDS;4147086;;
fin;°CDS;417531;;comp;;;&tRNA;1774422;102;;;;&tRNA;2866825;40;;;deb;°CDS;4330369;663;comp
deb;°CDS;492003;1178;comp;;;&tRNA;1774600;102;;;;&tRNA;2866941;187;;;;&tRNA;4331488;20;comp
;$rRNA;493715;349;;;;&tRNA;1774778;102;;;fin;°CDS;2867204;;;;;&tRNA;4331584;13;comp
;$rRNA;495607;132;;;;&tRNA;1774956;102;;;deb;°CDS;2904901;188;comp;;;&tRNA;4331694;47;comp
;$rRNA;498634;768;;;;&tRNA;1775134;102;;;;regulatory;2907051;230;comp;;;&tRNA;4331817;47;comp
fin;°CDS;499518;;comp;;;&tRNA;1775312;253;;;fin;°CDS;2907380;;comp;;;&tRNA;4331940;15;comp
deb;°CDS;550745;-23;;;;&tRNA;1775641;102;;;deb;°CDS;2926979;572;comp;;;&tRNA;4332055;16;comp
;&tRNA;552630;286;comp;;;&tRNA;1775819;102;;;;&tRNA;2929429;97;comp;;;&tRNA;4332147;48;comp
fin;°CDS;553011;;;;;&tRNA;1775997;102;;;;&tRNA;2929603;97;comp;;;&tRNA;4332271;113;comp
deb;°CDS;640018;155;;;;&tRNA;1776175;102;;;;&tRNA;2929777;83;comp;;fin;°CDS;4332460;;comp
;&tRNA;641376;1172;;;;&tRNA;1776353;47;;;;&tRNA;2929937;124;comp;;deb;°CDS;4446808;66;comp
;&tRNA;642639;789;;;;&tRNA;1776476;977;;;fin;°CDS;2930138;;comp;;;regulatory;4449058;441;comp
deb;°CDS;643519;988;;;fin;°CDS;1777529;;comp;;deb;°CDS;3118298;830;comp;;fin;°CDS;4449582;;
;$rRNA;645851;74;;;deb;°CDS;1928606;113;comp;;;&tRNA;3120289;58;comp;;deb;°CDS;4452358;212;comp
;&tRNA;647468;65;;;;misc_feature;1930303;474;comp;;;&tRNA;3120423;58;comp;;;regulatory;4453881;104;
;&tRNA;647610;336;;;fin;°CDS;1930887;;;;;&tRNA;3120557;58;comp;;fin;°CDS;4454085;;
;$rRNA;648022;177;;;deb;°CDS;2079870;876;;;;&tRNA;3120691;59;comp;;deb;°CDS;4615072;798;
;$rRNA;651094;727;;;;$rRNA;2081301;348;;;;&tRNA;3120826;57;comp;;;$rRNA;4616881;132;comp
fin;°CDS;651937;;;;;$rRNA;2083192;132;;;;&tRNA;3120959;58;comp;;;$rRNA;4617129;371;comp
deb;°CDS;727650;330;comp;;;$rRNA;2086219;304;;;;&tRNA;3121093;58;comp;;;&tRNA;4620395;65;comp
;&tRNA;728115;695;;;fin;°CDS;2086639;;comp;;;&tRNA;3121227;59;comp;;;&tRNA;4620536;74;comp
fin;°CDS;728895;;;;deb;°CDS;2142913;136;;;;&tRNA;3121362;58;comp;;;$rRNA;4620687;206;comp
deb;°CDS;878528;406;;;;&tRNA;2143274;134;comp;;;&tRNA;3121496;59;comp;;fin;°CDS;4622436;;comp
;regulatory;879639;204;;;fin;°CDS;2143485;;comp;;;&tRNA;3121631;59;comp;;deb;°CDS;5003438;-13;comp
fin;°CDS;879989;;;;deb;°CDS;2225993;125;;;;&tRNA;3121766;193;comp;;;regulatory;5004406;257;comp
deb;°CDS;1166653;117;;;;regulatory;2226508;52;;;fin;°CDS;3122035;;comp;;fin;°CDS;5004800;;
;&tRNA;1168942;220;comp;;fin;°CDS;2226691;;;;deb;°CDS;3243130;634;;;deb;°CDS;5129088;427;comp
fin;°CDS;1169239;;comp;;deb;°CDS;2365103;455;comp;;;ncRNA;3244382;176;comp;;;&tRNA;5129770;100;comp
deb;°CDS;1284512;-193;;;;&tRNA;2366164;40;comp;;fin;°CDS;3244655;;comp;;;$rRNA;5129947;133;comp
;misc_feature;1284538;121;comp;;;&tRNA;2366281;40;comp;;deb;°CDS;3268300;255;comp;;;$rRNA;5130196;349;comp
fin;°CDS;1284778;;comp;;;&tRNA;2366398;40;comp;;;&tRNA;3269860;8;comp;;;$rRNA;5133440;611;comp
;;;;;;;&tRNA;2366515;383;comp;;;&tRNA;3269944;63;comp;;fin;°CDS;5135594;;comp
;;;;;;fin;°CDS;2366975;;;;;&tRNA;3270084;465;comp;;;;;;
;;;;;;deb;°CDS;2374251;254;comp;;fin;°CDS;3270626;;;;;;;;
;;;;;;;&tRNA;2376218;216;;;;;;;;;;;;;
;;;;;;fin;°CDS;2376525;;;;;;;;;;;;;;

spl intercalaires tRNA[modifier | modifier le wikicode]

spl ;intercalaires tRNA;;;;;;;;;;;
108 aas;pas de comp’;;;;;;;;;;;
aa1;aa2;aa3;;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
&234;&455;&830;;;;;606;;89;113;;
8;40*3;58*3;;comp’;&234;;195;;98;114;'''deb;
35;&152;59;;comp’;&236;comp’;320;;104;124;<201;9
&236;13;57;;comp’;-23;comp’;286;;152;134;total;18
39;85;58*2;;;&155;;789;;155;160;taux;50%
41;&595;59;;comp’;330;;695;;157;176;;
58;13;58;;comp’;117;;220;;162;187;'''fin;
&155;95;59*2;;comp’;&500;comp’;545;;180;193;<201;9
1172;634;&255;;comp’;&34;;441;;192;195;total;21
&500;95;8;;;&913;;1058;;255;216;taux;43%
52;479;63;;;581;;176;;427;220;;
539;132;&157;;comp’;&257;;705;;455;315;'''total;
52;&192;103;;;&104;comp’;977;;572;353;<201;18
&34;128*2;&162;;comp’;136;;134;;581;441;total;39
52;189;51;;;&455;comp’;383;;595;495;taux;46%
&913;45;131;;comp’;254;;216;;663;530;;
21;2;20;;;&152;;530;;830;606;;
30;35;96;;;89;comp’;184;;913;695;;
32;13;49;;;98;;178;;'''-;705;;
30;&291;211;;;&595;comp’;545;;'''-;789;;
33;30;5;;;&192;;353;;'''-;1058;'''comp’;'''cumuls
9;85;47;;comp’;&291;;315;;-23;178;'''deb;
76;107*2;55;;comp’;&1011;;187;;34;184;<201;4
35;&1011;5;;;&572;;124;;117;187;total;13
9;45;47;;;&830;;193;;136;286;taux;31%
&257;41;55;;;&255;comp’;465;;234;320;'''fin;
37*9;26;&180;;;&157;;114;;236;383;<201;3
39;32;167;;;&162;;495;;254;465;total;10
&104;33;&663;;;&180;;160;;257;545;taux;30%
80;40;20;;comp’;289;comp’;187;;289;545;;
102*7;&572;13;;;&663;;113;;291;977;'''total;
253;97*2;47*2;;;427;;;;330;'''-;<201;7
102*4;83;15;;;;;;;500;'''-;total;23
47;;16;;;;;;;1011;'''-;taux;30%
;;48;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;deb;fin;total
;;;;;;;;;<201;13;12;25
;;;;;;;;;total;31;31;62
;;;;;;;;;taux;42%;39%;40%

Vibrio parahaemolyticus[modifier | modifier le wikicode]

vpb opérons[modifier | modifier le wikicode]

45.3%GC;6.7.19 Paris;16s 11 ;126;doubles;intercalaires
Vibrio parahaemolyticus BB22OP;;;chr1;;
;33614..35175;;16s;@4;80
;35256..35331;;gaa;;2
;35334..35409;;aaa;;30
;35440..35515;;gta;;55
comp;35571..35768;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;59
;35828..38743;;23s;;73
;38817..38932;;5s;;
;;;;;
;49997..50073;;cgg;;32
;50106..50181;;cac;+;72
;50254..50330;;cca;2 cac;49
;50380..50455;;cac;2 cca;24
;50480..50556;;cca;;
;;;;;
comp;400045..400120;;atgi;;
;;;;;
;577971..579532;;16s;;88
;579621..579696;;gcc;;12
;579709..579784;;gaa;;258
;580043..582958;;23s;;73
;583032..583147;;5s;;30
;583178..583254;;gac;;35
;583290..583366;;tgg;;
;;;;;
comp;769649..769733;;cta;+;29
comp;769763..769847;;cta;10 cta;47
comp;769895..769971;;atg;4 atg;24
comp;769996..770080;;cta;5 caa;52
comp;770133..770207;;caa;;29
comp;770237..770321;;cta;;53
comp;770375..770451;;atg;;24
comp;770476..770560;;cta;;52
comp;770613..770687;;caa;;29
comp;770717..770801;;cta;;54
comp;770856..770930;;caa;;29
comp;770960..771044;;cta;;35
comp;771080..771154;;caa;;48
comp;771203..771287;;cta;;31
comp;771319..771403;;cta;;77
comp;771481..771557;;atg;;77
comp;771635..771709;;caa;;31
comp;771741..771825;;cta;;40
comp;771866..771942;;atg;;
;;;;;
;786939..787015;;cca;;
;;;;;
comp;802315..802391;;agg;;
;;;;;
;910219..910295;;aga;;
;;;;;
comp;982089..982173;;tac;+;81
comp;982255..982339;;tac;4 tac;81
comp;982421..982505;;tac;;81
comp;982587..982671;;tac;;
;;;;;
;1124715..1124802;;tcc;;
;;;;;
;1418321..1418397;;gtc;+;32
;1418430..1418506;;gtc;2gtc;
;;;;;
comp;1988127..1988202;;ggc;+;10
comp;1988213..1988299;;tta;2 ggc;76
comp;1988376..1988451;;ggc;;20
comp;1988472..1988545;;tgc;;
;;;;;
;2164082..2164157;;aac;;
;;;;;
;2193593..2193683;;tca;;
;;;;;
comp;2547884..2547960;;atgf;;56
comp;2548017..2548100;;ctc;;
;;;;;
;2652092..2652168;;cgt;+;56
comp;2652225..2652301;;cgt;9 cgt;57
comp;2652359..2652435;;cgt;2 agc;57
comp;2652493..2652569;;cgt;;57
comp;2652627..2652703;;cgt;;57
comp;2652761..2652837;;cgt;;56
comp;2652894..2652970;;cgt;;210
comp;2653181..2653257;;cgt;;31
comp;2653289..2653380;;agc;@5;320
comp;2653701..2653777;;cgt;;31
comp;2653809..2653900;;agc;;
;;;;;
;2735697..2735772;;ttc;+;64
;2735837..2735912;;aca;3 ttc;7
;2735920..2735995;;ttc;2 aca;70
;2736066..2736141;;aac;2 aac;71
;2736213..2736288;;aca;;7
;2736296..2736371;;ttc;;43
;2736415..2736490;;aac;;
;;;;;
;2738623..2738698;;ttc;;51
;2738750..2738825;;aca;+;21
;2738847..2738922;;aac;2 aca;39
;2738962..2739037;;aca;2 aac;15
;2739053..2739128;;aac;;
;;;;;
comp;2741263..2741339;;gac;;31
comp;2741371..2741487;;5s;;57
comp;2741545..2741620;;acc;;100
comp;2741721..2741836;;5s;;73
comp;2741910..2744825;;23s;;257
comp;2745083..2745158;;gca;;41
comp;2745200..2745276;;atc;;56
comp;2745333..2746894;;16s;;
;;;;;
comp;2755928..2756012;;ttg;;
;;;;;
comp;2847646..2847722;;tgg;;68
comp;2847791..2847867;;gac;;30
comp;2847898..2848013;;5s;;73
comp;2848087..2851002;;23s;;258
comp;2851261..2851336;;gaa;;80
comp;2851417..2852978;;16s;;
;;;;;
comp;2987485..2987561;;atgf;+;56
comp;2987618..2987693;;ggc;5 atgf;18
comp;2987712..2987788;;atgf;8 ggc;35
comp;2987824..2987899;;ggc;;50
comp;2987950..2988025;;ggc;;49
comp;2988075..2988150;;ggc;;49
comp;2988200..2988275;;ggc;;30
comp;2988306..2988382;;atgf;;55
comp;2988438..2988513;;ggc;;30
comp;2988544..2988620;;atgf;;39
comp;2988660..2988735;;ggc;;19
comp;2988755..2988831;;atgf;;35
comp;2988867..2988942;;ggc;;
;;;;;
comp;3060924..3061000;;tgg;;68
comp;3061069..3061145;;gac;;30
comp;3061176..3061291;;5s;;73
comp;3061365..3064280;;23s;;257
comp;3064538..3064613;;gta;;14
comp;3064628..3064703;;gca;;32
comp;3064736..3064811;;aaa;;2
comp;3064814..3064889;;gaa;;80
comp;3064970..3066531;;16s;@3;319
comp;3066851..3066966;;5s;;73
comp;3067040..3069955;;23s;;261
comp;3070217..3071778;;16s;;
;;;;;
comp;3105094..3105169;;acc;;13
comp;3105183..3105257;;gga;;35
comp;3105293..3105377;;tac;;36
comp;3105414..3105489;;aca;;
;;;;;
comp;3111073..3111149;;gac;;30
comp;3111180..3111295;;5s;;73
comp;3111369..3114284;;23s;;261
comp;3114546..3116107;;16s;@1;317
comp;3116425..3116540;;5s;;73
comp;3116614..3119529;;23s;;261
comp;3119791..3121352;;16s;;
;;;;;
comp;3175944..3176034;;tca;;69
comp;3176104..3176219;;5s;;73
comp;3176293..3179211;;23s;;257
comp;3179469..3179544;;gca;;41
comp;3179586..3179662;;atc;;56
comp;3179719..3181280;;16s;@2;
;;;;;
comp;3217187..3217263;;gac;;30
comp;3217294..3217409;;5s;;73
comp;3217483..3220398;;23s;;59
;3220458..3220655;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;55
comp;3220711..3220786;;gta;;30
comp;3220817..3220892;;aaa;;2
comp;3220895..3220970;;gaa;;80
comp;3221051..3222612;;16s;;
Vibrio parahaemolyticus BB22OP;;;chr2;;
;132908..134469;;16s;;80
;134550..134625;;gaa;;2
;134628..134703;;aaa;;16
;134720..134795;;gca;;14
;134810..134885;;gta;;54
comp;134940..135122;;MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS;CDS 180;19
;135142..138059;;23s;;73
;138133..138248;;5s;;69
;138318..138408;;tca;;
;;;;;
comp;192886..192969;;ctc;;
;;;;;
comp;591931..592021;;tca;;
;;;;;
comp;1009457..1009530;;tgc;;73
comp;1009604..1009690;;tta;;
;;;;;
comp;1021568..1021641;;tgc;;73
comp;1021715..1021801;;tta;;
;;;;;
comp;1029973..1030048;;ggc;;3
comp;1030052..1030125;;tgc;;

vpb cumuls[modifier | modifier le wikicode]

vpb cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;;1;;100;
;16 23 5s 0;0;20;9;8;50;;20;;200;
;16 atc gca;2;40;24;4;100;;40;;300;
;16 23 5s a;1;60;21;2;150;;60;;400;
;max a;6;80;9;2;200;;80;;500;
;a doubles;0;100;3;0;250;;100;;600;
;spéciaux;6;120;0;0;300;;120;;700;
;total aas;33;140;0;0;350;;140;;800;
sans ;opérons;25;160;0;0;400;;160;;900;
;1 aa;11;180;0;0;450;;180;;1000;
;max a;19;200;0;0;500;;200;;1100;
;a doubles;8;;1;0;;;;;;
;total aas;93;;67;16;;0;;0;;0
total aas;;126;;;;;;;;;
remarques;;5;;;;;;;;;
avec jaune;;;moyenne;46;26;;;;;;
;;;variance;29;22;;;;;;
sans jaune;;;moyenne;43;;;;;;;
;;;variance;17;;;;;;;

vpb blocs[modifier | modifier le wikicode]

vpb blocs;;;;;;;
16s;80;16s;80;16s;80;;
gaa;2;gaa;2;gaa;2;;
aaa;30;aaa;30;aaa;16;;
gta;55;gta;55;gca;14;;
cds 198;59;cds 198;59;gta;54;;
23s;73;23s;73;cds 180;19;;
5s;;5s;30;23s;73;;
;;gac;;5s;69;;
;;;;tca;;;
;;;;;;;
16s;56;16s;56;16s;88;16s;80
atc;41;atc;41;gcc;12;gaa;258
gca;257;gca;257;gaa;258;23s;73
23s;73;23s;73;23s;73;5s;30
5s;100;5s;69;5s;30;gac;
acc;57;tca;;gac;;;
5s;31;;;;;;
gac;;;;;;;
;;;;;;;
16s;261;16s;261;;;;
23s;73;23s;73;;;;
5s;319;5s;317;;;;
16s;80;16s;261;;;;
gaa;2;23s;73;;;;
aaa;32;5s;30;;;;
gca;14;gac;;;;;
gta;257;;;;;;
23s;73;;;;;;
5s;30;;;;;;
gac;;;;;;;

vpb distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;6;gtc2;atgi;;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;;cta2+2;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;;cgt8;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;ggc4;ttc;4;tcc;;tac;1;tgc;4;ggc4;ttc;;tcc;;tac;4;tgc;;ggc4;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;;;atc;;acc;1;aac;4;agc;2;;atc;;acc;;aac;;agc;;;atc;;acc;1;aac;;agc;
ctc;1;ccc;;cac;;cgt;;acc 5s + 1 >a;ctc;1;ccc;;cac;2;cgt;1;acc 5s + 1 >a;ctc;;ccc;;cac;;cgt;8;acc 5s + 1 >a;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;tca 2 5s+ 2 a;gtc;;gcc;;gac;;ggc;7;tca 2 5s+ 2 a;gtc;2;gcc;;gac;;ggc;4;tca 2 5s+ 2 a;gtc;;gcc;;gac;6;ggc;
tta;;tca;2;taa;;tga;;;tta;3;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;
ata;;aca;;aaa;;aga;1;;ata;;aca;5;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;;cca;1;caa;;cga;;;cta;6;cca;2;caa;5;cga;;;cta;4;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;3
atgj;;acg;;aag;;agg;1;;atgj;4;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
vpb;;11;;;;;11;;vpb;60;;;;;;60;;vpb;22;;;;;;22;;vpb;;;;12;;;12

Escherichia albertii[modifier | modifier le wikicode]

eal opérons[modifier | modifier le wikicode]

49.6%GC;10.3.19 Paris;16s   7;89;doubles;intercalaires
Escherichia albertii;;;;;
;219063..219144;;tac;+;212
;219357..219438;;tac;2 tac;
;;;;;
;413135..413219;;tcc;;
;;;;;
;462888..462972;;tca;;
;;;;;
comp;489120..489191;;gga;;6
comp;489198..489270;;aca;;
;;;;;
;615149..615233;;tcc;;
;;;;;
comp;756823..756895;;aaa;+;5
comp;756901..756973;;gta;3 aaa ;48
comp;757022..757094;;aaa;2 gta;5
comp;757100..757172;;gta;;48
comp;757221..757293;;aaa;;
;;;;;
;834529..834602;;atgj;+;10
;834613..834694;;cta;2atgj ;26
;834721..834792;;caa;2caa ;37
;834830..834901;;caa;2 cag;18
;834920..834993;;atgj;;51
;835045..835116;;cag;;35
;835152..835223;;cag;;
;;;;;
comp;968958..969031;;aga;;
;;;;;
comp;1192416..1192488;;acg;;
;;;;;
comp;1269526..1269599;;gac;;
;;;;;
comp;1277040..1277113;;gac;;52
comp;1277166..1277285;;5s;@1;169
comp;1277455..1280377;;23s;;186
comp;1280564..1280636;;gca;;45
comp;1280682..1280755;;atc;;70
comp;1280826..1282367;;16s;;
;;;;;
;1567231..1567314;;ctg;+;31
;1567346..1567429;;ctg;3 ctg;35
;1567465..1567548;;ctg;;
;;;;;
comp;1657309..1657390;;ttg;;
;;;;;
comp;1765401..1765473;;ggc;+;159
comp;1765633..1765705;;ggc;2 ggc;
;;;;;
;1795516..1795588;;ttc;;
;;;;;
comp;2006002..2006121;;5s;;169
comp;2006291..2009214;;23s;;186
comp;2009401..2009473;;gca;;45
comp;2009519..2009592;;atc;;70
comp;2009663..2011202;;16s;;
;;;;;
comp;2042057..2043241;;tuf1;CDS 1185pb;117
comp;2043359..2043431;;acc;;9
comp;2043441..2043512;;gga;;119
comp;2043632..2043713;;tac;;11
comp;2043725..2043797;;aca;@3;
;;;;;
comp;2047429..2047548;;5s;;169
comp;2047718..2050648;;23s;;186
comp;2050835..2050907;;gca;;45
comp;2050953..2051026;;atc;;68
comp;2051095..2052636;;16s;;
;;;;;
comp;2208305..2208424;;5s;@2;169
comp;2208594..2211517;;23s;;198
comp;2211716..2211788;;gaa;;85
comp;2211874..2213418;;16s;;
;;;;;
comp;2267554..2267627;;cca;;43
comp;2267671..2267754;;ctg;;23
comp;2267778..2267850;;cac;;61
comp;2267912..2267985;;cgg;;
;;;;;
comp;2305358..2305430;;tgg;;11
comp;2305442..2305515;;gac;;52
comp;2305568..2305687;;5s;;169
comp;2305857..2308779;;23s;;198
comp;2308978..2309050;;gaa;;85
comp;2309136..2310676;;16s;;
;;;;;
comp;2426158..2426248;;tga;;
;;;;;
;2556305..2556378;;ccg;;
;;;;;
;2810766..2812307;;16s;;85
;2812393..2812465;;gaa;;198
;2812664..2815586;;23s;;169
;2815756..2815875;;5s;;151
;2816027..2816099;;acc;;40
;2816140..2816259;;5s;;
;;;;;
;2911129..2911212;;ctc;;
;;;;;
; 2913088..2913161;;atgf;;
;;;;;
comp;3010332..3010404;;atgi;;
;;;;;
comp;3177717..3177789;;ttc;;
;;;;;
;3301617..3301687;;ggg;;
;;;;;
comp;3366868..3366941;;atgf;+;37
comp;3366979..3367052;;atgf;3 atgf;37
comp;3367090..3367163;;atgf;;
;;;;;
;3469914..3470003;;agc;;6
;3470010..3470083;;cgt;+;201
;3470285..3470358;;cgt;3 cgt;200
; 3470559..3470632;;cgt;;
;;;;;
;3505321..3505393;;atgi;;
;;;;;
;3563056..3564598;;16s;;85
;3564684..3564756;;gaa;;198
;3564955..3567876;;23s;;169
;3568046..3568165;;5s;;
;;;;;
comp;3779750..3779822;;aaa;;7
comp;3779830..3779902;;gta;+;47
comp;3779950..3780022;;gta;2 gta;
;;;;;
;3782718..3782790;;gcc;+;42
;3782833..3782905;;gcc;2 gcc;
;;;;;
comp;3810369..3810440;;agg;;
;;;;;
comp;3993500..3993573;;ccc;;
;;;;;
comp;4232176..4232248;;aac;;
;;;;;
;4233996..4234068;;aac;;
;;;;;
comp;4242952..4243024;;aac;;
;;;;;
comp;4248342..4248414;;aac;;
;;;;;
;4249406..4249492;;tcg;;
;;;;;
;4256696..4256768;;atgi;;100
;4256869..4256942;;aga;;
;;;;;
;4317980..4318052;;ggc;;56
;4318109..4318179;;tgc;;14
;4318194..4318277;;tta;;
;;;;;
comp;4556753..4556826;;gtc;+;7
comp;4556834..4556907;;gtc;2 gtc;

eal cumuls[modifier | modifier le wikicode]

eal cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;8;;100;;40;;300;
;16 23 5s a;0;60;7;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;1;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;13;140;0;;350;;140;;800;
sans ;opérons;38;160;1;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;1;;500;;200;;1100;
;a doubles;10;;2;;;;;;;
;total aas;71;;33;0;;0;;0;;0
total aas;;84;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;53;;;;;;;
;;;variance;59;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eal blocs[modifier | modifier le wikicode]

eal blocs;;;
16s;70;70;68
atc;45;45;45
gca;186;186;186
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;85;85
gaa;198;198;198
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;;
gaa;198;;
23s;169;;
5s;151;;
acc;40;;
5s;;;

eal distribution[modifier | modifier le wikicode]

atgi;2;tct;;tat;;atgf;1;atgi 2a+>a;atgi;1;tct;;tat;;atgf;;atgi 2a+>a;atgi;;tct;;tat;;atgf;3;atgi 2a+>a;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;;tgc;;gta2;ttc;;tcc;;tac;1;tgc;1;gta2;ttc;;tcc;;tac;2;tgc;;gta2;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;4;agc;;ctg3;atc;;acc;1;aac;;agc;1;ctg3;atc;;acc;;aac;;agc;;ctg3;atc;;acc;1;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;gcc2;ctc;;ccc;;cac;1;cgt;;gcc2;ctc;;ccc;;cac;;cgt;3;gcc2;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;tac2;gtc;;gcc;;gac;;ggc;1;tac2;gtc;2;gcc;2;gac;;ggc;2;tac2;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;1;caa2;tta;1;tca;;taa;;tga;;caa2;tta;;tca;;taa;;tga;;caa2;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;cag2;ata;;aca;2;aaa;4;aga;1;cag2;ata;;aca;;aaa;;aga;;cag2;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;atgf3;cta;1;cca;1;caa;;cga;;atgf3;cta;;cca;;caa;2;cga;;atgf3;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;cgt3;gta;2;gca;;gaa;;gga;2;cgt3;gta;2;gca;;gaa;;gga;;cgt3;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;;ggc2;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;;atgj;2;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;3;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;aaa (gta aaa)2;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
eal;;23;;;;;23;;eal;25;;;;;;25;;eal;23;;;;;;23;;eal;;;;4;;;4

Escherichia coli[modifier | modifier le wikicode]

eco opérons[modifier | modifier le wikicode]

Escherichia coli str. K-12 substr. MG1655;;;;;;;
50.6%GC;10.3.19 Paris;16s 7 ;89;doubles;interca;EcoCyc;adIP
;223771..225312;;16s;;68;opéron;
;225381..225457;;atc;;42;ileV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30045]
;225500..225575;;gca;;183;« ;
;225759..228662;;23s;;93;« ;
;228756..228875;;5s;@1;52;« ;
;228928..229004;;gac;;;aspU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30024]
;;;;;;;
;236931..237007;;gac;;;;
;;;;;;;
;262871..262946;;acg;;;;
;;;;;;;
;564723..564799;;aga;;;;
;;;;;;;
comp;696430..696504;;cag;+;37;opéron;
comp;696542..696616;;cag;2 cag;47;glnT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30029]
comp;696664..696740;;atg;2 atg;15;« ;
comp;696756..696830;;caa;2 caa;34;« ;
comp;696865..696939;;caa;;23;« ;
comp;696963..697047;;cta;;9;« ;
comp;697057..697133;;atg;;;;
;;;;;;;
;780554..780629;;aaa;+;135;lysT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30055]
;780765..780840;;gta;5 aaa;2;opéron;
;780843..780918;;aaa;2 gta;149;« ;
;781068..781143;;gta;;3;valZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6389]
;781147..781222;;aaa;;146;opéron;
;781369..781444;;aaa;;132;lysZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6391]
;781577..781652;;aaa;;;lysQ;[https://biocyc.org/gene?orgid=ECOLI&id=G6392]
;;;;;;EcoCyc;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30055&chromosome=COLI-K12]
comp;925884..925971;;tcc;;;InfA-serW;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
;;;;;;;
comp;1031625..1031712;;tca;;;;
;;;;;;;
comp;1097565..1097652;;tcc;;;;
;;;;;;;
comp;1287087..1287176;;tpr ;cds 90pb;67;tpr;
comp;1287244..1287328;;tac;+;209;opéron;
comp;1287538..1287622;;tac;2 tac;;tyrT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30106]
;;;;;;;
; 1746435..1746511;;gtc;+;4;valV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30111]
; 1746516..1746592;;gtc;2 gtc;;opéron;
;;;;;;«RNA 67pb;
comp;1991815..1991901;;tta;;12;leuZ;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1983402/2000314]
comp;1991914..1991987;;tgc;;54;« ;
comp;1992042..1992117;;ggc;;;opéron;
;;;;;;;
comp;2043468..2043557;;tcg;;;;
;;;;;;;
;2044549..2044624;;aac;;;;
;;;;;;;
comp;2058027..2058102;;aac;;;;
;;;;;;;
; 2059851..2059926;;aac;;;;
;;;;;;;
;2062260..2062335;;aac;;;;
;;;;;;;
;2286211..2286287;;ccc;;;;
;;;;;;;
;2466309..2466383;;agg;;;;
;;;;;;;
comp;2518041..2518116;;gcc;+;39;alaX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30012]
comp;2518156..2518231;;gcc;2 gcc;;opéron;
;;;;;;;
;2520931..2521006;;gta;+;44;valU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30110]
;2521051..2521126;;gta;3gta;46;opéron;
;2521173..2521248;;gta;;4;« ;
;2521253..2521328;;aaa;;;« ;
;;;;;;;
comp;2726069..2726188;;5s;@2;92;opéron;
comp;2726281..2729184;;23s;;184;;
comp;2729369..2729444;;gaa;;171;;
comp;2729616..2731157;;16s;;;;
;;;;;;;
comp;2785762..2785837;;atgi;;;;
;;;;;;;
comp;2817784..2817860;;cgt;+;198;« ;
comp;2818059..2818135;;cgt;4 cgt;62;« ;
comp;2818198..2818274;;cgt;;198;« ;
comp;2818473..2818549;;cgt;;3;opéron;
comp;2818553..2818645;;agc;;;serV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30013]
;;;;;;;
;2947387..2947463;;atgf;+;33;opéron;
;2947497..2947573;;atgf;3 atgf;33;metW;[https://biocyc.org/gene?orgid=ECOLI&id=EG31117]
;2947607..2947683;;atgf;;;« ;
;;;;;;;
comp;2998984..2999057;;ggg;;;;
;;;;;;;
;3110366..3110441;;ttc;;;;
;;;;;;;
;3215598..3215673;;atgi;;;;
;;;;;;;
comp;3318213..3318289;;atgf;;;;
;;;;;;;
comp;3322072..3322158;;ctc;;;;
;;;;;;;
comp;3423423..3423542;;5s;;37;« ;
comp;3423580..3423655;;acc;;12;« ;
comp;3423668..3423787;;5s;;92;« ;
comp;3423880..3426783;;23s;;174;« ;
comp;3426958..3427033;;gca;;42;« ;
comp;3427076..3427152;;atc;;68;ileU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30044]
comp;3427221..3428762;;16s;;;opéron;
;;;;;;;
comp;3708616..3708692;;ccg;;;;
;;;;;;;
;3836222..3836316;;tga;;;;
;;;;;;ecoliwiki;[https://ecoliwiki.org/colipedia/index.php/Category:rRNA_operons]
;3941808..3943349;;16s;;85;gltU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30033]
;3943435..3943510;;gaa;;193;opéron;
;3943704..3946607;;23s;;92;« ;
;3946700..3946819;;5s;;52;« ;
;3946872..3946948;;gac;;8;aspT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30023]
;3946957..3947032;;tgg;;;trpT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30105]
;;;;;;;
;3982375..3982451;;cgg;;57;argX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30017]
;3982509..3982585;;cac;;20;opéron;
;3982606..3982692;;ctg;;42;« ;
;3982735..3982811;;cca;;;« ;
;;;;;;;
;4035531..4037072;;16s;;68;opéron;
;4037141..4037217;;atc;;42;ileT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30043]
;4037260..4037335;;gca;;183;« ;
;4037519..4040423;;23s;;93;« ;
;4040517..4040636;;5s;;;« ;
;;;;;;;
;4166659..4168200;;16s;;171;opéron;
;4168372..4168447;;gaa;;193;;
;4168641..4171544;;23s;;92;;
;4171637..4171756;;5s;;;;
;;;;;;;
;4175388..4175463;;aca;@3;8;thrU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30101]
;4175472..4175556;;tac;;116;opéron;
;4175673..4175747;;gga;;6;« ;
;4175754..4175829;;acc;;114;« ;
;4175944..4177128;;tufb;cds 1185 pb;;« ;
;;;;;;;
;4208147..4209688;;16s;;85;opéron;
;4209774..4209849;;gaa;;193;;
;4210043..4212946;;23s;;93;;
;4213040..4213159;;5s;;;;
;;;;;;;
comp;4362551..4362626;;ttc;;;;
;;;;;;;
;4392360..4392435;;ggc;+;36;opéron;
;4392472..4392547;;ggc;3 ggc;35;glyX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30040]
;4392583..4392658;;ggc;;;« ;
;;;;;;;
;4496405..4496489;;ttg;;;;
;;;;;;;
comp;4606079..4606165;;ctg;+;34;opéron;
comp;4606200..4606286;;ctg;3 ctg;28;leuV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30051]
comp;4606315..4606401;;ctg;;;« ;

eco cumuls[modifier | modifier le wikicode]

eco cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;10;;100;;40;;300;
;16 23 5s a;0;60;6;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;0;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;14;140;2;;350;;140;;800;
sans ;opérons;36;160;2;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;2;;500;;200;;1100;
;a doubles;10;;1;;;;;;;
;total aas;72;;36;0;;0;;0;;0
total aas;;86;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;57;;;;;;;
;;;variance;60;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eco cds[modifier | modifier le wikicode]

les CDS eco pour opérons;;;;;;;;;
clusters;6.8.19 Paris ;;;interca;cdsa;promoteur;terminateur;notes;
;222833..223408;;cds;362;192;sigma FIS;;;
;223771..225312;;16s;68;;;;;
;225381..225457;;atc;42;;;;;
;225500..225575;;gca;183;;;;;
;225759..228662;;23s;93;;;;;
;228756..228875;;5s;52;;;;;
;228928..229004;;gac;162;;Terminateur;+ sigma;;
;229167..229970;;cds;;268;;;;
;;;;;;;;;
comp;2724448..2725746;;cds;322;433;rien;début opéron ;rien;
comp;2726069..2726188;;5s;92;;;;;
comp;2726281..2729184;;23s;184;;;;;
comp;2729369..2729444;;gaa;171;;;;;
comp;2729616..2731157;;16s;442;;sigma FIS;;;
comp;2731600..2734173;;cds;;858;;;;
;;;;;;;;;
;3422436..3423194;;cds;228;253;Terminateur;fin opéron ;rien;
comp;3423423..3423542;;5s;37;;;;;
comp;3423580..3423655;;acc;12;;;;;
comp;3423668..3423787;;5s;92;;;;;
comp;3423880..3426783;;23s;174;;;;;
comp;3426958..3427033;;gca;42;;;;;
comp;3427076..3427152;;atc;68;;;;;
comp;3427221..3428762;;16s;473;;sigma FIS;;;
;3429236..3429790;;cds;;185;;;;
;;;;;;;;;
comp;3940635..3941327;;cds;480;231;sigma FIS;;;
;3941808..3943349;;16s;85;;;;;
;3943435..3943510;;gaa;193;;;;;
;3943704..3946607;;23s;92;;;;;
;3946700..3946819;;5s;52;;;;;
;3946872..3946948;;gac;8;;;;;
;3946957..3947032;;tgg;95;;Terminateur;fin opéron ;rien;
comp;3947128..3947967;;cds;;280;;;;
;;;;;;;;;
;4034608..4035153;;cds;377;182;Sigma Lrp-leu;;;
;4035531..4037072;;16s;68;;;;;
;4037141..4037217;;atc;42;;;;;
;4037260..4037335;;gca;183;;;;;
;4037519..4040423;;23s;93;;;;;
;4040517..4040636;;5s;228;;;;;
;4040865..4040900;;rprg;5;;pas de Term;fin opéron ;rien;
comp;4040906..4041433;;cds;;176;;;;
;;;;;;;;;
;4165428..4166285;;cds;373;286;Sigma Lrp-leu;;;
;4166659..4168200;;16s;171;;;;;
;4168372..4168447;;gaa;193;;;;;
;4168641..4171544;;23s;92;;;;;
;4171637..4171756;;5s;300;;Terminateur;début opéron ;rien;
;4172057..4173085;;cds;;343;;;;
;;;;;;;;;
comp;4205943..4207532;;cds;614;530;sigma FIS;;;
;4208147..4209688;;16s;85;;;;;
;4209774..4209849;;gaa;193;;;;;
;4210043..4212946;;23s;93;;;;;
;4213040..4213159;;5s;74;;Terminateur;début opéron ;rien;
;4213234..4213617;;cds;;128;;;;
;;;;;;;;;
;695101..696276;;cds;31;392;;;;
comp;696308..696378;;rprg;51;;Terminateur;fin opéron;rien;
comp;696430..696504;;cag;37;;;;;
comp;696542..696616;;cag;47;;;;;
comp;696664..696740;;atg;15;;;;;
comp;696756..696830;;caa;34;;;;;
comp;696865..696939;;caa;23;;;;;
comp;696963..697047;;cta;9;;;;;
comp;697057..697133;;atg;379;;sigma FIS;fin opéron;rien;
comp;697513..699177;;cds;;555;;;;
;;;;;;;;;
;779598..780389;;cds;164;264;sigma FIS;fin opéron;rien;
;780554..780629;;aaa;135;;;;;
;780765..780840;;gta;2;;;;;
;780843..780918;;aaa;149;;;;;
;781068..781143;;gta;3;;;;;
;781147..781222;;aaa;146;;;;;
;781369..781444;;aaa;132;;;;;
;781577..781652;;aaa;432;;Terminateur;début opéron;NadR pas sigma;
;782085..783128;;cds;;348;;;;
;;;;;;;;;
;1286709..1286984;;cds;81;92;Terminateur;;;
comp;1287066..1287236;;ncRNA;-150;;;;;
comp;1287087..1287176;;tpr ;67;30;;;;
comp;1287244..1287328;;tac;209;;;;;
comp;1287538..1287622;;tac;159;;sigma FIS;;;
comp;1287782..1288624;;cds;;281;;;;
;;;;;;;;;
solitaires;;;;promoteur;terminateur;interc avant;interc après;protéines;lien
;236931..237007;;gac;sigma FIS;Term 1;133;328;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=228513/245425]
;262871..262946;;acg;sigma FIS;rien;115;204;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=262297/263521]
;564723..564799;;aga;sigma FIS;rien;243;16;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=564149/565373]
comp;925884..925971;;InfA-tcc;sigma FIS;Term 1;344;254;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
comp;1031625..1031712;;tca;sigma FIS;Term 2;207;427;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1023213/1040125]
comp;1097565..1097652;;tcc;sigma FIS;Term 4;736;234;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1089153/1106065]
comp;2043468..2043557;;tcg;sigma -;Term 1;570;94;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2035057/2051969]
;2044549..2044624;;aac;sigma -;Term 1;101;314;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2036131/2053043]
comp;2058027..2058102;;aac;sigma -;Term 1;453;101;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2049609/2066521]
; 2059851..2059926;;aac;sigma -;Term 1;5;38;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2051433/2068345]
;2062260..2062335;;aac;sigma NtrC;rien;327;56;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2053842/2070754]
;2286211..2286287;;ccc;sigma FIS;Term 1;75;103;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2277793/2294705]
;2466309..2466383;;agg;sigma -;Term 1;76;162;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2457890/2474802]
comp;2785762..2785837;;atgi;rien;rien;410;-37;évidence faible1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2777344/2794256]
comp;2998984..2999057;;ggg;sigma FIS;rien;156;79;évidence faible;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2990565/3007477]
;3110366..3110441;;ttc;sigma FIS;Term 1;106;149;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3101948/3118860]
;3215598..3215673;;atgi;sigma -;Term 1;125;54;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3207180/3224092]
comp;3318213..3318289;;atgf;sigma FIS;Term 2;207;348;protéines1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3309795/3326707]
comp;3322072..3322158;;ctc;sigma -;Term 1;459;15;protéine2;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3313659/3330571]
comp;3708616..3708692;;ccg;sigma FIS;Term 2;911;92;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3700198/3717110]
;3836222..3836316;;tga;sigma -;rien;293;109;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3827813/3844725]
comp;4362551..4362626;;ttc;sigma FIS;Term 1;198;107;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4354133/4371045]
;4496405..4496489;;ttg;sigma FIS;Term 1;196;261;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4487991/4504903]

eco blocs[modifier | modifier le wikicode]

eco blocs;;;;
16s;68;16s;68;68
atc;42;atc;42;42
gca;174;gca;183;183
23s;92;23s;93;93
5s;12;5s;52;
acc;37;gac;;
5s;;;;
;;;;
16s;85;171;171;85
gaa;193;184;193;193
23s;92;92;92;93
5s;52;;;
gac;;;;

eco distribution[modifier | modifier le wikicode]

atgi;2;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;;gac a+2 5s;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;;gtc2;gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;;tgc;;gta3;ttc;;tcc;;tac;1;tgc;1;gta3;ttc;;tcc;;tac;2;tgc;;gta3;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;4;agc;;ctg3;atc;;acc;1;aac;;agc;1;ctg3;atc;;acc;;aac;;agc;;ctg3;atc;;acc;1;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;gcc2;ctc;;ccc;;cac;1;cgt;;gcc2;ctc;;ccc;;cac;;cgt;4;gcc2;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;tac2;gtc;;gcc;;gac;;ggc;1;tac2;gtc;2;gcc;2;gac;;ggc;3;tac2;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;1;aaa3;tta;1;tca;;taa;;tga;;aaa3;tta;;tca;;taa;;tga;;aaa3;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;1;caa2;ata;;aca;1;aaa;3;aga;;caa2;ata;;aca;;aaa;3;aga;;caa2;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;cag2;cta;1;cca;1;caa;;cga;;cag2;cta;;cca;;caa;2;cga;;cag2;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;atgf3;gta;2;gca;;gaa;;gga;1;atgf3;gta;3;gca;;gaa;;gga;;atgf3;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;;cgt4;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;ggc3;atgj;2;acg;;aag;;agg;;ggc3;atgj;;acg;;aag;;agg;;ggc3;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;3;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;;séquences;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;(aaa gta)2 aaa3;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;(aaa gta)2 aaa3;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
eco;;23;;;;;23;;eco;20;;;;;;20;;eco;;23;;4;;;29;;eco;;;;4;;;4

eco intercalaires entre cds[modifier | modifier le wikicode]

eco;6.2.21 Paris;;eco 23-9-2020;;;;;;;
eco;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>frequence5
;'''négatif;738;18.3;'''négatif ;-9;14;-1 à -89;'''4 641 652;-1;738
;'''zéro;29;0.7;;;;;'''intercals;0;29
;'''1 à 200;2511;62.4;'''0 à 200;72;58;;'''421 229;5;203
;'''201 à 370;572;14.2;'''201 à 370;264;47;;'''9.1%;10;174
;'''371 à 600;142;3.5;'''371 à 600;440;60;;;15;176
;'''601 à max;32;0.8;'''601 à 1028;693;97;;;20;99
;'''total 4024;<201;81.5;'''total 4004;103;126;-89 à 950;;25;85
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;67
4538785;1455;-1;738;-70;30;;0;29;35;56
2901896;1372;0;29;-60;2;;-1;°163;40;87
2876581;950;1;°47;-50;2;;-2;2;45;80
2405703;919;2;°57;-40;12;;-3;0;50;72
4077449;852;3;°54;-30;18;'''min à -1;-4;°303;55;82
767978;846;4;°31;-20;45;738;-5;0;60;72
1985139;796;5;14;-10;84;18.3%;-6;0;65;66
310746;775;6;16;0;574;;-7;15;70;60
1253085;768;7;°26;10;377;;-8;°60;75;57
1102546;754;8;16;20;275;;-9;2;80;52
3111266;728;9;°58;30;152;;-10;6;85;50
2303905;714;10;°58;40;143;'''1 à 100;-11;°34;90;49
2455083;680;11;°50;50;152;1701;-12;1;95;58
3353121;674;12;42;60;154;42.3%;-13;3;100;56
1907448;669;13;23;70;126;;-14;°20;105;56
2798091;668;14;°37;80;109;;-15;0;110;64
83622;659;15;24;90;99;;-16;3;115;40
2136104;658;16;22;100;114;;-17;°10;120;51
4325298;657;17;20;110;120;;-18;2;125;34
4294481;641;18;19;120;91;;-19;5;130;53
1299567;634;19;14;130;87;;-20;°9;135;41
2404629;630;20;°24;140;90;;-21;2;140;49
4502103;626;21;18;150;78;;-22;3;145;26
582875;620;22;18;160;81;;-23;°7;150;52
4602088;618;23;14;170;72;'''1 à 200;-24;2;155;51
3922060;616;24;°25;180;62;2511;-25;4;160;30
384059;615;25;10;190;68;62.4%;-26;°8;165;36
3550080;611;26;15;200;61;;-27;1;170;36
1711523;610;27;14;210;72;;-28;4;175;34
1292509;604;28;12;220;66;;-29;°5;180;28
985894;602;29;11;230;40;;-30;1;185;36
88028;601;30;15;240;41;'''0 à 200;-31;1;190;32
4150447;597;31;9;250;41;2540;-32;°7;195;31
654583;588;32;10;260;47;;;712;200;30
1089866;586;33;10;270;27;;reste;55;205;39
;;34;15;280;37;;total;767;210;33
;;35;12;290;38;;;;215;29
;;36;°19;300;26;;'''intercal;'''<u>frequencef;220;37
;;37;18;310;22;;600;3992;225;16
;;38;13;320;29;;610;4;230;24
;;39;°22;330;18;;620;5;235;19
;;40;15;340;18;'''201 à 370;630;2;240;22
;;reste;2310;350;11;572;640;1;245;24
;;total;4024;360;20;14.2%;650;1;250;17
;;;;370;19;;660;3;255;19
'''adresse;'''intercaln;'''décalage;'''long;380;23;;670;2;260;28
164730;-2400;shift2;135;390;9;;680;2;265;15
2731600;-2130;shift2;0;400;18;;690;0;270;12
492092;-1295;shift2;0;410;10;;700;0;275;23
4577958;-897;1 et 2shift2;0;420;7;;710;0;280;14
1179520;-729;shift2;111;430;13;;720;1;285;21
3111128;-723;comp;138;440;8;;730;1;290;17
3838248;-530;comp;394;450;3;;740;0;295;17
10643;-527;comp;187;460;8;;750;0;300;9
1639030;-448;shift2;50;470;4;;760;1;305;10
3796948;-436;comp;824;480;6;;770;1;310;12
578107;-242;shift2;220;490;3;;780;1;315;14
508875;-212;shift2;2293;500;4;;790;0;320;15
3993739;-210;comp;111;510;1;;800;1;325;8
16751;-153;shift2;0;520;5;;810;0;330;10
1240260;-129;comp;75;530;3;;820;0;335;10
4011076;-113;comp;787;540;3;'''371 à 600;830;0;340;8
1491922;-110;shift2;40;550;4;142;840;0;345;7
3086145;-102;comp;42;560;3;3.5%;850;1;350;4
3519465;-89;shift2;1150;570;1;;860;1;355;13
1529922;-86;comp;397;580;3;'''601 à max;total;28;360;7
2475873;-85;shift2;221;590;2;32;;;365;13
19811;-82;shift2;422;600;1;0.8%;;;370;6
257923;-82;shift2;422;reste;32;;reste;4;reste;174
279178;-82;shift2;422;total;4024;;total;4024;total;4024

eco autres intercalaires[modifier | modifier le wikicode]

eco;autres intercalaires;;adresses1;;;eco;autres intercalaires;;adresses2;;;eco;autres intercalaires;;adresses3;;;eco;autres intercalaires;;adresses4;
;;;;;;;;;;;;;;;;;;;;;;
deb;°CDS;14168;88;;;deb;°CDS;1205731;-74;;;deb;°CDS;2170532;30;;;deb;°CDS;3579768;116;
;mobile;15387;-1287;;;;gene;1206131;-10;;;;misc_f;2171429;105;;;;ncRNA;3580922;121;
fin;°CDS;15445;;;;fin;°CDS;1206913;;;;deb;°CDS;2171833;47;;;fin;°CDS;3581138;;
deb;°CDS;16751;-9;;;deb;°CDS;1208517;-1;;;;gene;2172921;3;;;deb;°CDS;3581863;-4;
;ncRNA;16952;482;;;;gene;1209119;29;;;fin;°CDS;2174282;;;;;misc_f;3583038;0;
fin;°CDS;17489;;;;fin;°CDS;1209685;;;;deb;°CDS;2196474;111;;;;mobile;3583428;-713;
deb;°CDS;18715;175;;;deb;°CDS;1210346;233;;;;gene;2197410;9;;;fin;°CDS;3583483;;
;mobile;19796;-753;;;;gene;1211413;102;;;fin;°CDS;2200279;;;;deb;°CDS;3583677;24;
fin;°CDS;19811;;;;fin;°CDS;1211680;;;;deb;°CDS;2226509;52;;;;misc_f;3584205;94;
deb;°CDS;74497;35;;;deb;°CDS;1218983;399;;;;gene;2227323;223;;;fin;°CDS;3584404;;
;ncRNA;75516;35;;;;gene;1219601;56;;;fin;°CDS;2228982;;;;deb;°CDS;3623399;104;
deb;°CDS;75644;67;;;fin;°CDS;1222305;;;;deb;°CDS;2284376;74;;;;gene;3623887;245;
;ncRNA;77367;-206;;;deb;°CDS;1223264;114;;;;&tRNA;2286211;102;;;fin;°CDS;3624378;;
fin;°CDS;77388;;;;;gene;1223564;371;;;;misc_f;2286390;4;;;deb;°CDS;3630968;261;
deb;°CDS;188712;205;;;fin;°CDS;1224279;;;;;mobile;2288919;-1049;;;;gene;3632852;382;
;ncRNA;189712;26;;;deb;°CDS;1238879;238;;;deb;°CDS;2289065;68;;;fin;°CDS;3634841;;
fin;°CDS;189874;;;;;mobile;1240188;-30;;;;misc_f;2290114;319;;;deb;°CDS;3647705;274;
deb;°CDS;222833;362;;;fin;°CDS;1240260;;;;fin;°CDS;2290500;;;;;ncRNA;3648063;149;
;$rRNA;223771;68;;;deb;°CDS;1269168;47;;;deb;°CDS;2311646;334;;;;ncRNA;3648294;152;
;&tRNA;225381;42;;;;ncRNA;1269323;313;;;;ncRNA;2313084;311;;;fin;°CDS;3648528;;
;&tRNA;225500;183;;;deb;°CDS;1269703;47;;;fin;°CDS;2313488;;;;deb;°CDS;3650237;628;
;$rRNA;225759;93;;;;ncRNA;1269858;314;;;deb;°CDS;2328148;0;;;;misc_f;3651291;-1;
;$rRNA;228756;52;;;deb;°CDS;1270238;47;;;;gene;2329798;-67;;;;mobile;3652036;-1049;
;&tRNA;228928;162;;;;ncRNA;1270393;288;;;fin;°CDS;2334336;;;;deb;°CDS;3652182;73;
fin;°CDS;229167;;;;fin;°CDS;1270749;;;;deb;°CDS;2348822;214;;;;misc_f;3653236;247;
deb;°CDS;236067;132;;;deb;°CDS;1286709;81;;;;gene;2349687;41;;;fin;°CDS;3653961;;
;&tRNA;236931;327;;;;ncRNA;1287066;-150;;;fin;°CDS;2349935;;;;deb;°CDS;3656995;417;
fin;°CDS;237335;;;;deb;°CDS;1287087;67;comp;;deb;°CDS;2356904;12;;;;ncRNA;3657985;311;
deb;°CDS;238257;9;;;;&tRNA;1287244;209;comp;;;gene;2357816;40;;;deb;°CDS;3658366;98;
;gene;238746;105;;;;&tRNA;1287538;159;comp;;fin;°CDS;2358042;;;;;ncRNA;3658992;149;
;gene;239190;40;;;fin;°CDS;1287782;;comp;;deb;°CDS;2451584;19;;;fin;°CDS;3659232;;
fin;°CDS;239419;;;;deb;°CDS;1293527;281;;;;gene;2452356;81;;;deb;°CDS;3663890;245;
deb;°CDS;247637;223;;;;gene;1294426;-897;;;fin;°CDS;2455083;;;;;ncRNA;3664864;16;
;gene;248358;1;;;;mobile;1294426;40;;;deb;°CDS;2465301;75;;;fin;°CDS;3664986;;
;gene;250072;70;;;fin;°CDS;1295446;;;;;&tRNA;2466309;-15;;;deb;°CDS;3692618;-4;
fin;°CDS;250898;;;;deb;°CDS;1298598;253;;;;misc_f;2466369;-10039;;;;gene;3695233;11;
deb;°CDS;252709;305;;;;mobile;1299499;-1127;;;fin;°CDS;2466545;;;;fin;°CDS;3695997;;
;gene;253467;-32;;;fin;°CDS;1299567;;;;deb;°CDS;2470497;159;;;deb;°CDS;3699980;48;
;gene;253702;56;;;deb;°CDS;1380148;13;;;;gene;2470803;-29;;;;ncRNA;3700136;363;
fin;°CDS;254259;;;;;gene;1380821;-1;;;deb;°CDS;2471077;26;;;fin;°CDS;3700563;;
deb;°CDS;256527;57;;;;gene;1381789;44;;;;gene;2471544;49;;;deb;°CDS;3706098;910;comp
;misc_f;257829;8;;;fin;°CDS;1381947;;;;fin;°CDS;2472112;;;;;&tRNA;3708616;91;comp
;mobile;257908;-753;;;deb;°CDS;1394891;121;;;deb;°CDS;2476310;73;;;fin;°CDS;3708784;;comp
fin;°CDS;257923;;;;;mobile;1396044;-1127;;;;gene;2476584;95;;;deb;°CDS;3720448;-153;
deb;°CDS;258345;55;;;fin;°CDS;1396112;;;;fin;°CDS;2476694;;;;;gene;3720448;0;
;misc_f;258676;38;;;deb;°CDS;1404741;8;;;deb;°CDS;2513042;28;;;;mobile;3720633;-1396;
fin;°CDS;259045;;;;;ncRNA;1405658;227;;;;mobile;2514273;-1287;;;fin;°CDS;3720680;;
deb;°CDS;261503;114;;;fin;°CDS;1405979;;;;fin;°CDS;2514331;;;;deb;°CDS;3721198;26;
;&tRNA;262871;-49;;;deb;°CDS;1408050;95;;;deb;°CDS;2515643;208;;;;gene;3722076;222;
;misc_f;262898;-34056;;;;ncRNA;1409129;57;;;;&tRNA;2518041;39;comp;;fin;°CDS;3722328;;
;gene;263150;115;;;fin;°CDS;1409308;;;;;&tRNA;2518156;235;comp;;deb;°CDS;3750086;31;
fin;°CDS;263328;;;;deb;°CDS;1411013;-50;;;fin;°CDS;2518467;;comp;;;gene;3750813;3;
deb;°CDS;266110;-1;;;;misc_f;1411899;-22959;;;deb;°CDS;2519257;258;comp;;;gene;3750918;18;
;gene;266553;1;;;fin;°CDS;1412000;;;;;&tRNA;2520931;44;;;fin;°CDS;3751128;;
;gene;266776;216;;;deb;°CDS;1413531;-185;;;;&tRNA;2521051;46;;;deb;°CDS;3766337;41;
fin;°CDS;267184;;;;;ncRNA;1413556;-2;;;;&tRNA;2521173;4;;;;gene;3767221;254;
deb;°CDS;269289;23;;;fin;°CDS;1413733;;;;;&tRNA;2521253;264;;;deb;°CDS;3768177;0;
;mobile;270206;-263;;;deb;°CDS;1422752;32;;;fin;°CDS;2521593;;comp;;;gene;3768639;1;
;misc_f;270278;0;;;;gene;1423345;-245;;;deb;°CDS;2557318;11;;;;gene;3768892;88;
;mobile;270541;-1159;;;fin;°CDS;1423400;;;;;misc_f;2558691;-6623;;;deb;°CDS;3769345;267;
deb;°CDS;270603;7;;;deb;°CDS;1426454;-94;;;fin;°CDS;2558858;;;;;gene;3769948;96;
;mobile;271762;-427;;;;misc_f;1427389;0;;;deb;°CDS;2639301;19;;;fin;°CDS;3770243;;
;misc_f;271764;389;;;;mobile;1427599;-1049;;;;ncRNA;2640595;-1;;;deb;°CDS;3807064;67;
;ncRNA;272580;192;;;deb;°CDS;1427746;69;;;fin;°CDS;2640686;;;;;ncRNA;3808166;301;
deb;°CDS;272847;-38;;;;misc_f;1428796;64;;;deb;°CDS;2652494;515;;;fin;°CDS;3808540;;
;mobile;273955;-1049;;;fin;°CDS;1429049;;;;;ncRNA;2653855;-2;;;deb;°CDS;3834547;292;comp
fin;°CDS;274101;;;;deb;°CDS;1434293;551;;;fin;°CDS;2654157;;;;;&tRNA;3836222;108;
deb;°CDS;277756;11;;;;gene;1434958;176;;;deb;°CDS;2689671;58;;;;gene;3836425;396;
;gene;278814;0;;;fin;°CDS;1435185;;;;;ncRNA;2691157;315;;;fin;°CDS;3836953;;
;mobile;279163;-753;;;deb;°CDS;1435760;227;;;fin;°CDS;2691656;;;;deb;°CDS;3852890;129;
fin;°CDS;279178;;;;;ncRNA;1437121;28;;;deb;°CDS;2700117;322;;;;ncRNA;3853118;-73;
deb;°CDS;279600;55;;;fin;°CDS;1437260;;;;;ncRNA;2700520;19;;;;ncRNA;3853118;295;
;gene;279931;-174;;;deb;°CDS;1465165;161;;;fin;°CDS;2700618;;;;fin;°CDS;3853553;;
;mobile;279931;2;;;;misc_f;1465392;0;;;deb;°CDS;2725925;81;;;deb;°CDS;3860283;-4;
;gene;280114;-249;;;;mobile;1467910;-1320;;;;$rRNA;2726069;92;comp;;;gene;3861173;-1;
;mobile;280114;-41;;;fin;°CDS;1467921;;;;;$rRNA;2726281;184;comp;;fin;°CDS;3861349;;
fin;°CDS;280385;;;;deb;°CDS;1468784;96;;;;&tRNA;2729369;171;comp;;deb;°CDS;3923744;110;
deb;°CDS;290510;-5;;;;misc_f;1469246;0;;;;$rRNA;2729616;442;comp;;;rep_o;3925744;36;
;mobile;290634;-753;;;;mobile;1469296;-1159;;;fin;°CDS;2731600;;comp;;fin;°CDS;3926012;;
fin;°CDS;290649;;;;deb;°CDS;1469358;9;;;deb;°CDS;2731600;-21;;;deb;°CDS;3940635;480;comp
deb;°CDS;313141;473;;;;misc_f;1470519;207;;;;ncRNA;2734153;7;;;;$rRNA;3941808;85;
;gene;313716;551;;;fin;°CDS;1474221;;;;fin;°CDS;2734303;;;;;&tRNA;3943435;193;
;gene;314357;-16;;;deb;°CDS;1488232;41;;;deb;°CDS;2754896;214;;;;$rRNA;3943704;92;
;mobile;315229;-1193;;;;gene;1489713;188;;;;ncRNA;2755593;-15;;;;$rRNA;3946700;52;
fin;°CDS;315291;;;;deb;°CDS;1490902;9;;;;misc_f;2755941;-21813;;;;&tRNA;3946872;8;
deb;°CDS;315587;-4;;;;ncRNA;1491442;170;;;fin;°CDS;2756159;;;;;&tRNA;3946957;95;
;gene;316450;302;;;fin;°CDS;1491677;;;;deb;°CDS;2771840;12;;;fin;°CDS;3947128;;comp
;gene;317439;158;;;deb;°CDS;1491962;-11;;;;gene;2772167;135;;;deb;°CDS;3950507;2;
fin;°CDS;317726;;;;;ncRNA;1492119;295;;;deb;°CDS;2773318;523;;;;gene;3950560;-4;
deb;°CDS;380069;1;;;fin;°CDS;1492470;;;;;gene;2775545;102;;;fin;°CDS;3952201;;
;misc_f;380844;-1;;;deb;°CDS;1502457;35;;;fin;°CDS;2775919;;;;deb;°CDS;3959532;198;
;mobile;381260;-1240;;;;mobile;1503161;-1691;;;deb;°CDS;2777453;189;;;;gene;3960012;216;
fin;°CDS;381351;;;;;gene;1503218;67;;;;gene;2777972;160;;;fin;°CDS;3960677;;
deb;°CDS;381674;11;;;fin;°CDS;1503717;;;;deb;°CDS;2778146;338;;;deb;°CDS;3980887;102;
;misc_f;382591;-134;;;deb;°CDS;1526940;737;;;;gene;2783065;333;;;;&tRNA;3982375;57;
fin;°CDS;382739;;;;;gene;1527890;-17;;;fin;°CDS;2783638;;;;;&tRNA;3982509;20;
deb;°CDS;388753;523;;;fin;°CDS;1529922;;;;deb;°CDS;2784529;750;comp;;;&tRNA;3982606;42;
;misc_f;390251;-117;;;deb;°CDS;1530319;81;;;;&tRNA;2785762;559;comp;;;&tRNA;3982735;146;
deb;°CDS;391592;60;;;;gene;1530586;176;;;;gene;2786397;335;;;fin;°CDS;3982958;;
;mobile;391709;-1228;;;fin;°CDS;1531816;;;;fin;°CDS;2788985;;;;deb;°CDS;3984352;424;
fin;°CDS;391739;;;;deb;°CDS;1542672;323;;;deb;°CDS;2807132;191;;;;ncRNA;3986432;82;
deb;°CDS;392602;68;;;;gene;1544384;38;;;;gene;2808316;123;;;fin;°CDS;3986686;;
;misc_f;392970;87;;;fin;°CDS;1544758;;;;fin;°CDS;2809617;;;;deb;°CDS;4019624;-252;
fin;°CDS;394506;;;;deb;°CDS;1588853;332;;;deb;°CDS;2814218;68;;;;ncRNA;4019978;-4;
deb;°CDS;408177;147;;;;gene;1590334;317;;;;ncRNA;2814802;8;;;fin;°CDS;4020226;;
;gene;408609;-4;;;fin;°CDS;1590854;;;;fin;°CDS;2814883;;;;deb;°CDS;4034608;377;
fin;°CDS;408947;;;;deb;°CDS;1592176;222;;;deb;°CDS;2816937;280;comp;;;$rRNA;4035531;68;
deb;°CDS;475982;76;;;;gene;1592665;530;;;;&tRNA;2817784;198;comp;;;&tRNA;4037141;42;
;ncRNA;476448;110;;;fin;°CDS;1598617;;;;;&tRNA;2818059;62;comp;;;&tRNA;4037260;183;
fin;°CDS;476672;;;;deb;°CDS;1622741;-29;;;;&tRNA;2818198;198;comp;;;$rRNA;4037519;93;
deb;°CDS;506603;121;;;;ncRNA;1622817;45;;;;&tRNA;2818473;3;comp;;;$rRNA;4040517;269;
;ncRNA;507204;-2;;;fin;°CDS;1622960;;;;;&tRNA;2818553;315;comp;;fin;°CDS;4040906;;
fin;°CDS;507286;;;;deb;°CDS;1631002;-9;;;fin;°CDS;2818961;;comp;;deb;°CDS;4046966;146;
deb;°CDS;527581;-1;;;;misc_f;1632277;-19856;;;deb;°CDS;2884553;133;;;;ncRNA;4049899;123;
;gene;527949;-20;;;fin;°CDS;1632890;;;;;ncRNA;2887353;169;;;deb;°CDS;4050133;270;
;gene;528640;366;;;deb;°CDS;1648823;340;;;fin;°CDS;2887578;;;;;ncRNA;4051036;65;
;gene;529497;52;;;;ncRNA;1649382;174;;;deb;°CDS;2923784;42;;;fin;°CDS;4051347;;
fin;°CDS;529645;;;;fin;°CDS;1649609;;;;;ncRNA;2924156;210;;;deb;°CDS;4105820;9;
deb;°CDS;563848;242;comp;;deb;°CDS;1649794;92;;;fin;°CDS;2924735;;;;;ncRNA;4106330;81;
;&tRNA;564723;-45;;;;gene;1650078;-156;;;deb;°CDS;2941650;128;;;fin;°CDS;4106469;;
;misc_f;564755;-21242;;;;mobile;1650843;-668;;;;ncRNA;2942696;16;;;deb;°CDS;4156850;54;
deb;°CDS;564815;-121;;;;gene;1650881;-26;;;fin;°CDS;2942918;;;;;ncRNA;4158278;95;
;gene;565858;18;;;;gene;1651512;19;;;deb;°CDS;2946081;208;comp;;fin;°CDS;4158490;;
;gene;566098;14;;;fin;°CDS;1652728;;;;;&tRNA;2947387;33;;;deb;°CDS;4165428;373;
;gene;566376;-4;;;deb;°CDS;1744871;307;comp;;;&tRNA;2947497;33;;;;$rRNA;4166659;171;
;misc_f;566684;0;;;;&tRNA;1746435;4;;;;&tRNA;2947607;73;;;;&tRNA;4168372;193;
;mobile;566777;-1193;;;;&tRNA;1746516;107;;;fin;°CDS;2947757;;comp;;;$rRNA;4168641;92;
fin;°CDS;566842;;;;fin;°CDS;1746700;;;;deb;°CDS;2973855;87;;;;$rRNA;4171637;300;
deb;°CDS;567138;30;;;deb;°CDS;1764018;326;;;;ncRNA;2976102;114;;;fin;°CDS;4172057;;
;misc_f;568035;67;;;;ncRNA;1764713;153;;;;ncRNA;2976304;213;;;deb;°CDS;4174076;361;comp
fin;°CDS;568315;;;;fin;°CDS;1764934;;;;fin;°CDS;2976599;;;;;&tRNA;4175388;8;
deb;°CDS;573956;189;;;deb;°CDS;1769074;185;;;deb;°CDS;2989935;193;;;;&tRNA;4175472;116;
;misc_f;574529;4;;;;ncRNA;1770372;137;;;;gene;2990554;224;;;;&tRNA;4175673;6;
;mobile;574591;-1049;;;fin;°CDS;1770615;;;;fin;°CDS;2991268;;;;;&tRNA;4175754;114;
deb;°CDS;574737;68;;;deb;°CDS;1800642;523;;;deb;°CDS;2993638;82;;;fin;°CDS;4175944;;
;misc_f;575786;572;;;;gene;1803094;171;;;;gene;2993939;18;;;deb;°CDS;4189786;1;
fin;°CDS;577398;;;;fin;°CDS;1805165;;;;;gene;2994460;33;;;;ncRNA;4190327;247;
deb;°CDS;580834;-26;;;deb;°CDS;1922313;96;;;;gene;2994937;221;;;fin;°CDS;4190735;;
;gene;581354;-129;;;;ncRNA;1923066;-234;;;;gene;2995314;-59;;;deb;°CDS;4205943;614;
deb;°CDS;581534;54;;;;ncRNA;1923104;157;;;;gene;2995962;0;;;;$rRNA;4208147;85;
;gene;582152;68;;;fin;°CDS;1923365;;;;;mobile;2996361;-1320;;;;&tRNA;4209774;193;
fin;°CDS;582875;;;;deb;°CDS;1957032;308;;;fin;°CDS;2996372;;;;;$rRNA;4210043;93;
deb;°CDS;606265;350;;;;ncRNA;1958441;-1;;;deb;°CDS;2997235;88;;;;$rRNA;4213040;74;
;ncRNA;607734;43;;;fin;°CDS;1958520;;;;;gene;2997689;45;;;fin;°CDS;4213234;;
deb;°CDS;607836;18;;;deb;°CDS;1973360;-1674;;;deb;°CDS;2998034;155;comp;;deb;°CDS;4249554;228;
;mobile;608007;-1287;;;;gene;1973360;4;;;;&tRNA;2998984;78;comp;;;gene;4250703;222;
fin;°CDS;608065;;;;fin;°CDS;1975329;;;;fin;°CDS;2999136;;comp;;fin;°CDS;4252506;;
deb;°CDS;657555;92;;;deb;°CDS;1977847;305;;;deb;°CDS;3055612;41;;;deb;°CDS;4262840;56;
;gene;658031;128;;;;mobile;1978503;-753;;;;ncRNA;3055983;75;;;;ncRNA;4263139;-2;
fin;°CDS;658947;;;;fin;°CDS;1978518;;;;deb;°CDS;3056241;61;;;fin;°CDS;4263248;;
deb;°CDS;685929;11;;;deb;°CDS;1990954;128;comp;;;ncRNA;3056851;-102;;;deb;°CDS;4277469;-8;
;ncRNA;686681;-5;;;;ncRNA;1991748;0;comp;;fin;°CDS;3056890;;;;;ncRNA;4277926;412;
deb;°CDS;686839;103;;;;&tRNA;1991815;12;comp;;deb;°CDS;3058666;55;;;fin;°CDS;4278479;;
;mobile;687851;-1049;;;;&tRNA;1991914;54;comp;;;gene;3059381;141;;;deb;°CDS;4321697;20;
fin;°CDS;687997;;;;;&tRNA;1992042;151;comp;;fin;°CDS;3059753;;;;;gene;4322443;54;
deb;°CDS;695101;153;;;fin;°CDS;1992269;;comp;;deb;°CDS;3109553;105;;;fin;°CDS;4323336;;
;&tRNA;696430;37;comp;;deb;°CDS;1996110;88;;;;&tRNA;3110366;148;;;deb;°CDS;4360396;256;
;&tRNA;696542;47;comp;;;ncRNA;1996921;4;;;fin;°CDS;3110590;;comp;;;gene;4362191;197;
;&tRNA;696664;15;comp;;fin;°CDS;1997062;;;;deb;°CDS;3129043;-70;;;;&tRNA;4362551;106;comp
;&tRNA;696756;34;comp;;deb;°CDS;2010600;143;;;;mobile;3130146;-1127;;;fin;°CDS;4362733;;comp
;&tRNA;696865;23;comp;;;gene;2011223;150;;;fin;°CDS;3130214;;;;deb;°CDS;4391604;210;
;&tRNA;696963;9;comp;;;misc_f;2012502;-162;;;deb;°CDS;3146450;118;;;;&tRNA;4392360;36;
;&tRNA;697057;379;comp;;;gene;2012502;-81;;;;gene;3146856;-95;;;;&tRNA;4392472;35;
fin;°CDS;697513;;comp;;fin;°CDS;2012700;;;;fin;°CDS;3147597;;;;;&tRNA;4392583;233;
deb;°CDS;715412;40;;;deb;°CDS;2024986;9;;;deb;°CDS;3185414;59;;;fin;°CDS;4392892;;comp
;gene;715947;123;;;;ncRNA;2025223;197;;;;misc_f;3186025;0;;;deb;°CDS;4426628;271;
;gene;716721;75;;;fin;°CDS;2025511;;;;;mobile;3186096;-1240;;;;gene;4427694;-17;
fin;°CDS;716946;;;;deb;°CDS;2033119;164;;;fin;°CDS;3186187;;;;fin;°CDS;4428079;;
deb;°CDS;733776;117;;;;ncRNA;2033649;311;;;deb;°CDS;3186510;16;;;deb;°CDS;4457959;176;
;gene;734220;-4;;;;gene;2034051;591;;;;misc_f;3187432;15;;;;gene;4459488;44;
fin;°CDS;735650;;;;fin;°CDS;2035835;;;;fin;°CDS;3189881;;;;fin;°CDS;4459900;;
deb;°CDS;736445;200;;;deb;°CDS;2042368;569;;;deb;°CDS;3192864;195;;;deb;°CDS;4495190;195;comp
;gene;736900;130;;;;&tRNA;2043468;93;comp;;;ncRNA;3194721;-100;;;;&tRNA;4496405;185;
fin;°CDS;738092;;;;deb;°CDS;2043651;100;;;deb;°CDS;3194766;271;;;;misc_f;4496675;-1191;
deb;°CDS;764180;0;;;;&tRNA;2044549;313;;;;ncRNA;3195097;-100;;;;gene;4496750;240;
;ncRNA;765050;2;;;deb;°CDS;2044938;261;;;fin;°CDS;3195141;;;;;mobile;4498181;-1240;
fin;°CDS;765153;;;;;gene;2052276;314;;;deb;°CDS;3214967;124;comp;;fin;°CDS;4498272;;
deb;°CDS;779598;164;;;fin;°CDS;2053643;;;;;&tRNA;3215598;53;;;deb;°CDS;4498595;92;
;&tRNA;780554;135;;;deb;°CDS;2056858;452;;;fin;°CDS;3215727;;comp;;;gene;4499593;468;
;&tRNA;780765;2;;;;&tRNA;2058027;100;comp;;deb;°CDS;3268415;613;;;deb;°CDS;4501260;500;
;&tRNA;780843;149;;;deb;°CDS;2058203;4;comp;;;ncRNA;3270216;32;;;;mobile;4502090;-1413;
;&tRNA;781068;3;;;;&tRNA;2059851;37;;;fin;°CDS;3270625;;;;fin;°CDS;4502103;;
;&tRNA;781147;146;;;fin;°CDS;2059964;;comp;;deb;°CDS;3280217;10;;;deb;°CDS;4506448;52;
;&tRNA;781369;132;;;deb;°CDS;2061016;326;comp;;;gene;3280701;19;;;;gene;4506626;4;
;&tRNA;781577;432;;;;&tRNA;2062260;55;;;;gene;3281122;350;;;;gene;4506861;15;
fin;°CDS;782085;;;;fin;°CDS;2062391;;comp;;fin;°CDS;3281976;;;;;mobile;4507125;-262;
deb;°CDS;851014;127;;;deb;°CDS;2065219;255;;;deb;°CDS;3309033;14;;;;misc_f;4507197;7;
;ncRNA;852725;-196;;;;misc_f;2066020;-12681;;;;ncRNA;3311183;16;;;;mobile;4507459;-1214;
fin;°CDS;852869;;;;;gene;2066068;4;;;fin;°CDS;3311415;;;;deb;°CDS;4507466;62;
deb;°CDS;887423;19;;;;mobile;2066159;-1049;;;deb;°CDS;3317554;206;comp;;;mobile;4508680;-323;
;ncRNA;887979;76;;;deb;°CDS;2066305;74;;;;&tRNA;3318213;347;comp;;;gene;4508684;64;
fin;°CDS;888134;;;;;gene;2067360;368;;;fin;°CDS;3318637;;;;;mobile;4509007;-793;
deb;°CDS;923264;343;;;;gene;2068261;215;;;deb;°CDS;3319988;458;comp;;;misc_f;4509009;-1;
;&tRNA;925884;253;comp;;;misc_f;2068635;0;;;;&tRNA;3322072;14;comp;;;misc_f;4509479;10;
fin;°CDS;926225;;comp;;;mobile;2068941;-1320;;;fin;°CDS;3322173;;comp;;;gene;4509804;556;
deb;°CDS;1030759;206;comp;;fin;°CDS;2068952;;;;deb;°CDS;3349806;117;;;fin;°CDS;4510690;;
;&tRNA;1031625;426;comp;;deb;°CDS;2069815;96;;;;ncRNA;3350577;-9;;;deb;°CDS;4518372;31;
fin;°CDS;1032139;;;;;misc_f;2070277;311;;;fin;°CDS;3350689;;;;;mobile;4518472;-713;
deb;°CDS;1049439;33;;;;gene;2070786;105;;;deb;°CDS;3362807;-4;;;deb;°CDS;4518527;-82;
;mobile;1049778;-713;;;;ncRNA;2071317;27;;;;misc_f;3365185;0;;;;gene;4518721;113;
fin;°CDS;1049833;;;;fin;°CDS;2071539;;;;;mobile;3365556;-1049;;;fin;°CDS;4519338;;
deb;°CDS;1079305;542;;;deb;°CDS;2077940;414;;;deb;°CDS;3365702;72;;;deb;°CDS;4527549;-4;
;gene;1081356;57;;;;gene;2078549;-103;;;;misc_f;3366755;-4;;;;ncRNA;4527977;44;
fin;°CDS;1082243;;;;fin;°CDS;2078575;;;;fin;°CDS;3366926;;;;fin;°CDS;4528111;;
deb;°CDS;1092876;10;;;deb;°CDS;2099862;127;;;deb;°CDS;3403484;36;;;deb;°CDS;4530530;398;
;mobile;1094245;-1228;;;;misc_f;2101396;4;;;;gene;3404495;0;;;;gene;4532050;126;
fin;°CDS;1094275;;;;;mobile;2101749;-1049;;;;gene;3404638;404;;;fin;°CDS;4532437;;
deb;°CDS;1095138;106;;;deb;°CDS;2101895;68;;;fin;°CDS;3405436;;;;deb;°CDS;4533796;376;
;gene;1095544;-4;;;;misc_f;2102944;1;;;deb;°CDS;3418390;430;;;;gene;4534430;339;
deb;°CDS;1095843;735;;;fin;°CDS;2103391;;;;;gene;3419042;67;;;;gene;4535015;565;
;&tRNA;1097565;233;comp;;deb;°CDS;2152469;182;;;fin;°CDS;3420134;;;;fin;°CDS;4536597;;
fin;°CDS;1097886;;;;;ncRNA;2153311;-106;;;deb;°CDS;3422436;228;;;deb;°CDS;4567287;478;
deb;°CDS;1146011;-7;;;deb;°CDS;2153349;237;;;;$rRNA;3423423;37;;;;gene;4568998;243;
;ncRNA;1146589;36;;;;ncRNA;2153646;-101;;;;&tRNA;3423580;12;;;fin;°CDS;4570162;;
fin;°CDS;1146794;;;;fin;°CDS;2153681;;;;;$rRNA;3423668;92;;;deb;°CDS;4572414;203;
deb;°CDS;1195123;-165;;;deb;°CDS;2165668;84;;;;$rRNA;3423880;174;;;;gene;4574135;56;
;misc_f;1196209;-14546;;;;ncRNA;2167114;-18;;;;&tRNA;3426958;42;;;fin;°CDS;4576912;;
fin;°CDS;1196867;;;;;misc_f;2167183;-510;;;;&tRNA;3427076;68;;;deb;°CDS;4579499;-6;
deb;°CDS;1203822;9;;;deb;°CDS;2167302;81;;;;$rRNA;3427221;473;;;;ncRNA;4579835;156;
;gene;1204170;-234;;;;gene;2167602;168;;;fin;°CDS;3429236;;;;fin;°CDS;4580068;;
deb;°CDS;1204170;-1137;;;fin;°CDS;2167989;;;;deb;°CDS;3558268;-19;;;deb;°CDS;4605804;38;
;gene;1204401;11;;;deb;°CDS;2168712;81;;;;gene;3559848;16;;;;&tRNA;4606079;34;comp
fin;°CDS;1205549;;;;;misc_f;2169693;3;;;fin;°CDS;3560622;;;;;&tRNA;4606200;28;comp
;;;;;;;mobile;2170171;-1193;;;;;;;;;;&tRNA;4606315;267;comp
;;;;;;fin;°CDS;2170236;;;;;;;;;;fin;°CDS;4606669;;comp

eco intercalaires tRNA[modifier | modifier le wikicode]

eco;intercalaires tRNAs;;;;;;;;;
;;;;;;;;;;
comp’;aas;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;162;;67;14;;
;;;132;;327;;74;78;;
;;;114;;;;75;91;'''deb;
;;comp’;242;;;;100;100;<201;11
6 aas;37 47 15 34 23 9;comp’;153;;379;;102;106;total;18
6 aas;135 2 149 3 146 132;;164;;432;;105;107;taux;61%
;;comp’;343;;253;;114;114;;
;;;206;comp’;426;;128;146;'''fin;
;;comp’;735;comp’;233;;132;151;<201;11
;209;;67;;159;;155;159;total;19
;4;comp’;307;;107;;164;162;taux;58%
;12 54;;128;;151;;206;235;;
;;comp’;569;comp’;93;;206;253;'''total;
;;;100;;313;;210;267;<201;22
;;comp’;452;;100;;280;313;total;37
;;comp’;4;comp’;37;;458;315;taux;59%
;;comp’;326;comp’;55;;750;327;;
;;;74;;;;910;379;;
;;;75;;;;'''-;432;comp’;cumuls
;39;comp’;208;;235;;4;37;;
;44 46 4;comp’;258;comp’;264;;38;53;;
;;;750;;;;124;55;'''deb;
4 aas;198 62 198 3;;280;;315;;153;73;<201;5
;;comp’;208;comp’;73;;195;93;total;17
;33 33;;155;;78;;208;95;taux;29%
;;;105;comp’;148;;208;148;;
;;comp’;124;comp’;53;;242;233;'''fin;
;;;206;comp’;347;;258;264;<201;7
;;;458;;14;;292;347;total;10
;;;910;;91;;307;'''-;taux;70%
;;comp’;292;;;;326;'''-;;
;8;;;comp’;95;;343;'''-;'''total;
;57 20 42;;102;;146;;361;'''-;<201;12
;8 116 6;comp’;361;;114;;452;'''-;total;27
;;;;;106;;569;'''-;taux;44%
;36 35;;210;comp’;233;;735;'''-;;
;;comp’;195;;;;;;;
;34 28;comp’;38;;267;;;;;
;;;;;;;;;;
;;;;;;;;deb;fin;total
;;;;;;;<201;16;18;34
;;;;;;;total;35;29;64
;;;;;;;taux;46%;62%;53%

Escherichia coli Nissle 1917[modifier | modifier le wikicode]

ecoN opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Esch_coli_Nissle_1917/eschColi_NISSLE_1917-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP007799.1;ecoN;;genome;;;;;;;;;
50%GC;21.8.19 Paris;16s  10 ;123 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;;
Escherichia coli Nissle 1917 ;;;;;;;;;;;;
;231864..232436;;CDS;;365;365;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
;232802..234321;;16s;;73;;;;1520;;;
;234395..234471;;gaa;;12;;;12;;;;
;234484..234557;;gca;;174;;;;;;;
;234732..237319;;23s;;83;;;;2588;;;
;237403..237518;;5s;;54;;;;116;;;
;237573..237649;;gac;;162;162;;;;162;;
;237812..238615;;CDS;;;;;;268;;2,5-didehydrogluconate reductase DkgB;*
;;;;;;;;;;;;
;244934..245665;;CDS;;132;132;;;244;;DNA polymerase III subunit epsilon;*
;245798..245874;;gac;;120;120;;;;120;;
comp;245995..246852;;CDS;;;;;;286;;DUF4942 domain-containing protein;*
;;;;;;;;;;;;
;367329..368582;;CDS;;114;114;;;418;114;glutamate-5-semialdehyde dehydrogenase;*
;368697..368772;;acg;;154;154;;;;;;
;368927..369265;;CDS;;;;;;113;;DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;631149..632015;;CDS;;270;270;;;289;;bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD;*
;632286..632362;;aga;;15;15;;;;15;;
comp;632378..632997;;CDS;;;;;;207;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;733188..734363;;CDS;;153;153;;;392;153;2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;*
comp;734517..734591;;cag;+;37;;37;;;;;
comp;734629..734703;;cag;2 cag;48;;48;;;;;
comp;734752..734828;;atgj;2 atgj;15;;15;;;;;
comp;734844..734918;;caa;2 caa;34;;34;;;;;
comp;734953..735027;;caa;;23;;23;;;;;
comp;735051..735135;;cta;;10;;10;;;;;
comp;735146..735222;;atgj;;380;380;;;;;;
comp;735603..737267;;CDS;;;;;;555;;asparagine synthase B;*
;;;;;;;;;;;;
;807377..808169;;CDS;;164;164;;;264;164;Pseudo, cell division protein CpoB;*
;808334..808409;;aaa;+;35;;35;;;;;
;808445..808520;;gta;5 aaa;2;;2;;;;;
;808523..808598;;aaa;2 gta;51;;51;;;;;
;808650..808725;;gta;;3;;3;;;;;
;808729..808804;;aaa;;48;;48;;;;;
;808853..808928;;aaa;;33;;33;;;;;
;808962..809037;;aaa;;277;277;;;;;;
;809315..810358;;CDS;;;;;;348;;quinolinate synthase NadA;*
;;;;;;;;;;;;
;950069..952345;;CDS;;343;343;;;*759;343;ATP-dependent Clp protease ATP-binding subunit ClpA;*
comp;952689..952776;;tcc;;253;253;;;;;;
comp;953030..953248;;CDS;;;;;;73;;translation initiation factor IF-1;*
;;;;;;;;;;;;
comp;1047224..1047883;;CDS;;206;206;;;220;206;FtsH protease modulator YccA;*
comp;1048090..1048177;;tca;;426;*426;;;;;;
;1048604..1049722;;CDS;;;;;;373;;hydrogenase 1 small subunit;*
;;;;;;;;;;;;
;1183656..1184018;;CDS;;463;*463;;;121;;hp;*
;1184482..1184558;;aga;;278;278;;;;278;;
> comp;1184837..1185786;;CDS;;;;;;317;;Pseudo, IS4 family transposase;*
;;;;;;;;;;;;
;1213982..1214809;;CDS;;165;165;;;276;165;DUF4942 domain-containing protein;*
comp;1214975..1215062;;tcc;;233;233;;;;;;
;1215296..1216234;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1216817..1217098;;CDS;;165;165;;;94;165;DUF4942 domain-containing protein;*
comp;1217264..1217351;;tcc;;234;234;;;;;;
;1217586..1218524;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1457038..1458129;;CDS;;16;16;;;364;16;acyl-CoA desaturase;*
comp;1458146..1458277;;ncRNA;;46;;;;44;;RtT sRNA;
comp;1458324..1458408;;tac;+;33;;33;;;;;
comp;1458442..1458526;;tac;2 tac;159;159;;;;;;
comp;1458686..1459528;;CDS;;;;;;281;;formyltetrahydrofolate deformylase;*
;;;;;;;;;;;;
comp;1829066..1830322;;CDS;;307;307;;;419;;hp;*
;1830630..1830706;;gtc;+;4;;4;;;;;
;1830711..1830787;;gtc;2 gtc;6;6;;;;6;;
<;1830794..1831177;;CDS;@4;;;;;128;;Pseudo, multidrug efflux MATE transporter MdtK;*
;;;;;;;;;;;;
comp;1831218..1832474;;CDS;;307;307;;;419;;hp;*
;1832782..1832858;;gtc;+;4;;4;;;;;
;1832863..1832939;;gtc;2 gtc;8;8;;;;8;;
<;1832948..1833280;;CDS;;;;;;111;;Pseudo, MATE family efflux transporter;*
;;;;;;;;;;;;
comp;1833321..1834577;;CDS;;307;307;;;419;;hp;*
;1834885..1834961;;gtc;+;4;;4;;;;;
;1834966..1835042;;gtc;2 gtc;108;108;;;;108;;
;1835151..1835456;;CDS;;;;;;102;;monooxygenase;*
;;;;;;;;;;;;
comp;2115794..2116459;;CDS;;195;195;;;222;;UPF0149 family protein YecA;*
comp;2116655..2116741;;tta;;12;;12;;;;;
comp;2116754..2116827;;tgc;;53;;53;;;;;
comp;2116881..2116956;;ggc;;151;151;;;;151;;
comp;2117108..2117656;;CDS;;;;;;183;;CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase;*
;;;;;;;;;;;;
comp;2191451..2192287;;CDS;;278;278;;;279;;hp;*
comp;2192566..2192655;;tcg;;93;93;;;;93;;
;2192749..2193546;;CDS;;100;100;;;266;100;DgsA anti-repressor MtfA;*
;2193647..2193722;;aac;;161;161;;;;;;
;2193884..2195146;;CDS;;;;;;421;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2232607..2233323;;CDS;;453;*453;;;239;;YebC/PmpR family DNA-binding transcriptional regulator;*
comp;2233777..2233852;;acc;;326;326;;;;326;;
;2234179..2235096;;CDS;;;;;;306;;nitrogen assimilation transcriptional regulator;*
;;;;;;;;;;;;
;2235198..2236148;;CDS;;37;37;;;317;;HTH-type transcriptional regulator Cbl;*
comp;2236186..2236261;;aac;;4;4;;;;4;;
;2236266..2237909;;CDS;;100;100;;;548;100;toxic metabolite efflux MATE transporter YeeO;*
;2238010..2238085;;aac;;161;161;;;;;;
;2238247..2239518;;CDS;;;;;;424;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2546968..2548728;;CDS;;74;74;;;587;74;cardiolipin transport protein PbgA;*
;2548803..2548879;;ccc;;101;101;;;;;;
comp;2548981..2549136;;CDS;;;;;;52;;autotransporter outer membrane beta-barrel domain-containing protein;*
;;;;;;;;;;;;
;2717780..2718712;;CDS;;75;75;;;311;75;formate/nitrite transporter family protein;*
;2718788..2718862;;agg;;437;*437;;;;;;
comp;2719300..2719830;;CDS;;;;;;177;;OmpH family outer membrane protein;*
;;;;;;;;;;;;
comp;2768744..2770933;;CDS;;206;206;;;*730;206;sensor domain-containing phosphodiesterase;*
comp;2771140..2771215;;gcc;+;39;;39;;;;;
comp;2771255..2771330;;gcc;2 gcc;220;220;;;;;;
;2771551..2771910;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;2772355..2773770;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;2774029..2774104;;gta;+;43;;43;;;;;
;2774148..2774223;;gta;3 gta;46;;46;;;;;
;2774270..2774345;;gta;;4;;4;;;;;
;2774350..2774425;;aaa;;110;110;;;;110;;
comp;2774536..2775420;;CDS;;;;;;295;;LysR family transcriptional regulator;*
;;;;;;;;;;;;
comp;2959205..2960503;;CDS;;323;323;;;433;323;alpha-ketoglutarate permease;*
comp;2960827..2960942;;5s;;83;;;;116;;;
comp;2961026..2965477;;23s;;184;;;;4452;;;
comp;2965662..2965737;;gaa;;431;;;;;;;
comp;2966169..2967720;;16s;;441;*441;;;1552;;;
comp;2968162..2970735;;CDS;;;;;;*858;;ATP-dependent chaperone ClpB;*
;;;;;;;;;;;;
comp;3027207..3027773;;CDS;;280;280;;;189;280;fructose-1-phosphate/6-phosphogluconate phosphatase;*
comp;3028054..3028130;;cgt;+;63;;63;;;;;
comp;3028194..3028270;;cgt;5 cgt;62;;62;;;;;
comp;3028333..3028409;;cgt;;62;;62;;;;;
comp;3028472..3028548;;cgt;;64;;64;;;;;
comp;3028613..3028689;;cgt;;3;;3;;;;;
comp;3028693..3028785;;agc;;315;315;;;;;;
comp;3029101..3029286;;CDS;;;;;;62;;carbon storage regulator CsrA;*
;;;;;;;;;;;;
comp;3157337..3158434;;CDS;;208;208;;;366;208;murein transglycosylase A;*
;3158643..3158719;;atgf;+;33;;33;;;;;
;3158753..3158829;;atgf;3 atgf;33;;33;;;;;
;3158863..3158939;;atgf;;635;*635;;;;;;
;3159575..3160075;;CDS;;;;;;167;;type VI secretion system contractile sheath small subunit;*
;;;;;;;;;;;;
;3230172..3231401;;CDS;;316;316;;;410;;HAAAP family serine/threonine permease;*
comp;3231718..3231791;;ggg;;78;78;;;;78;;
comp;3231870..3232625;;CDS;;;;;;252;;peptidoglycan DD-metalloendopeptidase family protein;*
;;;;;;;;;;;;
;3341048..3341755;;CDS;;105;105;;;236;105;DUF554 domain-containing protein;*
;3341861..3341936;;ttc;;197;197;;;;;;
;3342134..3343399;;CDS;;;;;;422;;integrase arm-type DNA-binding domain-containing protein;*
;;;;;;;;;;;;
comp;3569308..3569814;;CDS;;124;124;;;169;;G/U mismatch-specific DNA glycosylase;*
;3569939..3570014;;atgi;;53;53;;;;53;;
comp;3570068..3570832;;CDS;;;;;;255;;NADPH-dependent ferric chelate reductase;*
;;;;;;;;;;;;
comp;3670227..3670679;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3670886..3670962;;atgf;;347;347;;;;;;
>;3671310..3672155;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3673935..3674387;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3674594..3674670;;atgf;;347;347;;;;;;
>;3675018..3675869;;CDS;;;;;;284;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3677794..3678246;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3678453..3678529;;atgf;;347;347;;;;;;
>;3678877..3679722;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3681532..3681984;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3682191..3682267;;atgf;;347;347;;;;;;
;3682615..3683958;;CDS;;;;;;448;;argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3683966..3685591;;CDS;;456;*456;;;542;;phosphoethanolamine transferase;*
comp;3686048..3686134;;ctc;;14;14;;;;14;;
comp;3686149..3686481;;CDS;;;;;;111;;preprotein translocase subunit SecG;*
;;;;;;;;;;;;
;3784553..3785311;;CDS;;62;62;;;253;62;amino acid ABC transporter ATP-binding protein;*
comp;3785374..3785489;;5s;@3;39;;;;116;;;
comp;3785529..3785605;;acc;;14;;;;;;;
comp;3785620..3785735;;5s;;777;;;;116;;;
comp;3786513..3786588;;acc;;14;;;;;;;
comp;3786603..3786718;;5s;;1834;;;;116;;;
comp;3788553..3788628;;gaa;;1360;*1360;;;;;;
;3789989..3790543;;CDS;;;;;;185;;gamma carbonic anhydrase family protein;*
;;;;;;;;;;;;
comp;4078635..4080242;;CDS;;743;*743;;;536;;dipeptide ABC transporter substrate-binding protein DppA;*
comp;4080986..4081062;;ccg;;91;91;;;;91;;
comp;4081154..4082845;;CDS;;;;;;564;;kdo(2)-lipid A phosphoethanolamine 7''-transferase;*
;;;;;;;;;;;;
comp;4205966..4207348;;CDS;;292;292;;;461;292;glycoside-pentoside-hexuronide family transporter;*
;4207641..4207735;;tga;;300;300;;;;;;
>;4208036..4208857;;CDS;;;;;;274;;Pseudo, DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;4338643..4339335;;CDS;;479;*479;;;231;;FadR family transcriptional regulator;*
;4339815..4341342;;16s;;73;;;;1528;;;
;4341416..4341491;;gaa;;184;;;;;;;
;4341676..4344286;;23s;;83;;;;2611;;;
;4344370..4344485;;5s;;53;;;;116;;;
;4344539..4344615;;gac;;8;;;;;;;
;4344624..4344699;;tgg;;95;95;;;;95;;
comp;4344795..4345634;;CDS;;;;;;280;;HTH-type transcriptional regulator HdfR;*
;;;;;;;;;;;;
;4377681..4379066;;CDS;;102;102;;;462;102;amino acid permease;*
;4379169..4379245;;cgg;;58;;58;;;;;
;4379304..4379379;;cac;;20;;20;;;;;
;4379400..4379486;;ctg;;42;;42;;;;;
;4379529..4379605;;cca;;146;146;;;;;;
;4379752..4380987;;CDS;;;;;;412;;anaerobic sulfatase maturase;*
;;;;;;;;;;;;
;4460971..4461516;;CDS;;377;377;;;182;;menaquinone-dependent protoporphyrinogen IX dehydrogenase;*
;4461894..4463631;;16s;;56;;;;1738;;;
;4463688..4463764;;atc;;42;;;42;;;;
;4463807..4463882;;gca;;165;;;;;;;
;4464048..4467338;;23s;;83;;;;3291;;;
;4467422..4467537;;5s;;104;104;;;116;104;;
comp;4467642..4468169;;CDS;;;;;;176;;molybdopterin-guanine dinucleotide biosynthesis protein B;*
;;;;;;;;;;;;
;4605577..4606434;;CDS;;374;374;;;286;;glutamate racemase;*
;4606809..4608362;;16s;;363;;;;1554;;;
;4608726..4608801;;gaa;;1112;;;;;;;
;4609914..4610029;;5s;;136;136;;;116;136;;
;4610166..4611194;;CDS;;;;;;343;;UDP-N-acetylenolpyruvoylglucosamine reductase;*
;;;;;;;;;;;;
comp;4612185..4613135;;CDS;;361;361;;;317;;type I pantothenate kinase;*
;4613497..4613572;;aca;;8;;8;;;;;
;4613581..4613665;;tac;;116;;*116;;;;;
;4613782..4613856;;gga;;6;;6;;;;;
;4613863..4613938;;acc;;114;114;;;;114;;
;4614053..4615237;;CDS;;;;;;395;;elongation factor Tu;*
;;;;;;;;;;;;
comp;4642984..4644573;;CDS;;616;*616;;;530;;bifunctional  phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ;*
;4645190..4646378;;16s’;@1;83;83;;;1189;83;;
;4646462..4648150;;CDS;;436;*436;;;563;;bifunctional isocitrate dehydrogenase kinase/phosphatase;*
;4648587..4648662;;gaa;;185;;;;;;;
;4648848..4651319;;23s;;83;;;;2472;;;
;4651403..4651518;;5s;;76;76;;;116;76;;
;4651595..4651978;;CDS;;;;;;128;;hypothetical protein;*
;;;;;;;;;;;;
< comp;4834504..4834961;;CDS;;197;197;;;153;;pseudo, integrase;*
comp;4835159..4835234;;ttc;;106;106;;;;106;;
comp;4835341..4835916;;CDS;;;;;;192;;transcriptional regulator;*
;;;;;;;;;;;;
;4864628..4865173;;CDS;;210;210;;;182;210;oligoribonuclease;*
;4865384..4865459;;ggc;+;36;;36;;;;;
;4865496..4865571;;ggc;3 ggc;35;;35;;;;;
;4865607..4865682;;ggc;;233;233;;;;;;
;4865916..4865969;;CDS;;;;;;18;;hp;*
;;;;;;;;;;;;
comp;4974178..4975197;;CDS;;195;195;;;340;;NADPH-dependent aldehyde reductase Ahr;*
;4975393..4975477;;ttg;;39;39;;;;39;;
<> comp;4975517..4976055;;CDS;;;;;;180;;pseudo, IS630 family transposase;*
;;;;;;;;;;;;
;5042527..5042763;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5042802..5042888;;ctg;+;34;;34;;;;;
comp;5042923..5043009;;ctg;3 ctg;28;;28;;;;;
comp;5043038..5043124;;ctg;;290;290;;;;;;
comp;5043415..5044446;;CDS;;;;;;344;;16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC;*
;;;;;;;;;;;;
comp;5079375..5079581;;CDS;;117;117;;;69;117;AlpA family transcriptional regulator;*
;5079699..5081218;;16s;;73;;;;1520;;;
;5081292..5081368;;gaa;;12;;;12;;;;
;5081381..5081454;;gca;;366;366;;;;;;
;5081821..5082018;;CDS;;524;*524;;;66;;hypothetical protein;*
comp;5082543..5082754;;CDS;;;;;;71;;hypothetical protein;*
;;;;;;;;;;;;
comp;5090325..5090876;;CDS;;1808;*1808;;;184;;MarR family transcriptional regulator;*
comp;5092685..5092760;;gaa;;588;*588;;;;*588;;
< comp ;5093349..5093474;;CDS;;592;*592;;;42;;sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB;*
;5094067..5094142;;gaa;+;1472;;;*1472;;;;
;5095615..5095691;;atc;3 gaa;42;;;42;;;;
;5095734..5095809;;atc;2 atc;1130;;;*1130;;;;
;5096940..5097015;;gaa;;1145;;;*1145;;;;
;5098161..5098236;;gaa;;185;;;;;;;
;5098422..5100893;;23s;;83;;;;2472;;;
;5100977..5101092;;5s;;76;76;;;116;76;;
;5101169..5101552;;CDS;;63;63;;;128;;hypothetical protein;*
comp;5101616..5102059;;CDS;;;;;;148;;acetyltransferase;*
;;;;;;;;;;;;
;5124754..5125197;;CDS;;63;63;;;148;;acetyltransferase;*
comp;5125261..5125644;;CDS;;76;76;;;128;;hypothetical protein;*
comp;5125721..5125836;;5s;;83;;;;116;;;
comp;5125920..5128366;;23s’;@2;-10;*-10;;;2447;*-10;;
<;5128357..5128479;;CDS;;;;;;41;;pilus assembly protein;*
;;;;;;;;;;;;
comp;5252659..5253870;;CDS;;300;300;;;404;;tyrosine-type recombinase/integrase;*
comp;5254171..5254249;;tga;;292;292;;;;292;;
>;5254542..5255171;;CDS;;;;;;210;;pseudo, glycoside-pentoside-hexuronide family transporter;*
;;;;;;;;;;;;
> comp;5305902..5306228;;CDS;;0;0;;;109;0;pseudo, hp;*
comp;5306229..5306302;;atc;;1096;*1096;;;;;;
;5307399..5308450;;CDS;;;;;;351;;pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada;*
;;;;;;;;;;;;
comp;5321144..5321869;;CDS;;206;206;;;242;206;pseudo, histidine kinase;*
comp;5322076..5322151;;gcc;+;39;;39;;;;;
comp;5322191..5322266;;gcc;3 gcc;39;;39;;;;;
comp;5322306..5322381;;gcc;;220;220;;;;;;
;5322602..5322961;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;5323406..5324821;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;5325080..5325155;;gta;+;44;;44;;;;;
;5325200..5325275;;gta;2 gta;0;0;;;;0;;
<;5325276..5325389;;CDS;;;;;;38;;pseudo, putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
>;5375524..5376270;;CDS;;891;*891;;;249;*891;pseudo, AI-2E family transporter;*
;5377162..5377237;;gaa;;1047;*1047;;;;;;
comp;5378285..5379589;;CDS;;;;;;435;;isocitrate lyase;*
;;;;;;;;;;;;
comp >;5341397..5341492;;CDS;;-2;*-2;;;32;*-2;ABC transporter ATP-binding protein;*
comp;5341491..5344303;;23s;;174;;;;2813;;;
comp;5344478..5344553;;gca;;42;;;42;;;;
comp;5344596..5344672;;atc;;56;;;;;;;
comp;5344729..5346282;;16s;;1063;;;;1554;;;
comp;5347346..5347421;;gca;;42;;;42;;;;
comp;5347464..5347540;;atc;;56;;;;;;;
comp;5347597..5349150;;16s;;365;365;;;1554;;;
comp;5349516..5350088;;CDS;;187;187;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
>;5350276..5350914;;CDS;;;;;;213;;methionine ABC transporter ATP-binding protein MetN;*
;;;;;;;;;;;;
> comp;5359583..5360512;;CDS;;120;120;;;310;;tyrosine-type recombinase/integrase;*
comp;5360633..5360708;;gca;;42;;;;;;;
comp;5360751..5360827;;atc;;56;;;;;;;
comp;5360884..5362138;;16s’;;1;1;;;1255;1;;
< comp;5362140..5363543;;CDS;;;;;;468;;IS66 family transposase;*
;;;;;;;;;;;;
;5425965..5426201;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5426240..5426325;;ctg;+;26;;26;;;;a disparu le 20.12.19;*
comp;5426352..5426438;;ctg;3 ctg;28;;28;;;;;
comp;5426467..5426553;;ctg;;63;63;;;;;;
< comp;5426617..5427150;;CDS;;;;;;178;;pseudo, IS630-like element IS630 family transposase;*
;;;;;;;;;;;;
>;5433568..5433687;;CDS;;39;39;;;40;39;pseudo, nicotinamide-nucleotide amidase;*
comp;5433727..5433814;;tcc;;253;253;;;;;;
comp;5434068..5434286;;CDS;;;;;;73;;translation initiation factor IF-1;*

ecoN cumuls[modifier | modifier le wikicode]

ecoN cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;12;1;0;;1;5;1;5;100;16;1;0
;16 23 5s;0;20;13;2;50;11;40;10;200;34;30;1
;16 atc gca;2;40;17;;100;17;80;7;300;29;60;6
;16 gaa 235;2;60;9;4;150;16;120;16;400;18;90;8
;max a;5;80;4;;200;15;160;3;500;18;120;8
;a doubles;1;100;0;;250;14;200;4;600;8;150;7
;spéciaux;8;120;1;;300;14;240;9;700;0;180;11
;total aas;27;140;0;;350;12;280;2;800;2;210;11
sans ;opérons;50;160;0;;400;7;320;2;900;1;240;6
;1 aa;32;180;0;;450;4;360;3;1000;0;270;9
;max a;7;200;0;;500;4;400;0;1100;0;300;12
;a doubles;15;;0;;;11;;2;;0;;0
;total aas;94;;44;6;;130;;63;;126;;79
total aas;;121;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;33;32;;253;;142;;272;;172
;;;variance;23;15;;258;;145;;162;;79
sans jaune;;;moyenne;31;;;178;;127;;260;;
;;;variance;19;;;109;;91;;142;;

ecoN blocs[modifier | modifier le wikicode]

ecoN blocs;;;;;;;;;;;;
gène;interca;pbs;cdsa;;;gène;interca;pbs;cdsa;;;rRNAs
cds;365;;191;D-glycero;;cds;374;;286;Glu race;;16s
16s;73;1520;;;;16s;363;1554;;;;1189
gaa;12;;;;;gaa;1112;;;;;1255
gca;174;;;;;5s;136;116;;;;1520
23s;83;2588;;;;cds;;;343;UDP-N;;1520
5s;54;116;;;;;;;;;;1528
gac;162;;;;;cds;117;;69;tr AlpA;;1552
cds;;;268;gluDkgB;;16s;73;1520;;;;1554
;;;;;;gaa;12;;;;;1554
cds;323;;433;glutarate pm;;gca;366;;;;;1554
5s;83;116;;;;cds;524;;66;hp-66;;1738
23s;184;4452;;;;cds;;;71;hp-71;;
gaa;431;;;;;;;;;;;
16s;441;1552;;;;cds;-2;;32;ABC 32;;23s
cds;;;858;ClpB dep;;23s;174;2813;;;;2447
;;;;;;gca;42;;;;;2472
cds;616;;530;AICAR2;;atc;56;;;;;2472
16s’;83;1189;;;;16s;1063;1554;;;;2588
cds;436;;563;kinase isocit;;gca;42;;;;;2611
gaa;185;;;;;atc;56;;;;;2813
23s;83;2472;;;;16s;365;1554;;;;3291
5s;76;116;;;;cds;187;;191;D-glycero;;4452
cds;;;128;hp-128;;cds;;;213;ABC MetN;;
;;;;;;;;;;;;5s
cds;62;;253;pu-ABC;;cds;120;;310;Tyr recb 310;;116 x 11
5s;39;116;;;;gca;42;;;;;
acc;14;;;;;atc;56;;;;;
5s;777;116;;;;16s’;1;1255;;;;
acc;14;;;;;cds;;;468;IS66;;
5s;1834;116;;;;;;;;;;
gaa;1360;;;;;cds;63;;148;transferase;;
cds;;;185;gc anhydrase;;cds;76;;128;hp-128;;
;;;;;;5s;83;116;;;;
cds;377;;182;porphyrine M;;23s’;-10;2447;;;;
16s;56;1738;;;;cds;;;41;pilus;;
atc;42;;;;;;;;;;;
gca;165;;;;;cds;1808;;184;MarR ;;
23s;83;3291;;;;gaa;588;;;;;
5s;104;116;;;;cds;592;;42;sn-glycerol;;
cds;;;176;Mlb pB;;gaa;1472;;;;;
;;;;;;atc;42;;;;;
cds;479;;231;FadR tr ;;atc;1130;;;;;
16s;73;1528;;;;gaa;1145;;;;;
gaa;184;;;;;gaa;185;;;;;
23s;83;2611;;;;23s;83;2472;;;;
5s;53;116;;;;5s;76;116;;;;
gac;8;;;;;cds;63;;128;hp-128;;
tgg;95;;;;;cds;;;148;transferase;;
cds;;;280;HdfR HTH;;;;;;;;

ecoN distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;4;3 gtc2;atgi;;tct;;tat;;atgf;;3 gtc2;atgi;;tct;;tat;;atgf;3;3 gtc2;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;;gta2 + 3;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;;2 ctg3;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;;gcc2 + 3;gtt;;gct;;gat;;ggt;
ttc;2;tcc;4;tac;;tgc;;tac2;ttc;;tcc;;tac;1;tgc;1;tac2;ttc;;tcc;;tac;2;tgc;;tac2;ttc;;tcc;;tac;;tgc;
atc;1;acc;1;aac;3;agc;;aaa3;atc;;acc;1;aac;;agc;1;aaa3;atc;2;acc;;aac;;agc;;aaa3;atc;;acc;2;aac;;agc;
ctc;1;ccc;1;cac;;cgt;;atgf3;ctc;;ccc;;cac;1;cgt;;atgf3;ctc;;ccc;;cac;;cgt;5;atgf3;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;1;ggc;;ggc3;gtc;;gcc;;gac;;ggc;1;ggc3;gtc;6;gcc;5;gac;;ggc;3;ggc3;gtc;;gcc;;gac;2;ggc;
tta;;tca;1;taa;;tga;2;atc :;tta;1;tca;;taa;;tga;;atc :;tta;;tca;;taa;;tga;;atc :;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;2;4 16s atc2 aa;ata;;aca;1;aaa;3;aga;;4 16s atc2 aa;ata;;aca;;aaa;3;aga;;4 16s atc2 aa;ata;;aca;;aaa;;aga;
cta;;cca;;caa;;cga;;gaa :;cta;1;cca;1;caa;;cga;;gaa :;cta;;cca;;caa;2;cga;;gaa :;cta;;cca;;caa;;cga;
gta;;gca;;gaa;4;gga;;7 16s 5s 4aa;gta;2;gca;;gaa;;gga;1;7 16s 5s 4aa;gta;5;gca;;gaa;;gga;;7 16s 5s 4aa;gta;;gca;;gaa;1;gga;
ttg;1;tcg;1;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;;acc :;ttg;;tcg;;tag;;tgg;1
atgj;;acg;1;aag;;agg;1;2 5s >aa aa;atgj;2;acg;;aag;;agg;;2 5s >aa aa;atgj;;acg;;aag;;agg;;2 5s >aa aa;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;6;ccg;;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;;gac : 2 5s aa;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
ecoN;;34;;;;;34;;ecoN;20;;;;;;20;;ecoN;44;;;;;;44;;ecoN;;;;6;;;6

ecoN eco[modifier | modifier le wikicode]

ecoN eco tableaux[modifier | modifier le wikicode]
;;;;;;rouge;ff6600;$;jaune;ffff00;#;;;;;;;;;;;
;;eco ecoN;;;;orange;ffcc00;&;cyan;66ffff;°;gris2;dddddd;];;;;;;;;
;;;;;;jaunev;ccff66;@;turquoise;33ff99;%;Jaunev 5;669900;(;;;;;;;;
;19.12.19 Paris;;pour les cds;;;bleu;00ccff;§;gris1;eeeeee;[;;;;;;;;;;;
;Escherichia coli str. K-12 substr. MG1655;;;;;;;;;;;;;;;;;;;;;
;eco;;;;;;;;ecoN;;;;;;;;;;;;;
cluster;sens;;gènes;interca;cdsa;cds;;cluster;sens;;gènes;interca;cdsa;cds;;ecoN suite;sens;;gènes;interca;cdsa;cds
eco1;;222833..223408;cds;362;192;@D-glycero;;ecoN1;;231864..232436;CDS;365;191;@D-glycero;;EcoN 48;comp;5079375..5079581;CDS;117;69;tr AlpA
;;223771..225312;$16s;68;&1542;;;;;232802..234321;$16s;73;&1520;;;ok;;5079699..5081218;$16s;73;&1520;
;;225381..225457;atc;42;;;;;;234395..234471;gaa;12;;;;;;5081292..5081368;gaa;12;;
;;225500..225575;gca;183;;;;;;234484..234557;gca;174;;;;;;5081381..5081454;gca;366;;
;;225759..228662;$23s;93;&2904;;;;;234732..237319;$23s;83;&2588;;;;;5081821..5082018;CDS;524;66;hp-66
;;228756..228875;$5s;52;&120;;;;;237403..237518;$5s;54;&116;;;;comp;5082543..5082754;CDS;;71;hp-71
;;228928..229004;gac;162;;;;;;237573..237649;gac;162;;;;;;;;;;
;;229167..229970;cds;;268;@metDkgB;;;;237812..238615;CDS;;268;@gluDkgB;;eco1;;222833..223408;cds;[362;192;]D-glycero
;;;;;;;;;;;;;;;;;;223771..225312;$16s;[68;&1542;
eco2;;236067..236798;cds;132;244;@DNAIIIe;;ecoN2;;244934..245665;CDS;132;244;@DNAIIIe;;;;225381..225457;atc;[42;;
;;236931..237007;gac;327;;;;;;245798..245874;gac;120;;;;;;225500..225575;gca;[183;;
;;237335..238120;cds;;262;§lipo YafT;;;comp;245995..246852;CDS;;286;§DUF4942;;;;225759..228662;$23s;93;&2904;
;;;;;;;;;;;;;;;;;;228756..228875;$5s;52;&120;
eco3;;261503..262756;cds;114;418;@glu5dH;;ecoN3;;367329..368582;CDS;114;418;@glu5dH;;;;228928..229004;gac;162;;
;;262871..262946;acg;203;;;;;;368697..368772;acg;154;;;;;;229167..229970;cds;;268;@metDkgB
;comp;263150..263212;cds;;21;§YdiA;;;;368927..369265;CDS;;113;§DUF4102;;EcoN 56;comp >;5341397..5341492;CDS;-2;32;]ABC 32
;;262898..297205;#phage;;11436;pp CP4-6;;;;;;;;;;ok;comp;5341491..5344303;$23s;]174;&2813;
;;;;;;;;;;;;;;;;;comp;5344478..5344553;gca;]42;;
eco4;comp;563848..564480;cds;242;211;§put FimZ;;ecoN4;comp;631149..632015;CDS;270;289;§cyclo FolD;;;comp;5344596..5344672;atc;]56;;
;;564723..564799;aga;15;;;;;;632286..632362;aga;15;;;;;comp;5344729..5346282;$16s;]1063;&1554;
;comp;564815..565978;cds;;388;§put DLP12;;;comp;632378..632997;CDS;;207;§Tyr recb 207;;;comp;5347346..5347421;gca;[42;;
;;564755..586056;#phage;;7101;pp DLP12;;;;;;;;;;;comp;5347464..5347540;atc;[56;;
;;;;;;;;;;;;;;;;;comp;5347597..5349150;$16s;[365;&1554;
eco5;;695101..696276;cds;31;392;@octaprenyl;;ecoN5;;733188..734363;CDS;153;392;@octaprenyl;;;comp;5349516..5350088;CDS;[187;191;]D-glycero
;comp;696308..696378;rpr;51;&71;rpt71;;;comp;734517..734591;°cag;37;;;;;>;5350276..5350914;CDS;;213;ABC MetN
;comp;696430..696504;°cag;37;;;;;comp;734629..734703;°cag;48;;;;eco35;eco;3422436..3423194;cds;228;253;pu-YhdZ
;comp;696542..696616;°cag;47;;;;;comp;734752..734828;atgj;15;;;;;comp;3423423..3423542;$5s;]37;&120;
;comp;696664..696740;atg;15;;;;;comp;734844..734918;°caa;34;;;;;comp;3423580..3423655;acc;]12;;
;comp;696756..696830;°caa;34;;;;;comp;734953..735027;°caa;23;;;;;comp;3423668..3423787;$5s;]92;&120;
;comp;696865..696939;°caa;23;;;;;comp;735051..735135;cta;10;;;;;comp;3423880..3426783;$23s;]174;&2904;
;comp;696963..697047;cta;9;;;;;comp;735146..735222;°atgj;380;;;;;comp;3426958..3427033;gca;]42;;
;comp;697057..697133;°atg;379;;;;;comp;735603..737267;CDS;;555;@Asn B;;;comp;3427076..3427152;atc;]68;;
;comp;697513..699177;cds;;555;@Asn B;;;;;;;;;;;comp;3427221..3428762;$16s;]473;&1542;
;;;;;;;;;;;;;;;;;;3429236..3429790;cds;;185;%protein YrdA
eco6;;779598..780389;cds;164;264;@ cell CpoB;;ecoN6;;807377..808169;CDS;164;264;@ p-cell CpoB;;ecoN35;;3784553..3785311;CDS;62;253;]pu-ABC
;;780554..780629;°aaa;135;;;;;;808334..808409;°aaa;35;;;;;comp;3785374..3785489;$5s;]39;&116;
;;780765..780840;gta;2;;;;;;808445..808520;gta;2;;;;;comp;3785529..3785605;acc;]14;;
;;780843..780918;°aaa;149;;;;;;808523..808598;°aaa;51;;;;;comp;3785620..3785735;$5s;]777;&116;
;;781068..781143;gta;3;;;;;;808650..808725;gta;3;;;;;comp;3786513..3786588;acc;]14;;
;;781147..781222;°aaa;146;;;;;;808729..808804;°aaa;48;;;;;comp;3786603..3786718;$5s;]1834;&116;
;;781369..781444;°aaa;132;;;;;;808853..808928;°aaa;33;;;;;comp;3788553..3788628;gaa;1360;;
;;781577..781652;°aaa;432;;;;;;808962..809037;°aaa;277;;;;;;3789989..3790543;CDS;;185;%gc anhydrase
;;782085..783128;cds;;348;@quino;;;;809315..810358;CDS;;348;@quino NadA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco7;;923264..925540;cds;343;759;@ATP ClpA;;ecoN7;;950069..952345;CDS;343;759;@ATP ClpA;;EcoN 59;>;5433568..5433687;CDS;39;40;§p-Nam
;comp;925884..925971;tcc;253;;;;;comp;952689..952776;tcc;253;;;;ok;comp;5433727..5433814;tcc;253;;
;comp;926225..926443;cds;;73;@tif IF-1;;;comp;953030..953248;CDS;;73;@tif IF-1;;;comp;5434068..5434286;CDS;;73;@tif IF-1
;;;;;;;;;;;;;;;;;;;;;;
eco8;comp;1030759..1031418;cds;206;220;@FtsH;;ecoN8;comp;1047224..1047883;CDS;206;220;@FtsH YccA;;;;;;;;
;comp;1031625..1031712;tca;426;;;;;comp;1048090..1048177;tca;426;;;;;;;;;;
;;1032139..1033257;cds;;373;@Hnase1;;;;1048604..1049722;CDS;;373;@Hnase1;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco9;;;;;;;;ecoN9;;1183656..1184018;CDS;463;121;hp-121;;;;;;;;
;;;*****aga*****;;;;;;;1184482..1184558;aga;278;;;;;;;;;;
;;;;;;;;;> comp;1184837..1185786;CDS;;317;p-IS4;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco10;;1095843..1096829;cds;735;329;§un-YcdU;;ecoN10;;1213982..1214809;CDS;165;276;§DUF4942;;;;;;;;
;comp;1097565..1097652;tcc;233;;;;;comp;1214975..1215062;tcc;233;;;;;;;;;;
;;1097886..1098824;cds;;313;@glyoxylate A;;;;1215296..1216234;CDS;;313;@glyoxyl GhrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco11;;;;;;;;ecoN11;;1216817..1217098;CDS;165;94;§DUF4942;;;;;;;;
;;;*****tcc*****;;;;;;comp;1217264..1217351;tcc;234;;;;;;;;;;
;;;;;;;;;;1217586..1218524;CDS;;313;@glyoxyl GhrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco12;;1286709..1286984;cds;81;92;§p-un-YchS;;ecoN12;;1457038..1458129;CDS;16;364;§acyl-CoA ;;;;;;;;
;comp;1287066..1287236;ncRNA;-150;&171;§RttR sRNA;;;comp;1458146..1458277;ncRNA;46;44;§RtT sRNA;;;;;;;;
;comp;1287087..1287176;cds;67;30;§tpr;;;comp;1458324..1458408;°tac;33;;;;;;;;;;
;comp;1287244..1287328;°tac;209;;;;;comp;1458442..1458526;°tac;159;;;;;;;;;;
;comp;1287538..1287622;°tac;159;;;;;comp;1458686..1459528;CDS;;281;@fTHF;;;;;;;;
;comp;1287782..1288624;cds;;281;@fTHF;;;;;;;;;;;;;;;;
;;;;;;;;ecoN13;comp;1829066..1830322;CDS;307;419;%hp-419;;;;;;;;
eco13;;;;;;;;;;1830630..1830706;°gtc;4;;;;;;;;;;
;;*****;°gtc;*****;;;;;;1830711..1830787;°gtc;6;;;;;;;;;;
;;;°gtc;;;;;;<;1830794..1831177;CDS;;128;§p-MdtK;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;ecoN14;comp;1831218..1832474;CDS;307;419;%hp-419;;;;;;;;
eco14;;*****;°gtc;*****;;;;;;1832782..1832858;°gtc;4;;;;;;;;;;
;;;°gtc;;;;;;;1832863..1832939;°gtc;8;;;;;;;;;;
;;;;;;;;;<;1832948..1833280;CDS;;111;§p-MATE;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco15;comp;1744871..1746127;cds;307;419;%adhes YdhQ;;ecoN15;comp;1833321..1834577;CDS;307;419;%hp-419;;;;;;;;
;; 1746435..1746511;°gtc;4;;;;;;1834885..1834961;°gtc;4;;;;;;;;;;
;; 1746516..1746592;°gtc;107;;;;;;1834966..1835042;°gtc;108;;;;;;;;;;
;;1746700..1747005;cds;;102;@pu-YdhR;;;;1835151..1835456;CDS;;102;@mono-O2;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco16;comp;1990954..1991619;cds;195;222;@UPF0149 YecA;;ecoN16;comp;2115794..2116459;CDS;195;222;@UPF0149 YecA;;;;;;;;
;comp;1991815..1991901;tta;12;;;;;comp;2116655..2116741;tta;12;;;;;;;;;;
;comp;1991914..1991987;tgc;54;;;;;comp;2116754..2116827;tgc;53;;;;;;;;;;
;comp;1992042..1992117;ggc;151;;;;;comp;2116881..2116956;ggc;151;;;;;;;;;;
;comp;1992269..1992817;cds;;183;@glycerolP;;;comp;2117108..2117656;CDS;;183;@CDP-diacyl;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco17;;2042368..2042898;cds;569;177;§pu-cytochrom;;ecoN17;comp;2191451..2192287;CDS;278;279;§hp-279;;;;;;;;
;comp;2043468..2043557;tcg;93;;;;;comp;2192566..2192655;tcg;93;;;;;;;;;;
;;2043651..2044448;cds;100;266;%Mtf;;;;2192749..2193546;CDS;100;266;%MtfA;;;;;;;;
;;2044549..2044624;aac;313;;;;;;2193647..2193722;aac;161;;;;;;;;;;
;;2044938..2052014;cds;;2359;§Inv-adhesin;;;;2193884..2195146;CDS;;421;§Tyr recb-421;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco18;;2056858..2057574;cds;452;239;@pu-tr-YeeN;;ecoN18;;2232607..2233323;CDS;453;239;@tr-YebC;;;;;;;;
;comp;2058027..2058102;aac;[100;;;;;comp;2233777..2233852;acc;[326;;;;;;;;;;
;comp;2058203..2059846;cds;[4;548;@exporter;;;;2234179..2235096;CDS;[101;306;@tr-nitrogen;;;;;;;;
;; 2059851..2059926;aac;[37;;;;;;2235198..2236148;CDS;[37;317;@tr-Cbl;;;;;;;;
;comp;2059964..2060914;cds;[101;317;tact Cbl;;;comp;2236186..2236261;aac;[4;;;;;;;;;;
;comp;2061016..2061933;cds;[326;306;tr-Nac;;;;2236266..2237909;CDS;[100;548;trp-YeeO;;;;;;;;
;;2062260..2062335;aac;55;;;;;;2238010..2238085;aac;161;;;;;;;;;;
;comp;2062391..2063323;cds;;311;§ErfK;;;;2238247..2239518;CDS;;424;§Tyr recb 424;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco19;;2284376..2286136;cds;74;587;@pu-cardiolip;;ecoN19;;2546968..2548728;CDS;74;587;@cardiolipine;;;;;;;;
;;2286211..2286287;ccc;102;;;;;;2548803..2548879;ccc;101;;;;;;;;;;
;comp;2286390..2288914;cds;;842;§adhes YejO;;;comp;2548981..2549136;CDS;;52;§barrel;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco20;;2465301..2466233;cds;75;311;%YfdC;;ecoN20;;2717780..2718712;CDS;75;311;%nitrite;;;;;;;;
;;2466309..2466383;agg;161;;;;;;2718788..2718862;agg;437;;;;;;;;;;
;;2466545..2467702;cds;;386;§KpLE1;;;comp;2719300..2719830;CDS;;177;§OmpH;;;ecoN;;;;;
;;2466369..2476583;#phage;;3405;pp CPS-53;;;;;;;;;;EcoN 53;comp;5321144..5321869;CDS;206;242;§p-His kinase
;;;;;;;;ecoN21;comp;2768744..2770933;CDS;206;730;@sensor;;ok;comp;5322076..5322151;°gcc;39;;
eco21;comp;2515643..2517832;cds;208;730;@pu-sensor;;;comp;2771140..2771215;°gcc;39;;;;;comp;5322191..5322266;°gcc;39;;
;comp;2518041..2518116;°gcc;39;;;;;comp;2771255..2771330;°gcc;220;;;;;comp;5322306..5322381;°gcc;220;;
;comp;2518156..2518231;°gcc;235;;;;;;2771551..2771910;CDS;;120;%pu-tr 120;;;;5322602..5322961;CDS;;120;%pu-tr 120
;;2518467..2518811;cds;;115;%pu- YfeC;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco22;comp;2519257..2520672;cds;258;472;@Glu ligase;;ecoN22;comp;2772355..2773770;CDS;258;472;@Glu ligase;;;ecoN;;;;;
;;2520931..2521006;°gta;44;;;;;;2774029..2774104;°gta;43;;;;EcoN 54;comp;5323406..5324821;CDS;258;472;@Glu ligase
;;2521051..2521126;°gta;46;;;;;;2774148..2774223;°gta;46;;;;ok;;5325080..5325155;°gta;44;;
;;2521173..2521248;°gta;4;;;;;;2774270..2774345;°gta;4;;;;;;5325200..5325275;°gta;0;;
;;2521253..2521328;aaa;210;;;;;;2774350..2774425;aaa;110;;;;;<;5325276..5325389;CDS;;38;§p-pu-tr 38
;;2521539..2521567;rpr;25;&29;rpt-29;;;comp;2774536..2775420;CDS;;295;@LysR;;;;;;;;
;comp;2521593..2522477;cds;;295; @XapR;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco23;comp;2724448..2725746;cds;322;433;@glutarate sm;;ecoN23;comp;2959205..2960503;CDS;323;433;@glutarate pm;;;;;;;;
;comp;2726069..2726188;$5s;92;&120;;;;comp;2960827..2960942;$5s;83;&116;;;;;;;;;
;comp;2726281..2729184;$23s;184;&2904;;;;comp;2961026..2965477;$23s;184;&4452;;;;;;;;;
;comp;2729369..2729444;gaa;171;;;;;comp;2965662..2965737;gaa;431;;;;;;;;;;
;comp;2729616..2731157;$16s;442;&1542;;;;comp;2966169..2967720;$16s;441;&1552;;;;;;;;;
;comp;2731600..2734173;cds;;858;@ClpB;;;comp;2968162..2970735;CDS;;858;@ClpB dep;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco24;comp;2784529..2785011;cds;750;161;DUF5507;;ecoN24;;;;;;;;;;;;;;
;comp;2785762..2785837;atgi;559;;;;;;;****atgi*****;;;;;;;;;;;
;;2786397..2788649;cds;;751;pu-unYgaQ;;ecoN25;;;;;;;;;;;;;;
;;;;;;;;;comp;3027207..3027773;CDS;280;189;@fructose 6;;;;;;;;
eco25;comp;2816937..2817503;cds;280;189;@fructose;;;comp;3028054..3028130;°cgt;63;;;;;;;;;;
;comp;2817784..2817860;°cgt;198;;;;;comp;3028194..3028270;°cgt;62;;;;;;;;;;
;comp;2818059..2818135;°cgt;62;;;;;comp;3028333..3028409;°cgt;62;;;;;;;;;;
;comp;2818198..2818274;°cgt;198;;;;;comp;3028472..3028548;°cgt;64;;;;;;;;;;
;comp;2818473..2818549;°cgt;3;;;;;comp;3028613..3028689;°cgt;3;;;;;;;;;;
;comp;2818553..2818645;agc;315;;;;;comp;3028693..3028785;agc;315;;;;;;;;;;
;comp;2818961..2819146;cds;;62;@Csr;;;comp;3029101..3029286;CDS;;62;@CsrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco26;comp;2946081..2947178;cds;208;366;@murein lytic;;ecoN26;comp;3157337..3158434;CDS;208;366;@murein;;;;;;;;
;;2947387..2947463;°atgf;33;;;;;;3158643..3158719;°atgf;33;;;;;;;;;;
;;2947497..2947573;°atgf;33;;;;;;3158753..3158829;°atgf;33;;;;;;;;;;
;;2947607..2947683;°atgf;73;;;;;;3158863..3158939;°atgf;635;;;;;;;;;;
;comp;2947757..2949010;cds;;418;§Ala C;;;;3159575..3160075;CDS;;167;§sscs VI;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco27;comp;2998034..2998828;cds;155;265;§YgeQ;;ecoN27;;3230172..3231401;CDS;316;410;§HAAAP;;;;;;;;
;comp;2998984..2999057;ggg;78;;;;;comp;3231718..3231791;ggg;78;;;;;;;;;;
;comp;2999136..2999891;cds;;252;%pu-LysM;;;comp;3231870..3232625;CDS;;252;%glycan DD;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco28;;3109553..3110260;cds;105;236;@DUF554 ;;ecoN28;;3341048..3341755;CDS;105;236;@DUF554 ;;;;;;;;
;;3110366..3110441;ttc;148;;;;;;3341861..3341936;ttc;197;;;;;;;;;;
;comp;3110590..3111126;cds;;179;§pu-ssM;;;;3342134..3343399;CDS;;422;§arm-type;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco29;comp;3214967..3215473;cds;124;169;%G/U station;;ecoN29;comp;3569308..3569814;CDS;124;169;%G/U;;;;;;;;
;;3215598..3215673;atgi;53;;;;;;3569939..3570014;atgi;53;;;;;;;;;;
;comp;3215727..3216491;cds;;255;@ferric ;;;comp;3570068..3570832;CDS;;255;@ferric ;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco30;;;;;;;;ecoN30;comp;3670227..3670679;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3670886..3670962;atgf;347;;;;;;;;;;
;;;;;;;;;>;3671310..3672155;CDS;;282;§p-Arg-sc 282;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco31;;;;;;;;ecoN31;comp;3673935..3674387;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3674594..3674670;atgf;347;;;;;;;;;;
;;;;;;;;;>;3675018..3675869;CDS;;284;§p-Arg-sc 284;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco32;;;;;;;;ecoN32;comp;3677794..3678246;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3678453..3678529;atgf;347;;;;;;;;;;
;;;;;;;;;>;3678877..3679722;CDS;;282;§p-Arg-sc 282;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco33;comp;3317554..3318006;cds;206;151;@RimP;;ecoN33;comp;3681532..3681984;CDS;206;151;@RimP;;;;;;;;
;comp;3318213..3318289;atgf;347;;;;;comp;3682191..3682267;atgf;347;;;;;;;;;;
;;3318637..3319980;cds;;448;@Arg-suc;;;;3682615..3683958;CDS;;448;@Arg-suc;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco34;comp;3319988..3321613;cds;458;542;%pu-hydrolase;;ecoN34;comp;3683966..3685591;CDS;456;542;%Pet;;;;;;;;
;comp;3322072..3322158;ctc;14;;;;;comp;3686048..3686134;ctc;14;;;;;;;;;;
;comp;322173..3322505;cds;;111;@SecG-t;;;comp;3686149..3686481;CDS;;111;@SecG-p;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco35;;3422436..3423194;cds;228;253;@pu-YhdZ;;ecoN35;;3784553..3785311;CDS;62;253;@pu-ABC;;;;;;;;
;comp;3423423..3423542;$5s;37;&120;;;;comp;3785374..3785489;$5s;39;&116;;;;;;;;;
;comp;3423580..3423655;acc;12;;;;;comp;3785529..3785605;acc;14;;;;;;;;;;
;comp;3423668..3423787;$5s;92;&120;;;;comp;3785620..3785735;$5s;777;&116;;;;;;;;;
;comp;3423880..3426783;$23s;174;&2904;;;;comp;3786513..3786588;acc;14;;;;;;;;;;
;comp;3426958..3427033;gca;42;;;;;comp;3786603..3786718;$5s;1834;&116;;;;;;;;;
;comp;3427076..3427152;atc;68;;;;;comp;3788553..3788628;gaa;1360;;;;;;;;;;
;comp;3427221..3428762;$16s;473;&1542;;;;;3789989..3790543;CDS;;185;%gc anhydrase;;;;;;;;
;;3429236..3429790;cds;;185;%protein YrdA;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco36;comp;3706098..3707705;cds;567;536;@dip ABC;;;;;;;;;;;;;;;;
;comp;3708273..3708306;rpr;16;&34;rpt-34;;;;;;;;;;;;;;;;
;;3708323..3708358;rpr;257;&36;rpt-36;;ecoN36;comp;4078635..4080242;CDS;743;536;@DppA;;;;;;;;
;comp;3708616..3708692;ccg;91;;;;;comp;4080986..4081062;ccg;91;;;;;;;;;;
;comp;3708784..3710475;cds;;564;@kdo2;;;comp;4081154..4082845;CDS;;564;@kdo2;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco37;comp;3834547..3835929;cds;292;461;%pu-YicJ;;;;;;;;;;;;;;;;
;;3836222..3836316;tga;108;;;;ecoN37;comp;4205966..4207348;CDS;[292;461;%glycoside-p5;;EcoN 51;comp;5252659..5253870;CDS;[300;404;(Tyr recb 404
;;3836425..3836556;pseudo;396;&132;p-yicT;;;;4207641..4207735;tga;[300;;;;ok;comp;5254171..5254249;tga;[292;;
;;3836953..3838137;cds;;395;§pu-arabi;;;>;4208036..4208857;CDS;;274;§p-DUF4102;;;>;5254542..5255171;CDS;;210;p-glycoside
;;;;;;;;;;;;;;;;;;;;;;
eco38;comp;3940635..3941327;cds;480;231;%pu-tr YieP;;ecoN38;comp;4338643..4339335;CDS;479;231;%FadR tr ;;;;;;;;
;;3941808..3943349;$16s;85;&1542;;;;;4339815..4341342;$16s;73;&1528;;;;;;;;;
;;3943435..3943510;gaa;193;;;;;;4341416..4341491;gaa;184;;;;;;;;;;
;;3943704..3946607;$23s;92;&2904;;;;;4341676..4344286;$23s;83;&2611;;;;;;;;;
;;3946700..3946819;$5s;52;&120;;;;;4344370..4344485;$5s;53;&116;;;;;;;;;
;;3946872..3946948;gac;8;;;;;;4344539..4344615;gac;8;;;;;;;;;;
;;3946957..3947032;tgg;95;;;;;;4344624..4344699;tgg;95;;;;;;;;;;
;comp;3947128..3947967;cds;;280;@HdfR;;;comp;4344795..4345634;CDS;;280;@HdfR HTH;;;;;;;;
;;;;;;;;;;;;;;;;EcoN 52;> comp;5305902..5306228;CDS;0;109;p-hp
eco39;;3980887..3982272;cds;102;462;%pu-YifK;;ecoN39;;4377681..4379066;CDS;102;462;%aa permease;;;comp;5306229..5306302;atc;1096;;
;;3982375..3982451;cgg;57;;;;;;4379169..4379245;cgg;58;;;;ecoN ?;;5307399..5308450;CDS;;351;(p-Ada
;;3982509..3982585;cac;20;;;;;;4379304..4379379;cac;20;;;;;;;;;;
;;3982606..3982692;ctg;42;;;;;;4379400..4379486;ctg;42;;;;EcoN 57;> comp;5359583..5360512;CDS;120;310;(Tyr recb 310
;;3982735..3982811;cca;146;;;;;;4379529..4379605;cca;146;;;;;comp;5360633..5360708;gca;[42;;
;;3982958..3984193;cds;;412;%pu-AslB;;;;4379752..4380987;CDS;;412;%ans maturase;;ecoN40;comp;5360751..5360827;atc;[56;;
;;;;;;;;;;;;;;;;;comp;5360884..5362138;°16s’;1;&1255;
eco40;;4034608..4035153;cds;377;182;@porphyrine O;;ecoN40;;4460971..4461516;CDS;377;182;@porphyrine M;;;< comp;5362140..5363543;CDS;;468;(IS66
;;4035531..4037072;$16s;68;&1542;;;;;4461894..4463631;$16s;[56;&1738;;;;;;;;;
;;4037141..4037217;atc;42;;;;;;4463688..4463764;atc;[42;;;;EcoN 55;>;5375524..5376270;CDS;891;249;(p-AI-2E
;;4037260..4037335;gca;183;;;;;;4463807..4463882;gca;165;;;;;;5377162..5377237;gaa;1047;;eco 435
;;4037519..4040423;$23s;93;&2905;;;;;4464048..4467338;$23s;83;&3291;;;ecoN ?;comp;5378285..5379589;CDS;;435;isocitrate
;;4040517..4040636;$5s;228;&120;;;;;4467422..4467537;$5s;104;&116;;;;;;;;;
;;4040865..4040900;rpr;5;&36;rpt-36;;;comp;4467642..4468169;CDS;;176;@Mlb pB;;EcoN 49;comp;5090325..5090876;CDS;1808;184;(MarR
;comp;4040906..4041433;cds;;176;@Mlb adapt;;;;;;;;;;;comp;5092685..5092760;gaa;588;;
;;;;;;;;;;;;;;;;ecoN ?;< comp ;5093349..5093474;CDS;592;42;(sn-glycerol
eco41;;4165428..4166285;cds;373;286;@Glu race;;ecoN41;;4605577..4606434;CDS;374;286;@Glu race;;;;5094067..5094142;°gaa;1472;;
;;4166659..4168200;$16s;171;&1542;;;;;4606809..4608362;$16s;363;&1554;;;;;5095615..5095691;atc;42;;
;;4168372..4168447;gaa;193;;;;;;4608726..4608801;gaa;1112;;;;;;5095734..5095809;atc;1130;;
;;4168641..4171544;$23s;92;&2904;;;;;4609914..4610029;$5s;136;&116;;;;;5096940..5097015;°gaa;1145;;
;;4171637..4171756;$5s;300;&120;;;;;4610166..4611194;CDS;;343;@UDP-N;;ok ecoN43;;5098161..5098236;°gaa;]185;;
;;4172057..4173085;cds;;343;@UDP-N;;;;;;;;;;;;5098422..5100893;$23s;]83;&2472;
;;;;;;;;ecoN42;comp;4612185..4613135;CDS;361;317;@B5 kinase I;;;;5100977..5101092;$5s;]76;&116;
eco42;comp;4174076..4175026;cds;361;317;@B5 kinase;;;;4613497..4613572;aca;8;;;;;;5101169..5101552;CDS;63;128;hp-128
;;4175388..4175463;aca;8;;;;;;4613581..4613665;tac;116;;;;;comp;5101616..5102059;CDS;;148;transferase
;;4175472..4175556;tac;116;;;;;;4613782..4613856;gga;6;;;;;;;;;;
;;4175673..4175747;gga;6;;;;;;4613863..4613938;acc;114;;;;EcoN 50;;5124754..5125197;CDS;63;148;transferase
;;4175754..4175829;acc;114;;;;;;4614053..4615237;CDS;;395;@tuf;;;comp;5125261..5125644;CDS;76;128;hp-128
;;4175944..4177128;cds;229;395;@tufb;;;;;;;;;;ecoN40;comp;5125721..5125836;$5s;83;&116;
;;4177358..4177741;cds;;128;SecE;;ecoN43;comp;4642984..4644573;CDS;616;530;@AICAR2;;;comp;5125920..5128366;°23s’;-10;&2447;
;;;;;;;;;;4645190..4646378;°16s’;83;&1189;;;;<;5128357..5128479;CDS;;41;(pilus
eco43;comp;4205943..4207532;cds;614;530;@AICAR1;;;;4646462..4648150;CDS;436;563;§kinase isocit;;;;;;;;
;;4208147..4209688;$16s;85;&1542;;;;;4648587..4648662;gaa;]185;;;;;;;;;;
;;4209774..4209849;gaa;193;;;;;;4648848..4651319;$23s;]83;&2472;;;;;;;;;
;;4210043..4212946;$23s;93;&2904;;;;;4651403..4651518;$5s;]76;&116;;;;;;;;;
;;4213040..4213159;$5s;74;&120;;;;;4651595..4651978;CDS;;128;%hp-128;;;;;;;;
;;4213234..4213617;cds;;128;%stress;;;;;;;;;;;;;;;;
;;;;;;;;ecoN44;;;;;;;;;;;;;;
eco44;comp;4360396..4361934;cds;256;513;§CadC;;;< comp;4834504..4834961;CDS;197;153;§pu-integrase;;;;;;;;
;comp;4362191..4362353;pseudo;197;&163;yjdQ;;;comp;4835159..4835234;ttc;106;;;;;;;;;;
;comp;4362551..4362626;ttc;106;;;;;comp;4835341..4835916;CDS;;192;@tr 192;;;;;;;;
;comp;4362733..4363308;cds;;192;@pu-tr YjdC;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco45;;4391604..4392149;cds;210;182;@oligo-rnase;;ecoN45;;4864628..4865173;CDS;210;182;@oligo-rnase;;;;;;;;
;;4392360..4392435;°ggc;36;;;;;;4865384..4865459;°ggc;36;;;;;;;;;;
;;4392472..4392547;°ggc;35;;;;;;4865496..4865571;°ggc;35;;;;;;;;;;
;;4392583..4392658;°ggc;233;;;;;;4865607..4865682;°ggc;233;;;;;;;;;;
;;4392892..4392945;cds;;18;@un-YjeV;;;;4865916..4865969;CDS;;18;@hp-18;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco46;comp;4495190..4496209;cds;195;340;@NADPH- Ah;;ecoN46;comp;4974178..4975197;CDS;195;340;@NADPH- Ahr;;;;;;;;
;;4496405..4496489;ttg;260;;;;;;4975393..4975477;ttg;39;;;;;;;;;;
;;4496750..4497940;cds;;397;§pu-KpLE2;;;<> comp;4975517..4976055;CDS;;180;§p-IS630 ;;;;;;;;
;;4496675..4497940;#phage;;422;pp PR-Y;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco47;;4605804..4606040;cds;38;79;%protein YjjZ;;;;;;;;;;;;;;;;
;comp;4606079..4606165;°ctg;34;;;;;;;;;;;;;;;;;;
;comp;4606200..4606286;°ctg;28;;;;ecoN47;;5042527..5042763;CDS;38;79;%DUF1435;;EcoN 58;;5425965..5426201;CDS;38;79;%DUF1435
;comp;4606315..4606401;°ctg;157;;;;;comp;5042802..5042888;°ctg;34;;;;ok;comp;5426240..5426325;°ctg;26;;
;;4606559..4606594;rpr;22;&36;rpt 36;;;comp;5042923..5043009;°ctg;28;;;;;comp;5426352..5426438;°ctg;28;;
;comp;4606617..4606650;rpr;18;&34;rpt 34;;;comp;5043038..5043124;°ctg;290;;;;;comp;5426467..5426553;°ctg;63;;
;comp;4606669..4607700;cds;;344;@G1207;;;comp;5043415..5044446;CDS;;344;@G1207 RsmC;;;< comp;5426617..5427150;CDS;;178;p-IS630
ecoN eco noms cds[modifier | modifier le wikicode]
fonction;Noms courts;Noms longs;;;;;
tr-regulator; XapR;DNA-binding transcriptional activator XapR;;;;;*
permease;aa permease;amino acid permease;;;;;*
ABC bind;ABC 32;ABC transporter ATP-binding protein;;;;;*
ABC bind;ABC MetN;methionine ABC transporter ATP-binding protein MetN;;;;;*
desaturase;acyl-CoA ;acyl-CoA desaturase;;;;;*
adhesin;adhes YdhQ;adhesin-like autotransporter YdhQ;;;;;*
adhesin;adhes YejO;adhesin-like autotransporter YejO, gene fragment 2 of yejO,  misc_feature ;;;;;*
hydrolase ;AICAR1;bifunctional AICAR transformylase/IMP cyclohydrolase;;;;;*
hydrolase ;AICAR2;bifunctional  phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ;;;;;*
amidase;Ala C;N-acetylmuramoyl-L-alanine amidase C;;;;;*
maturase;ans maturase;anaerobic sulfatase maturase;;;;;*
synthetase;Arg-suc;argininosuccinate synthetase;;;;;*
integrase;arm-type;integrase arm-type DNA-binding domain-containing protein;;;;;*
synthetase;Asn B;asparagine synthetase B;;;;;*
protease b;ATP ClpA;ATP-dependent Clp protease ATP-binding subunit ClpA;;;;;*
kinase;B5 kinase;pantothenate kinase;;;;;*
kinase;B5 kinase I;type I pantothenate kinase;;;;;*
transporter;barrel;autotransporter outer membrane beta-barrel domain-containing protein;;;;;*
tr-regulator;CadC;DNA-binding transcriptional activator CadC;;;;;*
cardiolipin ;cardiolipine;cardiolipin transport protein PbgA;;;;;*
transferase;CDP-diacyl;CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase;;;;;*
division;cell CpoB;cell division coordinator CpoB;;;;;*
chaperone;ClpB;ClpB chaperone;;;;;*
chaperone;ClpB dep;ATP-dependent chaperone ClpB;;;;;*
storage;Csr;carbon storage regulator;;;;;*
storage;CsrA;carbon storage regulator CsrA;;;;;*
hydrolase ;cyclo FolD;bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD;;;;;*
phosphatase;D-glycero;D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase;;;;;*
ABC bind;dip ABC;dipeptide ABC transporter periplasmic binding protein;;;;;*
polymerase;DNAIIIe;DNA polymerase III subunit epsilon;;;;;*
ABC bind;DppA;dipeptide ABC transporter substrate-binding protein DppA;;;;;*
DUF;DUF1435;DUF1435 domain-containing protein;;;;;*
DUF;DUF4102;DUF4102 domain-containing protein;;;;;*
DUF;DUF4942;DUF4942 domain-containing protein;;;;;*
DUF;DUF5507;DUF5507 domain-containing protein YpjC;;;;;*
DUF;DUF554 ;DUF554 domain-containing protein;;;;;*
DUF;DUF554 Yqg;DUF554 domain-containing protein YqgA;;;;;*
peptidase;ErfK;L,D-transpeptidase ErfK;;;;;*
exporter;exporter;FMN/FAD exporter;;;;;*
tr-regulator;FadR tr ;FadR family transcriptional regulator;;;;;*
reductase;ferric ;NADPH-dependent ferric chelate reductase;;;;;*
phosphatase;fructose;fructose-1-phosphatase;;;;;*
phosphatase;fructose 6;fructose-1-phosphate/6-phosphogluconate phosphatase;;;;;*
deformylase;fTHF;formyltetrahydrofolate deformylase;;;;;*
protase;FtsH;modulator of FtsH protease;;;;;*
protease;FtsH YccA;FtsH protease modulator YccA;;;;;*
glycosylase;G/U;G/U mismatch-specific DNA glycosylase;;;;;*
glycosylase;G/U station;stationary phase mismatch/uracil DNA glycosylase;;;;;*
transferase;G1207;16S rRNA m(2)G1207 methyltransferase;;;;;*
transferase;G1207 RsmC;16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC;;;;;*
anhydrase;gc anhydrase;gamma carbonic anhydrase family protein;;;;;*
ligase;Glu ligase;glutamate--tRNA ligase;;;;;*
racemase;Glu race;glutamate racemase;;;;;*
dehydrogenase;glu5dH;glutamate-5-semialdehyde dehydrogenase;;;;;*
reductase;gluDkgB;2,5-didehydrogluconate reductase DkgB;;;;;*
permease;glutarate pm;alpha-ketoglutarate permease;;;;;*
symporter;glutarate sm;alpha-ketoglutarate:H(+) symporter;;;;;*
peptidase;glycan DD;peptidoglycan DD-metalloendopeptidase family protein;;;;;*
synthetase;glycerolP;phosphatidylglycerophosphate synthase;;;;;*
transporter;glycoside-p5;glycoside-pentoside-hexuronide family transporter;;;;;*
reductase;glyoxyl A;glyoxylate/hydroxypyruvate reductase A;;;;;*
reductase;glyoxyl GhrA;glyoxylate/hydroxypyruvate reductase GhrA;;;;;*
permease;HAAAP;HAAAP family serine/threonine permease;;;;;*
tr-regulator;HdfR;DNA-binding transcriptional dual regulator HdfR;;;;;*
tr-regulator;HdfR HTH;HTH-type transcriptional regulator HdfR;;;;;*
hydrogenase;Hnase1;hydrogenase 1 small subunit;;;;;*
hp;hp-121;hp-121;;;;;
hp;hp-128;hypothetical protein;;;;;*
hp;hp-18;hp-18;;;;;*
adhesin;Inv-adhesin;inverse autotransporter adhesin;;;;;*
transposase;IS66;IS66 family transposase;;;;;*
lyase;isocitrate;isocitrate lyase;;;;;*
transferase;kdo2;kdo(2)-lipid A phosphoethanolamine 7''-transferase;;;;;*
kinase/Pase;kinase isocit;bifunctional isocitrate dehydrogenase kinase/phosphatase;;;;;*
prophage;KpLE1;CPS-53 (KpLE1) prophage, prophage CPS-53 integrase;;;;;*
lipoprotein;lipo YafT;lipoprotein YafT;;;;;*
tr-regulator;LysR;LysR family transcriptional regulator;;;;;*
tr-regulator;MarR;MarR family transcriptional regulator;;;;;*
reductase;metDkgB;methylglyoxal reductase DkgB;;;;;*
GDP;Mlb adapt;molybdopterin-guanine dinucleotide biosynthesis adaptor protein;;;;;*
GDP;Mlb pB;molybdopterin-guanine dinucleotide biosynthesis protein B;;;;;*
oxygenase;mono-O2;monooxygenase;;;;;*
titration;Mtf;Mlc titration factor;;;;;*
tr-regulator;MtfA;DgsA anti-repressor MtfA;;;;;*
glycosylase;murein;murein transglycosylase A;;;;;*
glycosylase;murein lytic;membrane-bound lytic murein transglycosylase A;;;;;*
reductase;NADPH- Ah;aldehyde reductase, NADPH-dependent;;;;;*
reductase;NADPH- Ahr;NADPH-dependent aldehyde reductase Ahr;;;;;*
transporter;nitrite;formate/nitrite transporter family protein;;;;;*
hydroxylase;octaprenyl;2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;;;;;*
rnase;oligo-rnase;oligoribonuclease;;;;;*
protein;OmpH;OmpH family outer membrane protein;;;;;*
transferase;p-Ada;pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada;;;;;*
transporter;p-AI-2E;pseudo, AI-2E family transporter;;;;;*
synthetase;p-Arg-sc 282;Pseudo, argininosuccinate synthase;;;;;*
synthetase;p-Arg-sc 284;Pseudo, argininosuccinate synthase;;;;;*
division;p-cell CpoB;Pseudo, cell division protein CpoB;;;;;*
DUF;p-DUF4102;Pseudo, DUF4102 domain-containing protein;;;;;*
transporter;p-glycoside;pseudo, glycoside-pentoside-hexuronide family transporter;;;;;*
kinase;p-His kinase;pseudo, histidine kinase;;;;;*
hp;p-hp;pseudo, hp 109;;;;;*
integrase;p-integrase;pseudo, integrase;;;;;*
transposase;p-IS4;Pseudo, IS4 family transposase;;;;;*
transposase;p-IS630 ;pseudo, IS630 family transposase;;;;;*
transporter;p-MATE;Pseudo, MATE family efflux transporter;;;;;*
transporter;p-MdtK;Pseudo, multidrug efflux MATE transporter MdtK;;;;;*
amidase;p-Nam;pseudo, nicotinamide-nucleotide amidase;;;;;*
tr-regulator;p-pu-tr 38;pseudo, putative DNA-binding transcriptional regulator;;;;;*
protein;p-un-YchS;putative uncharacterized protein YchS;;;;;*
gene;p-yicT;p-yicT;;;;;*
transferase;Pet;phosphoethanolamine transferase;;;;;*
protein;pilus;pilus assembly protein;;;;;*
dehydrogenase;porphyrine M;menaquinone-dependent protoporphyrinogen IX dehydrogenase;;;;;*
oxidase;porphyrine O;protoporphyrinogen oxidase;;;;;*
prophage;pp CP4-6;note="cryptic prophage CP4-6"     misc_feature;;;;;*
prophage;pp CPS-53;cryptic prophage CPS-53, misc_feature;;;;;*
prophage;pp DLP12;note="cryptic prophage DLP12"     misc_feature;;;;;*
prophage;pp PR-Y;cryptic prophage PR-Y;;;;;*
protein;protein YjjZ;protein YjjZ;;;;;*
protein;protein YrdA;protein YrdA;;;;;*
tr-regulator;pu- YfeC;putative DNA-binding transcriptional regulator YfeC;;;;;*
ABC bind;pu-ABC;amino acid ABC transporter ATP-binding protein;;;;;*
exporter;pu-arabi;putative arabinose exporter;;;;;*
sulfatase;pu-AslB;putative anaerobic sulfatase maturation enzyme AslB;;;;;*
cardiolipin ;pu-cardiolip;putative cardiolipin transport protein;;;;;*
cytochrome;pu-cytochrom;putative cytochrome;;;;;*
hydrolase;pu-hydrolase;putative hydrolase, inner membrane;;;;;*
integrase;pu-KpLE2;KpLE2 phage-like element putative integrase;;;;;*
peptidase;pu-LysM;LysM domain-containing putative peptidase lipoprotein YgeR;;;;;*
GMP;pu-sensor;putative c-di-GMP phosphodiesterase PdeA;;;;;*
protein;Pu-ssM;putative type II secretion system M-type protein;;;;;*
tr-regulator;pu-tr 120;putative DNA-binding transcriptional regulator;;;;;*
tr-regulator;pu-tr YieP;putative transcriptional regulator YieP;;;;;*
tr-regulator;pu-tr YjdC;putative DNA-binding transcriptional regulator YjdC;;;;;*
tr-regulator;pu-tr-YeeN;putative transcriptional regulator YeeN;;;;;*
protein;pu-unYgaQ;putative uncharacterized protein YgaQ;;;;;*
oxygenase;pu-YdhR;putative monooxygenase YdhR;;;;;*
ABC bind;pu-YhdZ;putative ABC transporter ATP-binding subunit YhdZ;;;;;*
transporter;pu-YicJ;putative xyloside transporter YicJ;;;;;*
transporter;pu-YifK;putative transporter YifK;;;;;*
prophage;put DLP12;DLP12 prophage putative integrase;;;;;*
tr-regulator;put FimZ;putative LuxR family transcriptional regulator FimZ;;;;;*
synthetase;quino;quinolinate synthase;;;;;*
synthetase;quino NadA;quinolinate synthase NadA;;;;;*
ribosome;RimP;ribosome maturation factor RimP;;;;;*
rpt;rpt-29;rpt-29;;;;;
rpt;rpt-34;rpt_type=other;;;;;*
rpt;rpt-36;rpt_type=other;;;;;*
rpt;rpt71;rpt_type=other  71;;;;;*
sRNA;RttR sRNA;small RNA RttR;;;;;*
translocase;SecE;Sec translocon subunit SecE;;;;;*
translocase;SecG-p;preprotein translocase subunit SecG;;;;;*
translocase;SecG-t;Sec translocon subunit SecG;;;;;*
esterase;sensor;sensor domain-containing phosphodiesterase;;;;;*
ABC bind;sn-glycerol;sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB;;;;;*
protein;sscs VI;type VI secretion system contractile sheath small subunit;;;;;*
protein;stress;stress response protein;;;;;*
tr-regulator;tact Cbl;DNA-binding transcriptional activator Cbl;;;;;*
translation;tif IF-1;translation initiation factor IF-1;;;;;*
protein;tpr;protamine-like protein;;;;;*
tr-regulator;tr 192;transcriptional regulator;;;;;*
tr-regulator;tr AlpA;AlpA family transcriptional regulator;;;;;*
tr-regulator;tr-Cbl;HTH-type transcriptional regulator Cbl;;;;;*
tr-regulator;tr-Nac;DNA-binding transcriptional dual regulator Nac;;;;;*
tr-regulator;tr-nitrogen;nitrogen assimilation transcriptional regulator;;;;;*
tr-regulator;tr-YebC;YebC/PmpR family DNA-binding transcriptional regulator;;;;;*
transferase;transferase;acetyltransferase;;;;;*
transporter;trp-YeeO;toxic metabolite efflux MATE transporter YeeO;;;;;*
translation;tuf;elongation factor Tu;;;;;*
translation;tufb;tufb, translation elongation factor Tu 2;;;;;*
integrase;Tyr recb 207;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 404;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 421;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 424;tyrosine-type recombinase/integrase;;;;;*
reductase;UDP-N;UDP-N-acetylenolpyruvoylglucosamine reductase;;;;;*
protein;un-YcdU;uncharacterized protein YcdU;;;;;*
protein;un-YjeV;uncharacterized protein YjeV;;;;;*
protein;UPF0149 YecA;UPF0149 family protein YecA;;;;;*
protein;YdiA;YdiA family protein;;;;;*
protein;YfdC;inner membrane protein YfdC;;;;;*
protein;YgeQ;protein YgeQ;;;;;*
gene;yjdQ;gene="yjdQ";;;;;*
DUF;DUF1435;DUF1435 domain-containing protein;;;;;*
transposase;p-IS630;pseudo, IS630-like element IS630 family transposase;;;;;*

Vibrio campbellii[modifier | modifier le wikicode]

vha opérons[modifier | modifier le wikicode]

45.4%GC;26.7.19 Paris;16s 10;121;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Vibrio campbellii ATCC BAA-1116;;;;;;;;;;
comp;1..1384;;16s;@1;103;103;;;;
comp;1488..1604;;CDS;;102507;;;;39;
;;;;;;;;;;
;104112..105239;;CDS;;529;*529;;;*376;*529
comp;105769..105845;;atgf;+;158;;*158;;;
comp;106004..106079;;ggc;7 ggc;35;;35;;;
comp;106115..106190;;ggc;5 atgf;35;;35;;;
comp;106226..106301;;ggc;;18;;18;;;
comp;106320..106396;;atgf;;39;;39;;;
comp;106436..106511;;ggc;;90;;90;;;
comp;106602..106678;;atgf;;39;;39;;;
comp;106718..106793;;ggc;;18;;18;;;
comp;106812..106888;;atgf;;39;;39;;;
comp;106928..107003;;ggc;;18;;18;;;
comp;107022..107098;;atgf;;39;;39;;;
comp;107138..107213;;ggc;;156;156;;;;156
comp;107370..107915;;CDS;;81764;;;;182;
;;;;;;;;;;
;189680..190715;;CDS;;101;101;;;345;101
comp;190817..190933;;5s;;107;;;;;
comp;191041..193955;;23s;;290;;;;;
comp;194246..194321;;gca;;43;;;43;;
comp;194365..194441;;atc;;97;;;;;
comp;194539..196096;;16s;@2;371;;;;;
comp;196468..196584;;5s;;77;;;;;
comp;196662..199576;;23s;;290;;;;;
comp;199867..199942;;gca;;43;;;43;;
comp;199986..200062;;atc;;97;;;;;
comp;200160..201717;;16s;;853;*853;;;;*853
comp;202571..204706;;CDS;;29595;;;;*712;
;;;;;;;;;;
comp;234302..235486;;CDS;;101;101;;;395;101
comp;235588..235663;;acc;;13;;13;;;
comp;235677..235751;;gga;;35;;35;;;
comp;235787..235871;;tac;;52;;52;;;
comp;235924..235999;;aca;;206;206;;;;
;236206..237129;;CDS;;4144;;;;308;
;;;;;;;;;;
comp;241274..242467;;CDS;;546;*546;;;*398;*546
comp;243014..243090;;tgg;;68;;;68;;
comp;243159..243235;;gac;;32;;;;;
comp;243268..243384;;5s;;117;;;;;
comp;243502..246404;;23s;;310;;;;;
comp;246715..246790;;gta;;30;;;30;;
comp;246821..246896;;aaa;;2;;;2;;
comp;246899..246974;;gaa;;122;;;;;
comp;247097..248654;;16s;;554;*554;;;;*554
;249209..249664;;CDS;;60596;;;;*152;
;;;;;;;;;;
;310261..311296;;CDS;;121;121;;;345;121
comp;311418..311508;;tca;;91;;;;;
comp;311600..311716;;5s;;108;;;;;
comp;311825..314739;;23s;;289;;;;;
comp;315029..315104;;gca;;43;;;43;;
comp;315148..315224;;atc;;56;;;;;
comp;315281..316842;;16s;;471;*471;;;;*471
comp;317314..318027;;CDS;;40242;;;;*238;
;;;;;;;;;;
;358270..359305;;CDS;;147;147;;;345;
comp;359453..359529;;gac;;31;;;;;
comp;359561..359677;;5s;;108;;;;;
comp;359786..362700;;23s;;310;;;;;
comp;363011..363086;;gta;;30;;;30;;
comp;363117..363192;;aaa;;2;;;2;;
comp;363195..363270;;gaa;;82;;;;;
comp;363353..364914;;16s;;83;83;;;;83
comp;364998..365133;;CDS;;84252;;;;45;
;;;;;;;;;;
;449386..449521;;CDS;;83;83;;;45;83
;449605..451162;;16s;;122;;;;;
;451285..451360;;gaa;;2;;;2;;
;451363..451438;;aaa;;9;;;9;;
;451448..451523;;gca;;37;;;37;;
;451561..451636;;gta;;51;51;;;;51
comp;451688..451873;;CDS;;16;16;;;62;16
;451890..454804;;23s;;77;;;;;
;454882..454998;;5s;;32;;;;;
;455031..455107;;gac;;162;162;;;;
comp;455270..455533;;CDS;;11718;;;;88;
;;;;;;;;;;
comp;467252..467665;;CDS;;361;361;;;138;
;468027..468103;;cgg;;35;;35;;;
;468139..468214;;cac;;76;;76;;;
;468291..468367;;cca;;46;;46;;;
;468414..468489;;cac;;64;;64;;;
;468554..468630;;cca;;194;194;;;;194
comp;468825..469550;;CDS;;365688;;;;242;
;;;;;;;;;;
comp;835239..835550;;CDS;;138;138;;;104;138
comp;835689..835764;;atgi;;145;145;;;;
comp;835910..837772;;CDS;;182191;;;;621;
;;;;;;;;;;
;1019964..1020128;;CDS;;119;119;;;55;
;1020248..1021805;;16s;;129;;;;;
;1021935..1022010;;gcc;;41;;;41;;
;1022052..1022127;;gaa;;55;55;;;;55
comp;1022183..1022368;;CDS;;16;16;;;62;16
;1022385..1025299;;23s;;111;;;;;
;1025411..1025527;;5s;;31;;;;;
;1025559..1025635;;gac;;35;;;35;;
;1025671..1025747;;tgg;;3;3;;;;3
comp;1025751..1025933;;CDS;;225465;;;;61;
;;;;;;;;;;
;1251399..1252574;;CDS;;158;158;;;392;
comp;1252733..1252817;;cta;+;54;;54;;;
comp;1252872..1252946;;caa;5 cta;46;;46;;;
comp;1252993..1253077;;cta;3 atgj;21;;21;;;
comp;1253099..1253183;;cta;2 caa;18;;18;;;
comp;1253202..1253278;;atgj;;23;;23;;;
comp;1253302..1253386;;cta;;70;;70;;;
comp;1253457..1253533;;atgj;;79;;79;;;
comp;1253613..1253687;;caa;;31;;31;;;
comp;1253719..1253803;;cta;;39;;39;;;
comp;1253843..1253919;;atgj;;26;26;;;;26
comp;1253946..1254157;;CDS;;14564;;;;71;
;;;;;;;;;;
comp;1268722..1268862;;CDS;;260;260;;;47;
;1269123..1269199;;cca;;243;243;;;;*243
comp;1269443..1269628;;CDS;;16361;;;;62;
;;;;;;;;;;
;1285990..1286571;;CDS;;88;88;;;194;
comp;1286660..1286736;;agg;;68;68;;;;68
comp;1286805..1287938;;CDS;;116753;;;;378;
;;;;;;;;;;
comp;1404692..1405552;;CDS;;204;204;;;287;*204
;1405757..1405833;;aga;;244;244;;;;
;1406078..1407685;;CDS;;49950;;;;536;
;;;;;;;;;;
;1457636..1458508;;CDS;;407;407;;;291;
comp;1458916..1459000;;tac;+;100;;100;;;
comp;1459101..1459185;;tac;4 tac;100;;100;;;
comp;1459286..1459370;;tac;@7;100;;100;;;
comp;1459471..1459555;;tac;;282;282;;;;*282
;1459838..1460935;;CDS;;170368;;;;366;
;;;;;;;;;;
;1631304..1631753;;CDS;;144;144;;;150;144
;1631898..1631985;;tcc;;312;312;;;;
;1632298..1632684;;CDS;;550413;;;;129;
;;;;;;;;;;
;2183098..2183436;;CDS;;179;179;;;113;
;2183616..2183692;;gtc;+;46;;46;;;
;2183739..2183815;;gtc;2 gtc;149;149;;;;149
;2183965..2185344;;CDS;;578546;;;;460;
;;;;;;;;;;
comp;2763891..2766782;;CDS;;763;*763;;;*964;*763
comp;2767546..2767621;;ggc;+;11;;11;;;
comp;2767633..2767719;;tta;2 ggc;78;;78;;;
comp;2767798..2767873;;ggc;;37;;37;;;
comp;2767911..2767984;;tgc;;400;400;;;;*400
comp;2768385..2768942;;CDS;;82481;;;;186;
;;;;;;;;;;
;2851424..2851855;;CDS;;62;62;;;144;62
;2851918..2851992;;gga;;333;333;;;;
;2852326..2852970;;CDS;;133282;;;;215;
;;;;;;;;;;
comp;2986253..2986402;;CDS;;1;*1;;;50;1
;2986404..2986479;;aac;;372;372;;;;
;2986852..2989149;;CDS;;60873;;;;766;
;;;;;;;;;;
;3050023..3051831;;CDS;;139;139;;;603;139
;3051971..3052061;;tca;;321;321;;;;
;3052383..3053693;;CDS;;384243;;;;437;
;;;;;;;;;;
comp;3437937..3438392;;CDS;;233;233;;;152;
comp;3438626..3438702;;atgf;;56;;56;;;
comp;3438759..3438842;;ctc;;18;18;;;;18
comp;3438861..3439199;;CDS;;113972;;;;113;
;;;;;;;;;;
comp;3553172..3554167;;CDS;;189;189;;;332;189
comp;3554357..3554433;;cgt;+;59;;59;;;
comp;3554493..3554569;;cgt;7 cgt;57;;57;;;
comp;3554627..3554703;;cgt;2 agc;57;;57;;;
comp;3554761..3554837;;cgt;;57;;57;;;
comp;3554895..3554971;;cgt;;57;;57;;;
comp;3555029..3555105;;cgt;;85;;85;;;
comp;3555191..3555282;;agc;;29;;29;;;
comp;3555312..3555388;;cgt;;31;;31;;;
comp;3555420..3555511;;agc;;243;243;;;;
comp;3555755..3555952;;CDS;;83212;;;;66;
;;;;;;;;;;
;3639165..3640295;;CDS;;108;108;;;377;108
;3640404..3640479;;ttc;+;51;;51;;;
;3640531..3640606;;aca;3 ttc;7;;7;;;
;3640614..3640689;;ttc;2 aca;43;;43;;;
;3640733..3640808;;aac;2 aac;69;;69;;;
;3640878..3640953;;aca;;10;;10;;;
;3640964..3641039;;ttc;;42;;42;;;
;3641082..3641158;;aac;;292;292;;;;
;3641451..3643076;;CDS;;233;233;;;542;
;3643310..3643385;;ttc;;51;;51;;;
;3643437..3643512;;aca;+;21;;21;;;
;3643534..3643609;;aac;2 aca;39;;39;;;
;3643649..3643724;;aca;2 aac;15;;15;;;
;3643740..3643815;;aac;;156;156;;;;156
comp;3643972..3645405;;CDS;;561;*561;;;*478;*561
comp;3645967..3646043;;gac;;31;;;;;
comp;3646075..3646191;;5s;;57;;;;;
comp;3646249..3646324;;acc;;100;;;;;
comp;3646425..3646541;;5s;;111;;;;;
comp;3646653..3649567;;23s;;-13;*-13;;;;*-13
comp;3649555..3649797;;CDS;@3;35;35;;;81;35
comp;3649833..3649908;;gca;;43;;;43;;
comp;3649952..3650028;;atc;;97;;;;;
comp;3650126..3651683;;16s;;557;*557;;;;*557
comp;3652241..3653491;;CDS;;9514;;;;*417;
;;;;;;;;;;
comp;3663006..3663598;;CDS;;181;181;;;198;
comp;3663780..3663864;;ttg;;177;177;;;;177
comp;3664042..3664707;;CDS;;93515;;;;222;
;;;;;;;;;;
;3758223..3759258;;CDS;;578;*578;;;*345;*578
comp;3759837..3759913;;gac;;68;;;;;
comp;3759982..3760098;;5s;;111;;;;;
comp;3760210..3763124;;23s;;290;;;;;
comp;3763415..3763490;;gca;;43;;;43;;
comp;3763534..3763610;;atc;;97;;;;;
comp;3763708..3765265;;16s;;86;;;;;
comp;3765351;;16s;début;;;;;;
Chromosome II;;;;;;;;;;
comp;673782..674186;;CDS;;358;358;;;135;
comp;674545..674635;;tca;;329;329;;;;*329
;674965..675645;;CDS;;205537;;;;227;
;;;;;;;;;;
;881183..882640;;CDS;;244;244;;;486;*244
;882885..882958;;tgc;;302;302;;;;
;883261..883725;;CDS;;1229;;;;155;
;;;;;;;;;;
;884955..886649;;CDS;;245;245;;;565;*245
;886895..886981;;tta;;97;;97;;;
;887079..887154;;ggc;;5;;5;;;
;887160..887233;;tgc;;317;317;;;;
;887551..889074;;CDS;;465;;;;508;
;;;;;;;;;;
comp;889540..890328;;CDS;;386;386;;;263;
;890715..890801;;tta;+;53;;53;;;
;890855..890928;;tgc;2 tgc;181;;*181;;;
;891110..891183;;tgc;;366;366;;;;*366
;891550..891891;;CDS;;443950;;;;114;
;;;;;;;;;;
;1335842..1336042;;CDS;;17;17;;;;17
;1336060..1336134;;gga;;272;272;;;;
comp;1336407..1337222;;CDS;;505333;;;;272;
;;;;;;;;;;
;1842556..1842741;;CDS;;-36;*-36;;;62;*-36
;1842706..1842789;;ctc;;29;29;;;;29
;1842819..1843430;;CDS;;77699;;;;204;
;;;;;;;;;;
;1921130..1921561;;CDS;;62;62;;;144;62
;1921624..1921698;;gga;;337;337;;;;
comp;1922036..1922209;;CDS;;15660;;;;58;
;;;;;;;;;;
comp;1937870..1939129;;CDS;;84;84;;;420;
comp;1939214..1939304;;tca;;90;;;;;
comp;1939395..1939511;;5s;;77;;;;;
comp;1939589..1942503;;23s;;306;;;;;
comp;1942810..1942885;;gta;;35;;;35;;
comp;1942921..1942996;;gca;;24;;;24;;
comp;1943021..1943096;;aaa;;2;;;2;;
comp;1943099..1943174;;gaa;;114;;;;;
comp;1943289..1944850;;16s;;83;83;;;;83
comp;1944934..1945071;;CDS;;;;;;46;

vha cumuls[modifier | modifier le wikicode]

vha cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;0;0;1;3;1;1;100;17
;16 aas 23 5s ;3;20;10;5;50;8;20;5;200;17
;16 atc gca;4;40;17;6;100;10;40;3;300;10
;16 cds 23 5s ;3;60;16;6;150;12;60;2;400;13
;max a;5;80;6;1;200;9;80;3;500;6
;a doubles;0;100;6;0;250;9;100;3;600;4
;spéciaux;1;120;0;0;300;4;120;3;700;2
;total aas;37;140;0;0;350;7;140;3;800;2
sans ;opérons;27;160;1;0;400;6;160;4;900;0
;1 aa;14;180;0;0;450;1;180;1;1000;1
;max a;12;200;1;0;500;1;200;2;1100;0
;a doubles;10;;0;0;;8;;8;;0
;total aas;84;;57;18;;78;;38;;72
total aas;;121;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;;30;;;;;;266
;;;variance;;19;;;;;;199
sans jaune;;;moyenne;46;;;183;;86;;240
;;;variance;25;;;114;;59;;178

vha blocs[modifier | modifier le wikicode]

vha blocs;;;;;;;
;;;;cds;103;;
cds;853;cds;471;16s;86;;
16s;97;16s;56;16s;97;;
atc;43;atc;43;atc;43;;
gca;290;gca;289;gca;290;;
23s;77;23s;108;23s;111;;
5s;371;5s;91;5s;68;;
16s;97;tca;;gac;;;
atc;43;;;;;;
gca;290;;;;;;
23s;107;;;;;;
5s;101;;;;;;
cds;;;;;;;
;;;;;;;
cds;554;cds;83;cds;119;cds;557
16s;122;16s;82;16s;129;16s;97
gaa;2;gaa;2;gcc;41;atc;43
aaa;30;aaa;30;gaa;55;gca;35
gta;310;gta;310;cds;16;cds;-13
23s;117;23s;108;23s;111;23s;111
5s;32;5s;31;5s;31;5s;100
gac;;gac;;gac;;acc;57
;;;;;;5s;31
;;;;;;gac;
;;;;;;;
cds;83;cds;83;;;;
16s;114;16s;122;;;;
gaa;2;gaa;2;;;;
aaa;24;aaa;9;;;;
gca;35;gca;37;;;;
gta;306;gta;51;;;;
23s;77;cds;16;;;;
5s;90;23s;77;;;;
tca;;5s;32;;;;
;;gac;;;;;

vha distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;8;gtc2;atgi;;tct;;tat;;atgf;;gtc2;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;cta2;att;;act;;aat;;agt;;cta2;att;;act;;aat;;agt;;cta2;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;;tac4;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;tgc2;gtt;;gct;;gat;;ggt;;tgc2;gtt;;gct;;gat;;ggt;;tgc2;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;1;cgt6;ttc;4;tcc;;tac;1;tgc;2;cgt6;ttc;;tcc;;tac;4;tgc;2;cgt6;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;;ggc3;atc;;acc;1;aac;4;agc;2;ggc3;atc;;acc;;aac;;agc;;ggc3;atc;;acc;1;aac;;agc;
ctc;1;ccc;;cac;;cgt;;;ctc;1;ccc;;cac;2;cgt;1;;ctc;;ccc;;cac;;cgt;6;;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;acc 5s + 1 >a;gtc;;gcc;;gac;;ggc;5;acc 5s + 1 >a;gtc;2;gcc;;gac;;ggc;3;acc 5s + 1 >a;gtc;;gcc;;gac;6;ggc;
tta;;tca;2;taa;;tga;;tca 2 5s+ 2 a;tta;3;tca;;taa;;tga;;tca 2 5s+ 2 a;tta;;tca;;taa;;tga;;tca 2 5s+ 2 a;tta;;tca;2;taa;;tga;
ata;;aca;;aaa;;aga;1;gga 1>a + 3a;ata;;aca;5;aaa;;aga;;gga 1>a + 3a;ata;;aca;;aaa;;aga;;gga 1>a + 3a;ata;;aca;;aaa;;aga;
cta;;cca;1;caa;;cga;;;cta;3;cca;2;caa;2;cga;;;cta;2;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;3;séquences;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;2
atgj;;acg;;aag;;agg;1;(cac cca)2;atgj;3;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;cgt5 (cgt agc)2;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;ttc (aca aac)2;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;(atgf ggc) ggc2 (atgf ggc)4;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
vha;;14;;;;;14;ttc aca (ttc aac) aca (ttc aac);vha;51;;;;;;51;;vha;19;;;;;;19;;vha;;;;11;;;11

Aeromonas media WS[modifier | modifier le wikicode]

amed opérons[modifier | modifier le wikicode]

61.2%GC;25.7.19 Paris;16s ;126;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd
Aeromonas media WS;;;;;;;;;;
;6590..7159;;CDS;;3;;;;190;
;;;;;;;;;;
comp;7163..8359;;CDS;;512;*512;;;399;
;8872..10421;;16s;;66;;;;;
;10488..10564;;atc;;10;;;10;;
;10575..10650;;gca;;231;;;;;
;10882..13800;;23s;;98;;;;;
;13899..14013;;5s;;386;*386;;;;*386
;14400..14717;;CDS;;102422;;;;106;
;;;;;;;;;;
;117140..117850;;CDS;;47;47;;;237;47
;117898..117973;;ttc;;52;;52;;;
;118026..118101;;aca;;3;;3;;;
;118105..118180;;ttc;;45;;45;;;
;118226..118301;;aac;;252;252;;;;
;118554..119573;;CDS;;50489;;;;340;
;;;;;;;;;;
comp;170063..170329;;CDS;;103;103;;;89;103
comp;170433..170518;;ctg;+;71;;71;;;
comp;170590..170675;;ctg;5 ctg;46;;46;;;
comp;170722..170807;;ctg;;46;;46;;;
comp;170854..170939;;ctg;;51;;51;;;
comp;170991..171076;;ctg;;116;116;;;;
comp;171193..172653;;CDS;;146173;;;;487;
;;;;;;;;;;
;318827..320692;;CDS;;190;190;;;622;190
;320883..320959;;atgi;;244;244;;;;
comp;321204..323780;;CDS;;62601;;;;*859;
;;;;;;;;;;
;386382..386732;;CDS;;514;*514;;;117;
;387247..388802;;16s;;268;;;;;
;389071..389146;;gaa;;245;;;;;
;389392..392312;;23s;;104;;;;;
;392417..392531;;5s;;268;268;;;;268
comp;392800..394413;;CDS;;81847;;;;538;
;;;;;;;;;;
;476261..476482;;CDS;;64;64;;;74;64
comp;476547..476622;;aac;;5;;5;;;
comp;476628..476703;;ttc;;622;*622;;;;
;477326..477547;;CDS;;22721;;;;*74;
;;;;;;;;;;
;500269..500814;;CDS;;177;177;;;182;177
;500992..501067;;ggc;+;24;;24;;;
;501092..501167;;ggc;6 ggc;29;;29;;;
;501197..501272;;ggc;;38;;38;;;
;501311..501386;;ggc;;25;;25;;;
;501412..501487;;ggc;;23;;23;;;
;501511..501586;;ggc;;363;*363;;;;
comp;501950..502159;;CDS;;4810;;;;70;
;;;;;;;;;;
;506970..507110;;CDS;;236;236;;;47;236
;507347..507422;;gcc;+;28;;28;;;
;507451..507526;;gcc;5 gcc;66;;66;;;
;507593..507668;;gcc;;58;;58;;;
;507727..507802;;gcc;;40;;40;;;
;507843..507918;;gcc;;471;*471;;;;
;508390..508473;;riboswitch;@1;134002;;;;28;
;;;;;;;;;;
;642476..642802;;CDS;;9;9;;;109;9
;642812..642896;;ctc;;91;;91;;;
;642988..643064;;atgf;;166;166;;;;
;643231..643689;;CDS;;128528;;;;153;
;;;;;;;;;;
;772218..774050;;CDS;;195;195;;;611;195
comp;774246..774329;;cta;+;8;;8;;;
comp;774338..774414;;atg;3 atg;38;;38;;;
comp;774453..774527;;caa;4 caa;47;;47;;;
comp;774575..774649;;caa;;17;;17;;;
comp;774667..774743;;atg;;35;;35;;;
comp;774779..774853;;caa;;47;;47;;;
comp;774901..774975;;caa;;13;;13;;;
comp;774989..775065;;atg;;235;235;;;;
comp;775301..776392;;CDS;;3148;;;;364;
;;;;;;;;;;
comp;779541..780557;;CDS;;104;104;;;339;104
comp;780662..780736;;caa;;-21;*-21;;;;*-21
comp;780716..781612;;CDS;;373301;;;;299;
;;;;;;;;;;
comp;1154914..1155384;;CDS;;131;131;;;157;131
comp;1155516..1155592;;ccc;;226;226;;;;
comp;1155819..1157162;;CDS;;67691;;;;448;
;;;;;;;;;;
comp;1224854..1226290;;CDS;;301;301;;;479;
comp;1226592..1226667;;aac;;2;;2;;;
comp;1226670..1226744;;gga;;164;164;;;;164
comp;1226909..1227181;;CDS;;13604;;;;91;
;;;;;;;;;;
comp;1240786..1241733;;CDS;;350;*350;;;316;
comp;1242084..1242156;;aac;+;2;;2;;;
comp;1242159..1242234;;aac;2 aac;49;49;;;;49
;1242284..1242496;;CDS;;294;;;;71;
;;;;;;;;;;
;1242791..1244527;;CDS;;181;181;;;579;181
;1244709..1244796;;tcc;;407;*407;;;;
;1245204..1246064;;CDS;;161293;;;;287;
;;;;;;;;;;
comp;1407358..1408338;;CDS;;410;*410;;;327;
comp;1408749..1408836;;tcc;;177;177;;;;177
comp;1409014..1409631;;CDS;;34595;;;;206;
;;;;;;;;;;
;1444227..1444688;;CDS;;146;146;;;154;
;1444835..1444922;;tcc;;127;127;;;;127
;1445050..1446834;;CDS;;14349;;;;595;
;;;;;;;;;;
comp;1461184..1462401;;CDS;;163;163;;;406;163
comp;1462565..1462640;;cac;;124;;124;;;
comp;1462765..1462838;;aga;;240;240;;;;
comp;1463079..1464389;;CDS;;61984;;;;437;
;;;;;;;;;;
comp;1526374..1527606;;CDS;;151;151;;;411;151
comp;1527758..1527833;;cac;;123;;123;;;
comp;1527957..1528033;;aga;;36;;36;;;
comp;1528070..1528146;;cca;;203;203;;;;
;1528350..1529207;;CDS;;60230;;;;286;
;;;;;;;;;;
;1589438..1589644;;CDS;;138;138;;;69;
comp;1589783..1589858;;aac;;132;132;;;;132
;1589991..1592003;;CDS;;57434;;;;671;
;;;;;;;;;;
;1649438..1651867;;CDS;;104;104;;;*810;104
comp;1651972..1652048;;gtc;+;36;;36;;;
comp;1652085..1652161;;gtc;5 gtc;26;;26;;;
comp;1652188..1652264;;gtc;;15;;15;;;
comp;1652280..1652356;;gtc;;11;;11;;;
comp;1652368..1652444;;gtc;;170;170;;;;
comp;1652615..1653994;;CDS;;277443;;;;460;
;;;;;;;;;;
comp;1931438..1932934;;CDS;;145;145;;;499;145
comp;1933080..1933156;;atgf;+;110;;110;;;
comp;1933267..1933343;;atgf;9 atgf;102;;102;;;
comp;1933446..1933522;;atgf;@2;101;;101;;;
comp;1933624..1933700;;atgf;;101;;101;;;
comp;1933802..1933877;;atgf;;103;;103;;;
comp;1933981..1934057;;atgf;;102;;102;;;
comp;1934160..1934236;;atgf;;102;;102;;;
comp;1934339..1934415;;atgf;;92;;92;;;
comp;1934508..1934584;;atgf;;268;268;;;;
comp;1934853..1935572;;CDS;;490897;;;;240;
;;;;;;;;;;
comp;2426470..2427675;;CDS;;350;350;;;402;
comp;2428026..2428112;;tta;;40;;40;;;
comp;2428153..2428226;;tgc;;35;;35;;;
comp;2428262..2428337;;ggc;;181;181;;;;181
comp;2428519..2429073;;CDS;;117921;;;;185;
;;;;;;;;;;
comp;2546995..2547534;;CDS;;271;271;;;180;271
;2547806..2547882;;ccc;;1103;*1103;;;;
;2548986..2550593;;CDS;;107760;;;;*536;
;;;;;;;;;;
;2658354..2659094;;CDS;;87;87;;;247;87
;2659182..2659257;;acg;;108;108;;;;
<  comp;2659366..2659705;;CDS;;198821;;;;113;
;;;;;;;;;;
comp;2858527..2859036;;CDS;;126;126;;;170;
;2859163..2859247;;tac;+;30;;30;;;
;2859278..2859362;;tac;2 tac;121;121;;;;121
comp;2859484..2863335;;CDS;;115303;;;;*1284;
;;;;;;;;;;
;2978639..2979358;;CDS;;119;119;;;240;119
comp;2979478..2979552;;gga;;104;;104;;;
comp;2979657..2979730;;ggg;;201;201;;;;
;2979932..2981701;;CDS;;41492;;;;590;
;;;;;;;;;;
;3023194..3023487;;CDS;;75;75;;;98;75
comp;3023563..3023636;;tgc;;57;;57;;;
comp;3023694..3023769;;ggc;;248;248;;;;
;3024018..3027455;;CDS;;17375;;;;*1146;
;;;;;;;;;;
;3044831..3045361;;CDS;;133;133;;;177;133
comp;3045495..3045584;;tcg;;380;*380;;;;
;3045965..3046882;;CDS;;221147;;;;306;
;;;;;;;;;;
comp;3268030..3268398;;CDS;;318;318;;;123;
comp;3268717..3268804;;tca;;198;198;;;;198
;3269003..3269752;;CDS;;20717;;;;250;
;;;;;;;;;;
;3290470..3291624;;CDS;;50;50;;;385;50
;3291675..3291751;;agg;;126;126;;;;
comp;3291878..3292804;;CDS;;41865;;;;309;
;;;;;;;;;;
;3334670..3335758;;CDS;;230;230;;;363;
;3335989..3336073;;tac;+;32;;32;;;
;3336106..3336190;;tac;3 tac;45;;45;;;
;3336236..3336320;;tac;;135;135;;;;135
;3336456..3336731;;CDS;;169091;;;;92;
;;;;;;;;;;
comp;3505823..3506272;;CDS;;275;275;;;150;275
comp;3506548..3506662;;5s;;101;;;;;
comp;3506764..3509682;;23s;;229;;;;;
comp;3509912..3509987;;gaa;;218;;;;;
comp;3510206..3511760;;16s;;592;*592;;;;
;3512353..3515220;;CDS;;161083;;;;*956;
;;;;;;;;;;
comp;3676304..3677323;;CDS;;113;113;;;340;
comp;3677437..3677521;;ttg;;49;49;;;;49
;3677571..3678182;;CDS;;9862;;;;204;
;;;;;;;;;;
;3688045..3688872;;CDS;;369;*369;;;276;
comp;3689242..3689318;;cgt;+;25;;25;;;
comp;3689344..3689420;;cgt;5 cgt;25;;25;;;
comp;3689446..3689522;;cgt;;26;;26;;;
comp;3689549..3689625;;cgt;;98;;98;;;
comp;3689724..3689800;;cgt;;4;;4;;;
comp;3689805..3689897;;agc;;213;213;;;;213
comp;3690111..3690299;;CDS;;196546;;;;63;
;;;;;;;;;;
;3886846..3887601;;CDS;;302;302;;;252;302
comp;3887904..3887980;;gac;;98;;;;;
comp;3888079..3888193;;5s;;105;;;;;
comp;3888299..3891217;;23s;;231;;;;;
comp;3891449..3891524;;gca;;10;;;10;;
comp;3891535..3891611;;atc;;66;;;;;
comp;3891678..3893232;;16s;;420;*420;;;;
comp;3893653..3894195;;CDS;;18750;;;;181;
;;;;;;;;;;
comp;3912946..3913317;;CDS;;60;60;;;124;
comp;3913378..3913454;;tgg;;52;52;;;;52
comp;3913507..3914691;;CDS;@3;171;171;;;395;171
comp;3914863..3914937;;gga;;38;;38;;;
comp;3914976..3915060;;tac;;263;263;;;;
;3915324..3916262;;CDS;;45900;;;;313;
;;;;;;;;;;
comp;3962163..3963533;;CDS;;306;306;;;457;
comp;3963840..3963916;;tgg;;202;202;;;;202
;3964119..3964703;;CDS;;59641;;;;195;
;;;;;;;;;;
comp;4024345..4026816;;CDS;;658;*658;;;*824;
comp;4027475..4027551;;ccg;;140;140;;;;140
comp;4027692..4028417;;CDS;;80995;;;;242;
;;;;;;;;;;
;4109413..4111986;;CDS;;99;99;;;*858;
comp;4112086..4112200;;5s;;101;;;;;
comp;4112302..4115220;;23s;;231;;;;;
comp;4115452..4115527;;gaa;;192;;;;;
comp;4115720..4117273;;16s;;94;94;;;;94
comp;4117368..4117547;;CDS;;32227;;;;60;
;;;;;;;;;;
comp;4149775..4150248;;CDS;;204;204;;;158;204
comp;4150453..4150529;;cca;;58;;58;;;
comp;4150588..4150673;;ctg;;20;;20;;;
comp;4150694..4150769;;cac;;49;;49;;;
comp;4150819..4150895;;cgg;;258;258;;;;
;4151154..4151744;;CDS;;74862;;;;197;
;;;;;;;;;;
;4226607..4227725;;CDS;;428;*428;;;373;
;4228154..4229708;;16s;;192;;;;;
;4229901..4229976;;gaa;;229;;;;;
;4230206..4233124;;23s;;104;;;;;
;4233229..4233343;;5s;;106;;;;;
;4233450..4233525;;acc;;23;;;;;
;4233549..4233663;;5s;;164;164;;;;164
;4233828..4234793;;CDS;;119351;;;;322;
;;;;;;;;;;
comp;4354145..4355686;;CDS;;622;*622;;;*514;
;4356309..4357863;;16s;;268;;;;;
;4358132..4358207;;gaa;;230;;;;;
;4358438..4361364;;23s;;102;;;;;
;4361467..4361581;;5s;;106;;;;;
;4361688..4361763;;acc;;233;233;;;;233
;4361997..4363241;;CDS;;71363;;;;415;
;;;;;;;;;;
;4434605..4435198;;CDS;;465;*465;;;198;
;4435664..4437217;;16s;;219;;;;;
;4437437..4437512;;gaa;;229;;;;;
;4437742..4440657;;23s;;103;;;;;
;4440761..4440875;;5s;;98;;;;;
;4440974..4441050;;gac;;167;167;;;;167
;4441218..4442054;;CDS;;39919;;;;279;
;;;;;;;;;;
comp;4481974..4482513;;CDS;;477;*477;;;180;
;4482991..4484545;;16s;;513;;;;;
;4485059..4485549;;23s°;;37;;;;;
comp;4485587..4486115;;23s°;;229;;;;;
comp;4486345..4486419;;gaa;;218;;;;;
comp;4486638..4488193;;16s;;94;94;;;;94
comp;4488288..4488509;;CDS;;72132;;;;74;
;;;;;;;;;;
comp;4560642..4561676;;CDS;;192;192;;;345;
comp;4561869..4561944;;gta;+;18;;18;;;
comp;4561963..4562038;;aaa;7 gta;34;;34;;;
comp;4562073..4562148;;gta;5 aaa;18;;18;;;
comp;4562167..4562242;;aaa;2 aag;23;;23;;;
comp;4562266..4562341;;gta;;18;;18;;;
comp;4562360..4562435;;aaa;;23;;23;;;
comp;4562459..4562534;;gta;;18;;18;;;
comp;4562553..4562628;;aaa;;34;;34;;;
comp;4562663..4562738;;gta;;22;;22;;;
comp;4562761..4562836;;aag;;46;;46;;;
comp;4562883..4562958;;gta;;22;;22;;;
comp;4562981..4563056;;aag;;46;;46;;;
comp;4563103..4563178;;gta;;32;;32;;;
comp;4563211..4563286;;aaa;;174;174;;;;174
comp;4563461..4564276;;CDS;;70895;;;;272;
;;;;;;;;;;
comp;4635172..4636173;;CDS;;275;275;;;334;275
comp;4636449..4636525;;gac;;95;;;;;
comp;4636621..4636735;;5s;;101;;;;;
comp;4636837..4639756;;23s;;231;;;;;
comp;4639988..4640063;;gca;;10;;;10;;
comp;4640074..4640150;;atc;;66;;;;;
comp;4640217..4641771;;16s;;512;*512;;;;
;4642284..4643480;;CDS;;3;;;;399;
;;;;;;;;;;
comp;4643484..4644053;;CDS;;;;;;190;

amed cumuls[modifier | modifier le wikicode]

amed cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;0;-;1;1;40;1;100;14
;16 gaa 23 5s ;6;20;15;;50;5;60;5;200;21
;16 atc gca;3;40;27;;100;8;80;2;300;15
;16 23 5s ;0;60;14;;150;19;100;3;400;18
;max a;3;80;2;;200;17;120;4;500;11
;a doubles;0;100;3;;250;13;140;7;600;6
;spéciaux;1;120;8;;300;8;160;2;700;3
;total aas;18;140;2;;350;6;180;8;800;0
sans ;opérons;38;160;0;;400;4;200;5;900;4
;1 aa;16;180;0;;450;4;220;3;1000;1
;max a;14;200;0;;500;3;240;2;1100;0
;a doubles;12;;0;;;8;;6;;2
;total aas;109;;71;0;;96;;48;;95
total aas;;127;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;49;;;;;156;;
;;;variance;34;;;;;77;;
sans jaune;;;moyenne;;;;214;;;;274
;;;variance;;;;122;;;;157

amed blocs[modifier | modifier le wikicode]

amed blocs;;;;;
cds;512;cds;302;cds;275
16s;66;gac;98;gac;95
atc;10;5s;105;5s;101
gca;231;23s;231;23s;231
23s;98;gca;10;gca;10
5s;386;atc;66;atc;66
;;16s;420;16s;512
;;;;;
cds;514;275;99;;
16s;268;101;101;;
gaa;245;229;231;;
23s;104;218;192;;
5s;268;592;94;;
;;;;;
cds;428;CDS;622;cds;465
16s;192;16s;268;16s;219
gaa;229;gaa;230;gaa;229
23s;104;23s;102;23s;103
5s;106;5s;106;5s;98
acc;23;acc;233;gac;167
5s;164;;;;

amed distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;amed;atgi;;tct;;tat;;atgf;1;amed;atgi;;tct;;tat;;atgf;9;amed;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;gtc5;att;;act;;aat;;agt;;gtc5;att;;act;;aat;;agt;;gtc5;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;ctg5;ctt;;cct;;cat;;cgc;;ctg5;ctt;;cct;;cat;;cgc;;ctg5;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;gcc5;gtt;;gct;;gat;;ggt;;gcc5;gtt;;gct;;gat;;ggt;;gcc5;gtt;;gct;;gat;;ggt;
ttc;;tcc;3;tac;;tgc;;tac3+2;ttc;3;tcc;;tac;1;tgc;2;tac3+2;ttc;;tcc;;tac;5;tgc;;tac3+2;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;1;agc;;aac2;atc;;acc;;aac;3;agc;1;aac2;atc;;acc;;aac;2;agc;;aac2;atc;;acc;2;aac;;agc;
ctc;;ccc;2;cac;;cgt;;caa2+2;ctc;1;ccc;;cac;3;cgt;;caa2+2;ctc;;ccc;;cac;;cgt;5;caa2+2;ctc;;ccc;;cac;;cgt;
gtc;;gcc;;gac;;ggc;;atgf9;gtc;;gcc;;gac;;ggc;2;atgf9;gtc;5;gcc;5;gac;;ggc;6;atgf9;gtc;;gcc;;gac;3;ggc;
tta;;tca;1;taa;;tga;;cgt5;tta;1;tca;;taa;;tga;;cgt5;tta;;tca;;taa;;tga;;cgt5;tta;;tca;;taa;;tga;
ata;;aca;;aaa;;aga;;ggc6;ata;;aca;1;aaa;5;aga;2;ggc6;ata;;aca;;aaa;;aga;;ggc6;ata;;aca;;aaa;;aga;
cta;;cca;;caa;1;cga;;;cta;1;cca;2;caa;;cga;;;cta;;cca;;caa;4;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;7;gca;;gaa;;gga;3;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;séquences;atgj;3;acg;;aag;2;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;1;cag;;cgg;;;ctg;1;ccg;;cag;;cgg;1;;ctg;5;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;;(atgj caa2)2;gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;(gta aaa)4 (gta aag)2 gta aaa;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
amed;;16;;;;;16;;amed;47;;;;;;47;;amed;46;;;;;;46;;amed;;;;5;;;5

gamma synthèse[modifier | modifier le wikicode]

gamma distribution par génome[modifier | modifier le wikicode]

gama;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
spl;46;8;;;;6;79;3;142
vpb;60;11;;;;21;22;12;126
vha;51;14;;;;26;19;11;121
amed;47;16;;;;13;46;5;127
eal;25;23;;;;10;23;4;85
eco;20;23;;;;10;29;4;86
ecoN;20;34;;;;17;44;6;121
;;;;;;;;;
total;269;129;0;0;0;103;262;45;808

gamma distribution du total[modifier | modifier le wikicode]

gama7;;;;;;;660;;gamma7;;;;;;;148
atgi;11;tct;;tat;;atgf;48;;atgi;;tct;;tat;;atgf;0
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;21;tcc;14;tac;30;tgc;18;;ttc;;tcc;;tac;;tgc;
atc;3;acc;6;aac;34;agc;11;;atc;23;acc;9;aac;;agc;
ctc;9;ccc;6;cac;12;cgt;40;;ctc;;ccc;;cac;;cgt;
gtc;21;gcc;16;gac;7;ggc;46;;gtc;;gcc;2;gac;23;ggc;
tta;14;tca;12;taa;;tga;4;;tta;;tca;4;taa;;tga;
ata;;aca;19;aaa;33;aga;10;;ata;;aca;;aaa;8;aga;
cta;24;cca;14;caa;23;cga;;;cta;;cca;;caa;;cga;
gta;34;gca;;gaa;17;gga;14;;gta;8;gca;29;gaa;34;gga;
ttg;7;tcg;4;tag;;tgg;4;;ttg;;tcg;;tag;;tgg;8
atgj;19;acg;4;aag;2;agg;7;;atgj;;acg;;aag;;agg;
ctg;21;ccg;4;cag;6;cgg;7;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;4;;gtg;;gcg;;gag;;ggg;
gama;>1aa;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
;531;129;0;0;0;0;660;;1-3aas;;;;45;;103;148

gamma distribution par type[modifier | modifier le wikicode]

gama7;;;;;;;660;;gama7;;;;;;;129;;gama7;;;;;;;269;;gama7;;;;;;;262;;gama7;;;;;;;45
atgi;11;tct;0;tat;0;atgf;48;;atgi;9;tct;;tat;;atgf;6;;atgi;2;tct;;tat;;atgf;18;;atgi;;tct;;tat;;atgf;24;;atgi;;tct;;tat;;atgf;
att;0;act;0;aat;0;agt;0;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;0;cct;0;cat;0;cgc;0;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;21;tcc;14;tac;30;tgc;18;;ttc;7;tcc;14;tac;;tgc;1;;ttc;14;tcc;;tac;6;tgc;15;;ttc;;tcc;;tac;24;tgc;2;;ttc;;tcc;;tac;;tgc;
atc;3;acc;6;aac;34;agc;11;;atc;1;acc;1;aac;14;agc;;;atc;;acc;5;aac;11;agc;11;;atc;2;acc;;aac;9;agc;;;atc;;acc;9;aac;;agc;
ctc;9;ccc;6;cac;12;cgt;40;;ctc;5;ccc;6;cac;;cgt;;;ctc;4;ccc;;cac;12;cgt;2;;ctc;;ccc;;cac;;cgt;38;;ctc;;ccc;;cac;;cgt;
gtc;21;gcc;16;gac;7;ggc;46;;gtc;;gcc;;gac;3;ggc;;;gtc;2;gcc;2;gac;;ggc;17;;gtc;19;gcc;14;gac;4;ggc;29;;gtc;;gcc;;gac;23;ggc;
tta;14;tca;12;taa;0;tga;4;;tta;;tca;10;taa;;tga;4;;tta;14;tca;;taa;;tga;;;tta;;tca;2;taa;;tga;;;tta;;tca;4;taa;;tga;
ata;0;aca;19;aaa;33;aga;10;;ata;;aca;;aaa;;aga;6;;ata;;aca;19;aaa;15;aga;4;;ata;;aca;;aaa;18;aga;;;ata;;aca;;aaa;;aga;
cta;24;cca;14;caa;23;cga;0;;cta;;cca;2;caa;1;cga;;;cta;18;cca;10;caa;12;cga;;;cta;6;cca;2;caa;10;cga;;;cta;;cca;;caa;;cga;
gta;34;gca;0;gaa;17;gga;14;;gta;;gca;;gaa;4;gga;4;;gta;13;gca;;gaa;;gga;10;;gta;21;gca;;gaa;13;gga;;;gta;;gca;;gaa;1;gga;
ttg;7;tcg;4;tag;0;tgg;4;;ttg;7;tcg;4;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;8
atgj;19;acg;4;aag;2;agg;7;;atgj;;acg;4;aag;;agg;7;;atgj;19;acg;;aag;2;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;21;ccg;4;cag;6;cgg;7;;ctg;;ccg;4;cag;;cgg;;;ctg;4;ccg;;cag;;cgg;7;;ctg;17;ccg;;cag;6;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;0;gcg;0;gag;0;ggg;4;;gtg;;gcg;;gag;;ggg;3;;gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;gama;>1aa;1aa;-5s;+5s;-16s;+16s;total
;;;;;;;;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;1-3aas;;;;45;;;

gamma par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;gama7;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;37;18;39;;;2;96;
16;moyen;51;104;31;;21;52;259;
14;fort;41;147;192;;24;49;453;
; ;129;269;262;;45;103;808;
10;g+cga;15;3;6;;;;24;
2;agg+cgg;7;7;;;;;14;
4;carre ccc;11;8;33;;;2;54;
5;autres;4;;;;;;4;
;;37;18;39;;;2;96;
;total tRNAs  ‰ ;;;;;;;;
;gama7;1aa;>1aa;dup;+5s;1-3aas;autres;gama  ‰;ref. ‰
21;faible;46;22;48;;;2;119;26
16;moyen;63;129;38;;26;64;321;324
14;fort;51;182;238;;30;61;561;650
;;160;333;324;;56;127;808;729
10;g+cga;19;4;7;;;;30;10
2;agg+cgg;9;9;;;;;17;
4;carre ccc;14;10;41;;;2;67;16
5;autres;5;;;;;;5;
;;46;22;48;;;2;119;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;gama7;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;56;27;59;142;26;29;7;15
16;moyen;77;158;47;282;324;40;39;12
14;fort;62;223;291;576;650;32;55;73
;;195;408;397;660;729;129;269;262
10;g+cga;23;5;9;36;10;41;;15
2;agg+cgg;11;11;;21;;19;;
4;carre ccc;17;12;50;79;16;30;;85
5;autres;6;;;6;;11;;
;;56;27;59;142;;37;;39

gamma, estimation des -rRNAs[modifier | modifier le wikicode]

gamma;;;;;;;;;;;;;;;;;;;;;;;;;
144 génomes total avec rRNA;;;;gama;total;ttt;tgt;;100 génomes total avec rRNA;;;;gama;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;144;1536; ; ;;indices;;;;144;1067;0;0;;gama7;effectifs;;1aa+>1aa+dup;;;;660
atgi;;tct;;tat;;atgf;3;;atgi;;tct;;tat;;atgf;2;;atgi;11;tct;;tat;;atgf;48
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;3;tcc;;tac;1;tgc;;;ttc;2;tcc;;tac;1;tgc;;;ttc;21;tcc;14;tac;30;tgc;18
atc;373;acc;57;aac;;agc;3;;atc;259;acc;40;aac;;agc;2;;atc;3;acc;6;aac;34;agc;11
ctc;;ccc;;cac;10;cgt;;;ctc;;ccc;;cac;7;cgt;;;ctc;9;ccc;6;cac;12;cgt;40
gtc;;gcc;3;gac;151;ggc;;;gtc;;gcc;2;gac;105;ggc;;;gtc;21;gcc;16;gac;7;ggc;46
tta;1;tca;3;taa;;tga;;;tta;1;tca;2;taa;;tga;;;tta;14;tca;12;taa;;tga;4
ata;;aca;;aaa;13;aga;;;ata;;aca;;aaa;9;aga;;;ata;;aca;19;aaa;33;aga;10
cta;;cca;14;caa;;cga;;;cta;;cca;10;caa;;cga;;;cta;24;cca;14;caa;23;cga;
gta;14;gca;378;gaa;423;gga;;;gta;10;gca;263;gaa;294;gga;;;gta;34;gca;;gaa;17;gga;14
ttg;1;tcg;;tag;;tgg;73;;ttg;1;tcg;;tag;;tgg;51;;ttg;7;tcg;4;tag;;tgg;4
atgj;1;acg;;aag;;agg;;;atgj;1;acg;;aag;;agg;;;atgj;19;acg;4;aag;2;agg;7
ctg;;ccg;;cag;;cgg;11;;ctg;;ccg;;cag;;cgg;8;;ctg;21;ccg;4;cag;6;cgg;7
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;4
;;900;;622;;14;1536;;;;625;;432;;10;1067;;;;186;;380;;94;660
27.5.20 Tanger;;;;gama;total;ttt;tgt;;27.5.20 Tanger;;;;gama;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;86713;1.5;0;;avec +16s;;;;1183;86713;1.5;0;;gama7;indices;;1aa+>1aa+dup;;;;
atgi;130;tct;1.7;tat;1.3;atgf;290;;atgi;130;tct;1.7;tat;1.3;atgf;292;;atgi;157;tct;;tat;;atgf;686
att;0.1;act;0.5;aat;0.2;agt;;;att;0.1;act;0.5;aat;0.2;agt;;;att;;act;;aat;;agt;
ctt;0.9;cct;;cat;;cgc;;;ctt;0.9;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0.5;gct;;gat;;ggt;0.5;;gtt;0.5;gct;;gat;;ggt;0.5;;gtt;;gct;;gat;;ggt;
ttc;173;tcc;152;tac;226;tgc;114;;ttc;175;tcc;152;tac;227;tgc;114;;ttc;300;tcc;200;tac;429;tgc;257
atc;26;acc;115;aac;311;agc;104;;atc;285;acc;155;aac;311;agc;106;;atc;43;acc;86;aac;486;agc;157
ctc;102;ccc;86;cac;108;cgt;298;;ctc;102;ccc;86;cac;115;cgt;298;;ctc;129;ccc;86;cac;171;cgt;571
gtc;173;gcc;165;gac;184;ggc;351;;gtc;173;gcc;167;gac;289;ggc;351;;gtc;300;gcc;229;gac;100;ggc;657
tta;119;tca;138;taa;1.0;tga;64;;tta;120;tca;140;taa;1.0;tga;64;;tta;200;tca;171;taa;;tga;57
ata;0.8;aca;141;aaa;368;aga;151;;ata;0.8;aca;141;aaa;377;aga;151;;ata;;aca;271;aaa;471;aga;143
cta;128;cca;131;caa;189;cga;13;;cta;128;cca;141;caa;189;cga;13;;cta;343;cca;200;caa;329;cga;
gta;311;gca;21;gaa;30;gga;114;;gta;321;gca;283;gaa;324;gga;114;;gta;486;gca;;gaa;243;gga;200
ttg;102;tcg;83;tag;2.7;tgg;62;;ttg;103;tcg;83;tag;2.7;tgg;113;;ttg;100;tcg;57;tag;;tgg;57
atgj;169;acg;71;aag;24;agg;110;;atgj;170;acg;71;aag;24;agg;110;;atgj;271;acg;57;aag;29;agg;100
ctg;252;ccg;62;cag;102;cgg;92;;ctg;252;ccg;62;cag;102;cgg;100;;ctg;300;ccg;57;cag;86;cgg;100
gtg;8.3;gcg;6.9;gag;7.6;ggg;72;;gtg;8.3;gcg;6.9;gag;7.6;ggg;72;;gtg;;gcg;;gag;;ggg;57
;;1892;;3118;;1244;6254;;;;2517;;3550;;1254;7321;;;;2657;;5429;;1343;9429
rapports;;75;;88;;99;85;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;gama7;indices;;1aa+>1aa+dup;;différence;;
atgi;100;tct;;tat;;atgf;99;;fiches;57.882;;;fréquences;;;;;atgi;17;tct;100;tat;100;atgf;58
att;;act;;aat;;agt;;;total des aas sans rRNA;8335;;;0/0;;;;;att;100;act;100;aat;100;agt;
ctt;;cct;;cat;;cgc;;;avec;1401;;;10;7;;;;ctt;100;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;genom;144;;;20;7;;;;gtt;100;gct;;gat;;ggt;100
ttc;99;tcc;100;tac;100;tgc;100;;;;;;30;6;;;;ttc;42;tcc;24;tac;47;tgc;56
atc;9;acc;74;aac;100;agc;98;;gama7;94.2857142857143;;;40;8;;;;atc;39;acc;26;aac;36;agc;34
ctc;100;ccc;100;cac;94;cgt;100;;sans;660;;;50;10;38;;;ctc;21;ccc;0;cac;37;cgt;48
gtc;100;gcc;99;gac;64;ggc;100;;avec;148;;;60;2;;;;gtc;42;gcc;28;gac;46;ggc;47
tta;99;tca;99;taa;;tga;100;;genom;7;;;70;1;;;;tta;40;tca;20;taa;100;tga;11
ata;100;aca;100;aaa;98;aga;100;;;;;;80;0;;;;ata;100;aca;48;aaa;22;aga;5
cta;100;cca;93;caa;100;cga;100;;L’estimation par gama7;;;;90;1;;;;cta;63;cca;34;caa;42;cga;100
gta;97;gca;7;gaa;9;gga;100;;est  62% au dessus;;;;100;6;;;;gta;36;gca;100;gaa;88;gga;43
ttg;99;tcg;100;tag;100;tgg;55;;des aas sans;;;;;0;;;;ttg;2;tcg;31;tag;100;tgg;8
atgj;100;acg;100;aag;100;agg;100;;;;;;;48;;;;atgj;38;acg;20;aag;16;agg;9
ctg;100;ccg;100;cag;100;cgg;92;;;;;;;;;;;ctg;16;ccg;8;cag;16;cgg;8
gtg;100;gcg;100;gag;100;ggg;100;;;;;;;;;;;gtg;100;gcg;100;gag;100;ggg;21
;;;;;;;;;;;;;;;;;;;;425;;656;;229;1310

alpha[modifier | modifier le wikicode]

rtb[modifier | modifier le wikicode]

rtb opérons[modifier | modifier le wikicode]

29.0%GC;31.12.19 Paris;16s  1 ;33 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rickettsia typhi str. B9991CWPP ;;;;;;;;;;;;
comp;7429..8469;;cds;;381;381;;;347;;UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase;*
comp;8851..8926;;ttc;;368;368;;;;;;*
;9295..10278;;cds;;;;;;328;;tRNA dihydrouridine synthase DusB;*
;;;;;;;;;;;;*
;14663..18055;;cds;;108;108;;;1131;;autotransporter outer membrane beta-barrel domain-containing protein;*
;18164..18238;;gaa;;1394;*1394;;;;;;*
comp;19633..20106;;cds;;;;;;158;;crossover junction endodeoxyribonuclease RuvC;*
;;;;;;;;;;;;*
comp;48065..48709;;cds;;278;278;;;215;;YihA family ribosome biogenesis GTP-binding protein;*
comp;48988..49064;;atgf;;110;110;;;;;;*
comp;49175..49411;;cds;;;;;;79;;50S ribosomal protein L31;*
;;;;;;;;;;;;*
comp;73627..73929;;cds;;17;17;;;101;;preprotein translocase subunit SecG;*
comp;73947..74021;;acc;;139;139;;;;;;*
comp;74161..75417;;cds;;;;;;419;;MFS transporter;*
;;;;;;;;;;;;*
;155064..157163;;cds;;143;143;;;700;;elongation factor G;*
;157307..157382;;tgg;;167;167;;;;;;*
;157550..157750;;cds;;;;;;67;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
;189197..189400;;cds;;889;*889;;;68;;DUF2674 domain-containing protein;*
comp;190290..190365;;acg;;142;142;;;;;;*
comp;190508..192814;;cds;;;;;;769;;outer membrane protein assembly factor BamA;*
;;;;;;;;;;;;*
;255010..255921;;cds;;732;*732;;;304;;methionyl-tRNA formyltransferase;*
;256654..259439;;23s;;206;;;;2786;;;*
;259646..259760;;5s;;173;173;;;115;;;*
comp;259934..261007;;cds;;;;;;358;;cell division protein ZapE;*
;;;;;;;;;;;;*
;291358..291843;;cds;;35;35;;;162;;30S ribosomal protein S9;*
;291879..291955;;atgj;;1364;*1364;;;;;;*
comp;293320..293805;;cds;;;;;;162;;RNA pyrophosphohydrolase;*
;;;;;;;;;;;;*
;335194..336996;;cds;;402;402;;;601;;elongation factor 4;*
;337399..337473;;aac;;633;*633;;;;;;*
comp;338107..338793;;cds;;;;;;229;;hp;*
;;;;;;;;;;;;*
comp;440466..440933;;cds;;496;496;;;156;;DUF2155 domain-containing protein;*
;441430..441504;;tgc;;31;31;;;;;;*
;441536..442456;;cds;;;;;;307;;site-specific tyrosine recombinase XerD;*
;;;;;;;;;;;;*
comp;469056..469781;;cds;;218;218;;;242;;3-deoxy-manno-octulosonate cytidylyltransferase;*
;470000..470075;;aaa;;15;;15;;;;;*
;470091..470167;;atc;;1922;*1922;;;;;;*
;472090..472662;;cds;;;;;;191;;GTP cyclohydrolase I FolE;*
;;;;;;;;;;;;*
comp;564534..565562;;cds;;1530;*1530;;;343;;type 2 isopentenyl-diphosphate Delta-isomerase;*
comp;567093..567180;;tcc;;218;218;;;;;;*
comp;567399..568145;;cds;;;;;;249;;NTP transferase domain-containing protein;*
;;;;;;;;;;;;*
;583250..584149;;cds;;1278;*1278;;;300;;hydroxymethylbilane synthase;*
comp;585428..585518;;tca;;58;58;;;;;;*
comp;585577..586569;;cds;;;;;;331;;tryptophan--tRNA ligase;*
;;;;;;;;;;;;*
;598723..599706;;cds;;26;26;;;328;;polyprenyl synthetase family protein;*
;599733..599809;;cgg;;60;;60;;;;;*
comp;599870..599944;;caa;;62;62;;;;;;*
comp;600007..601779;;cds;;;;;;591;;aminopeptidase P family protein;*
;;;;;;;;;;;;*
comp;644357..644745;;cds;;499;499;;;130;;p-ribosome-associated translation inhibitor RaiA;*
;645245..645321;;gac;@1;1051;;1051;;;;;*
comp;646373..646448;;gcc;;222;222;;;;;;*
comp;646671..647276;;cds;;;;;;202;;ATP-dependent Clp endopeptidase proteolytic subunit ClpP;*
;;;;;;;;;;;;*
comp;649389..650048;;cds;;452;452;;;220;;(d)CMP kinase;*
;650501..650577;;gtc;;1274;*1274;;;;;;*
comp;651852..652094;;cds;;;;;;81;;HU family DNA-binding protein;*
;;;;;;;;;;;;*
comp;696163..697398;;cds;;1535;*1535;;;412;;tyrosine--tRNA ligase;*
;698934..699010;;cgt;;1028;*1028;;;;;;*
;700039..705720;;cds;;;;;;1894;;alpha-2-macroglobulin family protein;*
;;;;;;;;;;;;*
comp;727560..728087;;cds;;1164;*1164;;;176;;copper chaperone Pcu(A)C;*
comp;729252..729326;;gca;;32;32;;;;;;*
comp;729359..729574;;cds;;;;;;72;;hp;*
;;;;;;;;;;;;*
;739215..740075;;cds;;181;181;;;287;;TIGR01459 family HAD-type hydrolase;*
;740257..740343;;ctc;;246;246;;;;;;*
;740590..741960;;cds;;1199;*1199;;;457;;magnesium transporter;*
;743160..743234;;ggc;;1090;*1090;;;;;;*
;744325..744753;;cds;;;;;;143;;preprotein translocase subunit YajC;*
;;;;;;;;;;;;*
comp;775944..777866;;cds;;2465;*2465;;;641;;hp;*
comp;780332..781831;;16s;;1854;*1854;;;1500;;;*
comp;783686..785485;;cds;;;;;;600;;PAS domain-containing sensor histidine kinase;*
;;;;;;;;;;;;*
comp;814590..814823;;cds;;349;349;;;78;;hp;*
comp;815173..815248;;gta;;68;68;;;;;;*
comp;815317..815589;;cds;;;;;;91;;30S ribosomal protein S20;*
;;;;;;;;;;;;*
comp;829300..830484;;cds;;82;82;;;395;;elongation factor Tu;*
comp;830567..830640;;gga;;95;;95;;;;;*
comp;830736..830821;;tac;;183;183;;;;;;*
;831005..831733;;cds;;;;;;243;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
;839841..839969;;cds;;145;145;;;43;;dimethyladenosine transferase;*
;840115..840200;;tta;;2009;*2009;;;;;;*
;842210..842446;;cds;;;;;;79;;hp;*
;;;;;;;;;;;;*
comp;876906..877589;;cds;;401;401;;;228;;7-cyano-7-deazaguanine synthase QueC;*
;877991..878067;;cac;;145;145;;;;;;*
;878213..879943;;cds;;;;;;577;;ATP-binding cassette domain-containing protein;*
;;;;;;;;;;;;*
;918938..919882;;cds;;951;*951;;;315;;ACP S-malonyltransferase;*
;920834..920925;;agc;;1945;*1945;;;;;;*
comp;922871..924049;;cds;;;;;;393;;acetyl-CoA C-acetyltransferase;*
;;;;;;;;;;;;*
comp;961209..962297;;cds;;41;41;;;363;;YjgP/YjgQ family permease;*
comp;962339..962415;;atgi;;390;390;;;;;;*
comp;962806..963273;;cds;;;;;;156;;peptidoglycan-associated lipoprotein Pal;*
;;;;;;;;;;;;*
;1023375..1023626;;cds;;1585;*1585;;;84;;BolA family transcriptional regulator;*
;1025212..1025288;;cca;;17;17;;;;;;*
;1025306..1025521;;cds;;;;;;72;;translation initiation factor IF-1;*
;;;;;;;;;;;;*
;1053321..1054139;;cds;;2191;*2191;;;273;;alpha/beta hydrolase;*
comp;1056331..1056407;;aga;;98;98;;;;;;*
;1056506..1056823;;cds;;;;;;106;;DUF167 domain-containing protein;*
;;;;;;;;;;;;*
comp;1098776..1099240;;cds;;40;40;;;155;;DNA polymerase III subunit chi;*
comp;1099281..1099365;;cta;;145;145;;;;;;*
comp;1099511..1100662;;cds;;;;;;384;;succinyl-diaminopimelate desuccinylase;*
;;;;;;;;;;;;*
comp;1102351..1102980;;cds;;475;475;;;210;;lipoyl(octanoyl) transferase LipB;*
comp;1103456..1103530;;aca;;130;130;;;;;;*
comp;1103661..1103996;;cds;;;;;;112;;30S ribosomal protein S16;*

rtb cumuls[modifier | modifier le wikicode]

rtb cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;;cdsa;gammes;cdsa 300
avec rRNA;opérons;2;1;;-;1;0;1;;100;11;30;0
;23s5s;1;20;1;;50;8;40;;200;13;60;1
;16s;1;40;;;100;5;80;;300;12;90;9
;16s23s;0;60;1;;150;9;120;;400;13;120;4
;max a;0;80;;;200;4;160;;500;3;150;2
;a doubles;0;100;1;;250;4;200;;600;3;180;7
;spéciaux;0;120;;;300;1;240;;700;3;210;3
;total aas;0;140;;;350;1;280;;800;1;240;4
sans ;opérons;29;160;;;400;3;320;;900;0;270;3
;1 aa;25;180;;;450;2;360;;1000;0;300;3
;max a;2;200;;;500;4;400;;1100;0;330;5
;a doubles;0;;1;;;21;;;;2;;20
;total aas;33;;4;0;;62;;0;;61;;61
total aas;;33;;;;21;1430;;;;;;
remarques;;1;;;;;491;;;;;;
avec jaune;;;moyenne;;;;612;;;;310;;
;;;variance;;;;665;;;;291;;
sans jaune;;;moyenne;57;;;193;;;;269;;176
;;;variance;40;;;148;;;;176;;86

rtb blocs[modifier | modifier le wikicode]

rtb distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;1;tgc;
atc;;acc;1;aac;1;agc;1;;atc;1;acc;;aac;;agc;
ctc;1;ccc;;cac;1;cgt;1;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;;gac;;ggc;1;;gtc;;gcc;1;gac;1;ggc;
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;;aga;1;;ata;;aca;;aaa;1;aga;
cta;1;cca;1;caa;;cga;;;cta;;cca;;caa;1;cga;
gta;1;gca;1;gaa;1;gga;;;gta;;gca;;gaa;;gga;1
ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
rtb;;25;;;;;25;;rtb;8;;;;;;8

rtb intercalaires entre cds[modifier | modifier le wikicode]

rtb;28.1.21 Paris;NCBI;7.12.2020;;;;;;;;;
rtb;intercalaires;total;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;frequence5;intercal;frequencez
;'''négatif;102;12.9;'''négatif ;-11;10;-50 à -1;'''1 112 957;-1;102;610;1
;'''zéro;5;0.6;;;;;'''intercals;0;5;620;2
;'''1 à 200;430;54.2;'''0 à 200;85;61;;'''224 467;5;42;630;1
;'''201 à 370;84;10.6;'''201 à 370;261;43;;'''20.2%;10;24;640;3
;'''371 à 600;52;6.6;'''371 à 600;481;63;;;15;24;650;2
;'''601 à max;120;15.1;'''601 à 1028;1173;515;;;20;16;660;3
;'''total 793;<201;67.7;'''total 793;282;445;-50 à 3216;;25;12;670;0
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul, %;intercal;fréquence;30;6;680;7
665700;3216;-1;102;-70;0;;0;5;35;7;690;0
1032528;3065;0;5;-60;0;;-1;°10;40;8;700;1
506416;2624;1;°10;-50;1;;-2;1;45;2;710;1
64385;2360;2;7;-40;1;;-3;0;50;8;720;2
801292;2313;3;8;-30;5;'''min à -1;-4;°33;55;5;730;2
272796;2262;4;°13;-20;12;102;-5;0;60;8;740;0
131965;2171;5;4;-10;21;12.9%;-6;0;65;10;750;1
763244;2078;6;5;0;67;;-7;2;70;12;760;1
101695;2071;7;3;10;66;;-8;°16;75;9;770;2
446016;1893;8;°7;20;40;;-9;0;80;12;780;2
905133;1870;9;°7;30;18;;-10;1;85;9;790;0
141270;1858;10;2;40;15;'''1 à 100;-11;°2;90;4;800;1
570117;1846;11;°6;50;10;243;-12;0;95;10;810;3
129767;1794;12;5;60;13;30.6%;-13;3;100;15;820;0
378376;1765;13;3;70;22;;-14;°7;105;11;830;4
232652;1743;14;5;80;21;;-15;0;110;12;840;0
871293;1715;15;5;90;13;;-16;1;115;10;850;1
998041;1656;16;°6;100;25;;-17;°7;120;10;860;1
359936;1637;17;1;110;23;;-18;0;125;13;870;0
1014216;1621;18;3;120;20;;-19;0;130;8;880;1
847537;1581;19;3;130;21;;-20;°2;135;16;890;1
338816;1539;20;3;140;26;;-21;0;140;10;900;1
808693;1532;21;2;150;17;;-22;1;145;10;910;2
950532;1524;22;2;160;17;'''1 à 200;-23;°3;150;7;920;1
969491;1524;23;1;170;21;430;-24;0;155;8;930;1
706435;1485;24;°4;180;16;54%;-25;1;160;9;940;1
536071;1468;25;3;190;15;;-26;°5;165;12;950;3
638208;1464;26;2;200;11;;-27;0;170;9;960;0
597131;1463;27;0;210;7;;;100;175;9;970;0
544938;1446;28;2;220;7;;reste;7;180;7;980;1
235220;1444;29;2;230;11;;total;107;185;8;990;0
90984;1401;30;0;240;8;;;;190;7;1000;1
693395;1374;31;0;250;9;;'''intercal;'''<u>fréquencef;195;6;1010;1
422301;1373;32;3;260;9;'''0 à 200;600;673;200;5;1020;1
678698;1370;33;3;270;6;435;650;9;205;3;1030;1
476675;1354;34;0;280;3;;700;11;210;4;1040;1
1079428;1335;35;1;290;6;;750;6;215;3;1050;2
270767;1318;36;1;300;1;;800;6;220;4;1060;2
687447;1302;37;2;310;3;;850;8;225;5;1070;1
49408;1282;38;0;320;3;;900;4;230;6;1080;1
247450;1266;39;2;330;2;;950;8;235;5;1090;0
398128;1260;40;3;340;2;;1000;2;240;3;1100;0
577310;1255;reste;547;350;3;;1050;6;245;6;1110;2
676898;1227;total;793;360;2;'''201 à 370;1100;4;250;3;1120;2
425653;1184;;;370;2;84;1150;7;255;5;1130;1
915284;1182;;;380;0;10.6%;1200;5;260;4;1140;0
;;;;390;1;;1250;1;265;4;1150;2
;;;;400;5;;1300;4;270;2;1160;0
;;;;410;4;;1350;3;275;1;1170;2
;;;;420;3;;1400;4;280;2;1180;1
'''adresse;'''intercaln;'''décalage;'''long;430;2;;1450;3;285;3;1190;2
384083;-50;comp;;440;2;;1500;4;290;3;1200;0
523034;-41;shift2;646;450;3;;1550;4;295;1;reste;44
362986;-38;shift2;850;460;2;;1600;1;300;0;total;793
864784;-38;shift2;2407;470;1;;1650;2;305;3;;
628502;-35;shift2;571;480;2;;1700;1;310;0;;
1068153;-35;comp;;490;3;;1750;2;315;1;;
1110540;-32;shift2;997;500;3;;1800;2;320;2;;
511489;-26;;;510;4;'''371 à 600;1850;1;325;2;;
661241;-26;;;520;3;52;1900;3;330;0;;
710083;-26;;;530;3;6.6%;1950;0;335;1;;
899806;-26;;;540;0;;2000;0;340;1;;
1089393;-26;;;550;0;;2050;0;345;2;;
417665;-25;;;560;3;;2100;2;350;1;;
276966;-23;;;570;3;;2150;0;355;1;;
480829;-23;;;580;1;'''601 à max;2200;1;360;1;;
981350;-23;;;590;1;120;;114;365;1;;
110015;-22;;;600;3;15.1%;;;370;1;;
415433;-20;;;reste;120;;reste;6;reste;172;;
748256;-20;;;total;793;;total;793;total;793;;

rtb autres intercalaires[modifier | modifier le wikicode]

rtb;les autres intercalaires;;adresses1;;;rtb;les autres intercalaires;;adresses2;;;rtb;les autres intercalaires;;adresses3;
deb;     °CDS;7429;381;comp;;deb;     °CDS;564534;1530;comp;;deb;     °CDS;829300;82;comp
;     &tRNA;8851;368;comp;;;     &tRNA;567093;218;comp;;;     &tRNA;830567;95;comp
fin;     °CDS;9295;;;;fin;     °CDS;567399;;comp;;;     &tRNA;830736;183;comp
deb;     °CDS;14663;108;;;deb;     °CDS;583250;1278;;;fin;     °CDS;831005;;
;     &tRNA;18164;1394;;;;     &tRNA;585428;58;comp;;deb;     °CDS;839520;382;
fin;     °CDS;19633;;comp;;fin;     °CDS;585577;;comp;;;     &tRNA;840115;2009;
deb;     °CDS;48065;278;comp;;deb;     °CDS;598723;26;;;fin;     °CDS;842210;;
;     &tRNA;48988;110;comp;;;     &tRNA;599733;60;;;deb;     °CDS;876906;401;comp
fin;     °CDS;49175;;comp;;;     &tRNA;599870;62;comp;;;     &tRNA;877991;145;
deb;     °CDS;73627;17;comp;;fin;     °CDS;600007;;comp;;fin;     °CDS;878213;;
;     &tRNA;73947;139;comp;;deb;     °CDS;608541;176;comp;;deb;     °CDS;911079;179;comp
fin;     °CDS;74161;;comp;;;     ncRNA;609386;248;comp;;;     tmRNA;911738;74;comp
deb;     °CDS;155064;143;;;fin;     °CDS;610018;;;;fin;     °CDS;912362;;
;     &tRNA;157307;167;;;deb;     °CDS;644395;499;comp;;deb;     °CDS;918938;951;
fin;     °CDS;157550;;;;;     &tRNA;645245;1051;;;;     &tRNA;920834;1945;
deb;     °CDS;189738;411;;;;     &tRNA;646373;222;comp;;fin;     °CDS;922871;;comp
;     &tRNA;190290;142;comp;;fin;     °CDS;646671;;comp;;deb;     °CDS;941489;156;comp
fin;     °CDS;190508;;comp;;deb;     °CDS;649389;452;comp;;;     ncRNA;942887;9;comp
deb;     °CDS;255010;736;;;;     &tRNA;650501;1274;;;fin;     °CDS;943055;;comp
23s;     $rRNA;256658;228;;;fin;     °CDS;651852;;comp;;deb;     °CDS;961209;41;comp
5s;     $rRNA;259646;173;;;deb;     °CDS;696163;1535;comp;;;     &tRNA;962339;390;comp
fin;     °CDS;259934;;comp;;;     &tRNA;698934;1028;;;fin;     °CDS;962806;;comp
deb;     °CDS;291358;35;;;fin;     °CDS;700039;;;;deb;     °CDS;1023375;1585;
;     &tRNA;291879;1364;;;deb;     °CDS;727560;1164;comp;;;     &tRNA;1025212;17;
fin;     °CDS;293320;;;;;     &tRNA;729252;32;comp;;fin;     °CDS;1025306;;
deb;     °CDS;335194;402;;;fin;     °CDS;729359;;comp;;deb;     °CDS;1053321;2191;
;     &tRNA;337399;633;;;deb;     °CDS;739215;181;;;;     &tRNA;1056331;98;comp
fin;     °CDS;338107;;comp;;;     &tRNA;740257;246;;;fin;     °CDS;1056506;;
deb;     °CDS;440466;496;comp;;deb;     °CDS;740590;1199;;;deb;     °CDS;1090984;14;
;     &tRNA;441430;31;;;;     &tRNA;743160;1090;;;;     ncRNA;1091640;152;
fin;     °CDS;441536;;;;fin;     °CDS;744325;;;;fin;     °CDS;1091886;;
deb;     °CDS;469056;218;comp;;deb;     °CDS;775944;2466;comp;;deb;     °CDS;1098776;40;comp
;     &tRNA;470000;15;;;16s;     $rRNA;780333;1854;comp;;;     &tRNA;1099281;145;comp
;     &tRNA;470091;1922;;;fin;     °CDS;783686;;comp;;fin;     °CDS;1099511;;comp
fin;     °CDS;472090;;;;deb;     °CDS;814590;349;comp;;deb;     °CDS;1102351;475;comp
;;;;;;;     &tRNA;815173;68;comp;;;     &tRNA;1103456;130;comp
;;;;;;fin;     °CDS;815317;;comp;;fin;     °CDS;1103661;;comp

rtb intercalaires tRNA[modifier | modifier le wikicode]

;entre aas;;cds aa deb;;cds aa fin ;;cds aa deb;cds aa fin ;;
;;;;;;;;;;
;15;;381;comp’;368;;17;31;'''deb;
comp’;60;;108;comp’;1394;;26;32;<201;9
comp’;1051;;278;;110;;35;58;total;19
;95;;17;;139;;40;62;taux;47%
;;;143;;167;;82;68;;
;;comp’;411;;142;;108;110;'''fin;
;;;;;;;143;130;<201;12
;;;35;;1364;;176;139;total;21
;;;402;comp’;633;;181;142;taux;57%
;;comp’;496;;31;;278;145;;
;;comp’;218;;1922;;349;145;'''total;
;;;1530;;218;;381;167;<201;21
;;comp’;1278;;58;;382;218;total;40
;;;26;;62;;402;222;taux;53%
;;;176;;248;;475;246;;
;;comp’;499;;222;;951;248;;
;;comp’;452;comp’;1274;;1164;1028;;
;;comp’;1535;;1028;;1199;1090;;
;;;1164;;32;;1530;1364;;
;;;181;;246;;'''-;1922;;
;;;1199;;1090;;'''-;2009;'''comp’;'''cumuls
;;;349;;68;;218;98;'''deb;9
;;;82;comp’;183;;401;183;<201;0
;;;382;;2009;;411;368;'''fin;7
;;comp’;401;;145;;452;633;<201;2
;;;951;comp’;1945;;496;1274;;
;;comp’;2191;comp’;98;;499;1394;'''total;
;;;40;;145;;1278;1945;<201;2
;;;475;;130;;1535;'''-;total;16
;;;;;;;2191;'''-;taux;13%
;;;;;;;;;;
;;;;;;;;;;
;;;deb;fin;total;;;;;
;;<201;9;14;23;;;;;
;;total;28;28;56;;;;;
;;taux;32%;50%;41%;;;;;

rpl[modifier | modifier le wikicode]

rpl opérons[modifier | modifier le wikicode]

29.0%GC;30.12.19 Paris;16s  1 ;33 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rickettsia prowazekii str. Breinl ;;;;;;;;;;;;
comp;31462..31892;;cds;;263;263;;;144;;p-preprotein translocase subunit YajC;*
comp;32156..32181;;rpr;;870;870;;;26;;tandem;*
comp;33052..33126;;ggc;;1253;1253;;;;;;*
comp;34380..35750;;cds;;256;256;;;;;magnesium transporter;*
comp;36007..36093;;ctc;;190;190;;;;;;*
comp;36284..37144;;cds;;;;;;287;;TIGR01459 family HAD-type hydrolase;*
;;;;;;;;;;;;*
;46825..47040;;cds;;31;31;;;72;;hp;*
;47072..47146;;gca;;1964;1964;;;;;;*
;49111..49650;;cds;;;;;;180;;copper chaperone Pcu(A)C;*
;;;;;;;;;;;;*
comp;71150..76816;;cds;;933;933;;;1889;;alpha-2-macroglobulin family protein;*
comp;77750..77826;;cgt;;1179;1179;;;;;;*
;79006..80241;;cds;;;;;;412;;tyrosine--tRNA ligase;*
;;;;;;;;;;;;*
;121704..121946;;cds;;984;984;;;81;;HU family DNA-binding protein;*
comp;122931..123007;;gtc;;446;446;;;;;;*
;123454..124113;;cds;;;;;;220;;(d)CMP kinase;*
;;;;;;;;;;;;*
;126222..126827;;cds;;236;236;;;202;;ATP-dependent Clp endopeptidase proteolytic subunit ClpP;*
;127064..127139;;gcc;@1;830;;830;;;;;*
comp;127970..128046;;gac;;365;365;;;;;;*
;128412..128843;;cds;;;;;;144;;ribosome-associated translation inhibitor RaiA;*
;;;;;;;;;;;;*
;171237..173012;;cds;;50;50;;;592;;aminopeptidase P family protein;*
;173063..173137;;caa;;49;;49;;;;;*
comp;173187..173263;;cgg;;18;18;;;;;;*
comp;173282..174265;;cds;;;;;;328;;polyprenyl synthetase family protein;*
;;;;;;;;;;;;*
;186344..187336;;cds;;58;58;;;331;;tryptophan--tRNA ligase;*
;187395..187484;;tca;;354;354;;;;;;*
comp;187839..188738;;cds;;;;;;300;;hydroxymethylbilane synthase;*
;;;;;;;;;;;;*
;203097..203846;;cds;;219;219;;;250;;bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase;*
;204066..204153;;tcc;;1457;1457;;;;;;*
;205611..206639;;cds;;;;;;343;;type 2 isopentenyl-diphosphate Delta-isomerase;*
;;;;;;;;;;;;*
comp;299321..300853;;cds;;419;419;;;511;;hp;*
comp;301273..301349;;atc;;15;;15;;;;;*
comp;301365..301440;;aaa;;219;219;;;;;;*
;301660..302400;;cds;;;;;;247;;3-deoxy-manno-octulosonate cytidylyltransferase;*
;;;;;;;;;;;;*
comp;328700..329635;;cds;;22;22;;;312;;site-specific tyrosine recombinase XerD;*
comp;329658..329732;;tgc;;499;499;;;;;;*
;330232..330699;;cds;;;;;;156;;DUF2155 domain-containing protein;*
;;;;;;;;;;;;*
;429121..429807;;cds;;723;723;;;229;;hp;*
comp;430531..430605;;aac;;359;359;;;;;;*
comp;430965..432767;;cds;;;;;;601;;elongation factor 4;*
;;;;;;;;;;;;*
;473867..474352;;cds;;928;928;;;162;;RNA pyrophosphohydrolase;*
comp;475281..475357;;atgj;;40;40;;;;;;*
comp;475398..475883;;cds;;;;;;162;;30S ribosomal protein S9;*
;;;;;;;;;;;;*
;506934..508007;;cds;;183;183;;;358;;cell division protein ZapE;*
comp;508191..508305;;5s;;240;;;;115;;;*
comp;508546..511330;;23s;;716;716;;;2785;;;*
comp;512047..512958;;cds;;;;;;304;;methionyl-tRNA formyltransferase;*
;;;;;;;;;;;;*
;577419..579725;;cds;;138;138;;;769;;outer membrane protein assembly factor BamA;*
;579864..579939;;acg;;1026;1026;;;;;;*
comp;580966..581169;;cds;;;;;;68;;DUF2674 domain-containing protein;*
;;;;;;;;;;;;*
comp;612439..612639;;cds;;143;143;;;67;;preprotein translocase subunit SecE;*
comp;612783..612858;;tgg;;143;143;;;;;;*
comp;613002..615101;;cds;;;;;;700;;elongation factor G;*
;;;;;;;;;;;;*
comp;656226..656870;;cds;;296;296;;;215;;YihA family ribosome biogenesis GTP-binding protein;*
comp;657167..657243;;atgf;;119;119;;;;;;*
comp;657363..657599;;cds;;;;;;79;;50S ribosomal protein L31;*
;;;;;;;;;;;;*
comp;678911..679213;;cds;;19;19;;;101;;preprotein translocase subunit SecG;*
comp;679233..679307;;acc;;159;159;;;;;;*
comp;679467..680723;;cds;;;;;;419;;MFS transporter;*
;;;;;;;;;;;;*
comp;746326..746529;;cds;;1664;1664;;;68;;hp;*
comp;748194..748268;;gaa;;109;109;;;;;;*
comp;748378..749421;;cds;;;;;;348;;autotransporter outer membrane beta-barrel domain-containing protein;*
;;;;;;;;;;;;*
comp;756703..757686;;cds;;363;363;;;328;;tRNA dihydrouridine synthase DusB;*
;758050..758125;;ttc;;564;564;;;;;;*
;758690..759730;;cds;;;;;;347;;UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase;*
;;;;;;;;;;;;*
;776202..776537;;cds;;154;154;;;112;;30S ribosomal protein S16;*
;776692..776766;;aca;;467;467;;;;;;*
;777234..777863;;cds;;;;;;210;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;779197..780348;;cds;;140;140;;;384;;succinyl-diaminopimelate desuccinylase;*
;780489..780573;;cta;;37;37;;;;;;*
;780611..781075;;cds;;;;;;155;;DNA polymerase III subunit chi;*
;;;;;;;;;;;;*
comp;823242..823559;;cds;;98;98;;;106;;DUF167 domain-containing protein;*
;823658..823734;;aga;;1364;1364;;;;;;*
comp;825099..825230;;cds;;;;;;44;;hp;*
;;;;;;;;;;;;*
comp;854241..854456;;cds;;17;17;;;72;;translation initiation factor IF-1;*
comp;854474..854550;;cca;;1573;1573;;;;;;*
comp;856124..856357;;cds;;;;;;78;;BolA family transcriptional regulator;*
;;;;;;;;;;;;*
;915034..915501;;cds;;391;391;;;156;;peptidoglycan-associated lipoprotein Pal;*
;915893..915969;;atgi;;41;41;;;;;;*
;916011..917099;;cds;;;;;;363;;YjgP/YjgQ family permease;*
;;;;;;;;;;;;*
;953564..954742;;cds;;696;696;;;393;;acetyl-CoA C-acetyltransferase;*
comp;955439..955530;;agc;;898;898;;;;;;*
comp;956429..957373;;cds;;;;;;315;;ACP S-malonyltransferase;*
;;;;;;;;;;;;*
comp;1009435..1011165;;cds;;142;142;;;577;;ATP-binding cassette domain-containing protein;*
comp;1011308..1011384;;cac;;346;346;;;;;;*
;1011731..1012414;;cds;;;;;;228;;7-cyano-7-deazaguanine synthase QueC;*
;;;;;;;;;;;;*
comp;1045414..1045656;;cds;;2381;2381;;;81;;hp;*
comp;1048038..1048123;;tta;;135;135;;;;;;*
comp;1048259..1048387;;cds;;;;;;43;;hp;*
;;;;;;;;;;;;*
comp;1056245..1056973;;cds;;188;188;;;243;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;1057162..1057247;;tac;;105;;105;;;;;*
;1057353..1057426;;gga;;82;82;;;;;;*
;1057509..1058693;;cds;;;;;;395;;elongation factor Tu;*
;;;;;;;;;;;;*
;1072391..1072663;;cds;;62;62;;;91;;30S ribosomal protein S20;*
;1072726..1072801;;gta;;1181;1181;;;;;;*
comp;1073983..1074648;;cds;;;;;;222;;hp;*
;;;;;;;;;;;;*
;1102136..1103935;;cds;;1458;1462;;;600;;PAS domain-containing sensor histidine kinase;*
;1105394..1106893;;16s;;1462;1462;;;1500;;;*
;1108356..1109301,1..184;;cds;;;;;;377;;P-hp;*

rpl cumuls[modifier | modifier le wikicode]

rpl cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;2;1;;-;1;0;1;;100;12;30;0
;23s5s;1;20;1;;50;9;40;;200;11;60;2
;16s;1;40;;;100;4;80;;300;12;90;9
;16s23s;0;60;1;;150;8;120;;400;15;120;4
;max a;0;80;;;200;5;160;;500;2;150;2
;a doubles;0;100;;;250;3;200;;600;4;180;6
;spéciaux;0;120;1;;300;3;240;;700;2;210;2
;total aas;0;140;;;350;1;280;;800;1;240;5
sans ;opérons;29;160;;;400;5;320;;900;0;270;3
;1 aa;25;180;;;450;2;360;;1000;0;300;2
;max a;2;200;;;500;2;400;;1100;0;330;5
;a doubles;0;;1;;;21;;;;1;;20
;total aas;33;;4;0;;63;;0;;60;;60
total aas;;33;;;;21;1204;;;;;;
remarques;;1;;;;;453;;;;;;
avec jaune;;;moyenne;;;;528;;;;293;;
;;;variance;;;;558;;;;271;;
sans jaune;;;moyenne;56;;;191;;;;243;;172
;;;variance;45;;;140;;;;145;;89

rpl blocs[modifier | modifier le wikicode]

rpl distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;1;tgc;
atc;;acc;1;aac;1;agc;1;;atc;1;acc;;aac;;agc;
ctc;1;ccc;;cac;1;cgt;1;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;;gac;;ggc;1;;gtc;;gcc;1;gac;1;ggc;
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;;aga;1;;ata;;aca;;aaa;1;aga;
cta;1;cca;1;caa;;cga;;;cta;;cca;;caa;1;cga;
gta;1;gca;1;gaa;1;gga;;;gta;;gca;;gaa;;gga;1
ttg;;tcg;;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
rpl;;25;;;;;25;;rpl;8;;;;;;8

rpm[modifier | modifier le wikicode]

rpm opérons[modifier | modifier le wikicode]

;20   m23s;17  m16s;;;;;;;;;;
;;9 m16s seuls;;;;;;;;;;
http://gtrnadb.ucsc.edu/genomes/bacteria/Rhod_phot_DSM_122/rhodPhot_DSM122-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_017059.1;rpm;;genome;24.12.19;;;;;;;;
64.7%GC;26.12.19 Paris;16s  7;95 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rhodospirillum photometricum DSM 122;;;;;;;;;;;;
comp;3322..4194;;cds;;30;30;;;291;;LysM peptidoglycan-binding domain-containing protein;*
comp;4225..4821;;23s°;@1;196;;;;595;;;*
comp;5018..5093;;gca;;182;;;;;;;*
comp;5276..5684;;16s°;;38;38;;;407;;;*
;5723..6664;;cds;;;;;;314;;SEL1-like repeat protein;*
;;;;;;;;;;;;*
comp <;12458..13198;;cds;;242;242;;;247;;p-transposase;*
comp;13441..13555;;5s;@2;72;;;;113;;;*
comp;13628..13880;;23s°;;-7;*-7;;;251;;;*
comp;13874..15127;;cds;;;;;;418;;hp;*
;;;;;;;;;;;;*
;21325..22362;;cds;;586;*586;;;346;;hp;*
;22949..23237;;16s°;;85;85;;;287;;;*
comp;23323..23490;;cds;;;;;;56;;hp;*
;;;;;;;;;;;;*
comp;24015..24287;;cds;;250;250;;;91;;TraYdomain-containingprotein;*
comp;24538..24652;;5s;;71;;;;113;;;*
comp;24724..27490;;23s;;212;;;;2765;;;*
comp;27703..27779;;atc;;112;;;;;;;*
comp;27892..28378;;16s°;;18;18;;;485;;;*
<>;28397..29119;;cds;;;;;;241;;p-EscV/YscV/HrcVfamilytypeIIIsecretionsystemexportapparatusprotein;*
;;;;;;;;;;;;*
comp;32782..33759;;cds;;190;190;;;326;;glycosyltransferase;*
;33950..34357;;16s°;;112;;;;406;;;*
;34470..34546;;atc;;216;;;;;;;*
;34763..35591;;23s°;;44;;;;827;;;*
comp;35636..35750;;5s;;72;;;;113;;;*
comp;35823..38589;;23s;;215;;;;2765;;;*
comp;38805..38881;;atc;;112;;;;;;;*
comp;38994..40502;;16s;;260;;;;1507;;;*
comp;40763..42629;;23s°;;-15;;;;1865;;;*
;42615..42903;;16s°;;112;;;;287;;;*
;43016..43092;;atc;;213;;;;;;;*
;43306..44132;;23s°;;-1;;;;825;;;*
comp;44132..44835;;23s°;;-5;*-5;;;702;;;*
;44831..45121;;cds;;;;;;97;;hp;*
;;;;;;;;;;;;*
<;45496..45768;;cds;;553;*553;;;91;;p-glycosyl transferase family 1;*
;46322..47040;;16s°;;0;*0;;;717;;;*
comp;47041..47433;;cds;;;;;;131;;winged helix-turn-helix domain-containing protein;*
;;;;;;;;;;;;*
comp;49761..51017;;cds;;128;128;;;419;;glycosyltransferase;*
comp;51146..51221;;23s°;;214;;;;74;;;*
comp;51436..51512;;atc;;112;;;;;;;*
comp;51625..52017;;16s°;;-7;;;;391;;;*
;52011..52881;;23s°;;106;106;;;869;;;*
;52988..53464;;cds;;-37;*-37;;;159;;hp;*
>;53428..53694;;cds;;86;86;;;89;;p-glycosyltransferase;*
comp;53781..54709;;23s°;;26;;;;927;;;*
;54736..54898;;16s°;;112;;;;161;;;*
;55011..55087;;atc;;216;;;;;;;*
;55304..55741;;23s°;;438;*438;;;436;;;*
;56180..56440;;cds;;;;;;87;;hp;*
;;;;;;;;;;;;*
comp;82891..83088;;cds;;116;116;;;66;;preprotein translocase subunit SecE;*
comp;83205..83280;;tgg;;199;199;;;;;;*
>comp;83480..84178;;cds;;;;;;233;;p-elongation factor Tu;*
;;;;;;;;;;;;*
;417242..417412;;cds;;142;142;;;57;;tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase;*
;417555..417631;;atgj;+;24;;24;;;;;*
;417656..417732;;atgj;2 atgj;38;38;;;;;;*
comp;417771..418796;;cds;;;;;;342;;tRNA epoxyqueuosine(34) reductase QueG;*
;;;;;;;;;;;;*
;434306..435142;;cds;;512;*512;;;279;;CDP-diacylglycerol--serine O-phosphatidyltransferase;*
;435655..435842;;16s°;;-6;;;;186;;;*
;435837..436075;;23s°;;72;;;;237;;;*
;436148..436262;;5s;;51;;;;113;;;*
;436314..436390;;atgf;;196;196;;;;;;*
;436587..436883;;cds;;;;;;99;;hp;*
;;;;;;;;;;;;*
comp;467261..468370;;cds;;167;167;;;370;;3-isopropylmalate dehydrogenase;*
;468538..468667;;23s°;;72;;;;128;;;*
;468740..468854;;5s;;51;;;;113;;;*
;468906..468982;;atgf;;125;125;;;;;;*
;469108..469863;;cds;;;;;;252;;SAM-dependent chlorinase/fluorinase;*
;;;;;;;;;;;;*
comp;534521..536161;;cds;;367;367;;;547;;glucose-6-phosphate isomerase;*
;536529..536603;;acg;;92;92;;;;;;*
comp;536696..537778;;cds;;;;;;361;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
comp;658467..658931;;cds;;110;110;;;155;;GNAT family N-acetyltransferase;*
comp;659042..659116;;gtc;;155;155;;;;;;*
;659272..660159;;cds;;106;106;;;296;;N-formylglutamate amidohydrolase;*
;660266..660340;;gtc;;648;*648;;;;;;*
comp;660989..661800;;cds;;;;;;271;;p-N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;684188..685141;;cds;;323;323;;;318;;cation transporter;*
comp;685465..685539;;gtg;+;25;;25;;;;;*
comp;685565..685639;;gtg;2 gtg;195;195;;;;;;*
;685835..686251;;cds;;;;;;139;;NUDIX hydrolase;*
;;;;;;;;;;;;*
comp;691078..691773;;cds;;4;4;;;232;;ComF family protein;*
;691778..691897;;23s°;;72;;;;118;;;*
;691970..692084;;5s;;114;114;;;113;;;*
comp;692199..694505;;cds;;;;;;769;;VWA domain-containing protein;*
;;;;;;;;;;;;*
;750262..751398;;cds;;161;161;;;379;;[FeFe] hydrogenase H-cluster radical SAM maturase HydE;*
comp;751560..751674;;5s;;72;;;;113;;;*
comp;751747..752005;;23s°;;597;*597;;;257;;;*
;752603..752814;;rpr;@4;388;*388;;;21;;CRISPR;*
;753203..753760;;cds;;;;;;186;;hp;*
;;;;;;;;;;;;*
comp;839981..840214;;cds;;4;4;;;78;;hp;*
comp;840219..840478;;16s°;;568;*568;;;258;;;*
comp;841047..844388;;cds;;;;;;1114;;response regulator;*
;;;;;;;;;;;;*
;874585..875391;;cds;;88;88;;;269;;phosphoadenylyl-sulfate reductase;*
;875480..875556;;cac;;81;81;;;;;;*
;875638..876117;;cds;;;;;;160;;CreA family protein;*
;;;;;;;;;;;;*
;885688..886299;;cds;;176;176;;;204;;LysE family translocator;*
;886476..886552;;ccc;;144;144;;;;;;*
comp;886697..887233;;cds;;;;;;179;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;932708..934243;;cds;;93;93;;;512;;Fic family protein;*
comp;934337..934413;;cgt;+;35;;35;;;;;*
comp;934449..934525;;cgt;3 cgt;44;;44;;;;;*
comp;934570..934646;;cgt;;449;*449;;;;;;*
;935096..936175;;cds;;;;;;360;;hp;*
;;;;;;;;;;;;*
comp;978995..979396;;cds;;138;138;;;134;;MFS transporter;*
comp;979535..979609;;ggc;+;23;;23;;;;;*
comp;979633..979707;;ggc;4 ggc;45;;45;;;;;*
comp;979753..979827;;ggc;;29;;29;;;;;*
comp;979857..979931;;ggc;;206;206;;;;;;*
;980138..981679;;cds;;;;;;514;;murein biosynthesis integral membrane protein MurJ;*
;;;;;;;;;;;;*
;997575..997898;;cds;;95;95;;;108;;DUF1476 domain-containing protein;*
comp;997994..998067;;cag;+;54;;54;;;;;*
comp;998122..998195;;cag;2 cag;168;168;;;;;;*
;998364..999509;;cds;;;;;;382;;Ppx/GppA family phosphatase;*
;;;;;;;;;;;;*
;1050081..1051028;;cds;;60;60;;;316;;NnrS family protein;*
comp;1051089..1051163;;acc;+;16;;16;;;;;*
comp;1051180..1051254;;acc;3 acc;18;;18;;;;;*
comp;1051273..1051347;;acc;;170;170;;;;;;*
comp;1051518..1053305;;cds;;;;;;596;;EAL domain-containing protein;*
;;;;;;;;;;;;*
;1197836..1199341;;cds;;197;197;;;502;;aldehyde dehydrogenase;*
;1199539..1199623;;cta;;126;126;;;;;;*
;1199750..1201090;;cds;;;;;;447;;trigger factor;*
;;;;;;;;;;;;*
;1206196..1206501;;cds;;93;93;;;102;;HU family DNA-binding protein;*
;1206595..1206670;;gta;;50;50;;;;;;*
;1206721..1207092;;cds;;;;;;124;;hp;*
;;;;;;;;;;;;*
;1213113..1214459;;cds;;210;210;;;449;;acetyl-CoA carboxylase biotin carboxylase subunit;*
comp;1214670..1214874;;16s°;;600;*600;;;203;;;*
comp;1215475..1216716;;cds;;;;;;414;;polyphosphate kinase;*
;;;;;;;;;;;;*
comp;1349719..1350132;;cds;;109;109;;;138;;NAD(P) transhydrogenase subunit alpha;*
comp;1350242..1350608;;23s°;;212;;;;365;;;*
comp;1350821..1350897;;atc;;115;;;;;;;*
comp;1351013..1351438;;16s°;;23;23;;;424;;;*
< comp;1351462..1352160;;cds;;;;;;233;;p-tetratricopeptide repeat protein;*
;;;;;;;;;;;;*
;1359745..1360302;;cds;;176;176;;;186;;hp;*
;1360479..1360555;;gac;+;37;;37;;;;;*
;1360593..1360669;;gac;2 gac;274;274;;;;;;*
;1360944..1361204;;cds;;;;;;87;;hp;*
;;;;;;;;;;;;*
;1416615..1417769;;cds;;214;214;;;385;;glycosyltransferase family 61 protein;*
;1417984..1418074;;tcc;;154;154;;;;;;*
comp;1418229..1419095;;cds;;;;;;289;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
comp;1472421..1473403;;cds;;250;250;;;328;;biotin synthase BioB;*
comp;1473654..1473740;;ttg;;77;77;;;;;;*
comp;1473818..1474678;;cds;;;;;;287;;homocysteine S-methyltransferase family protein;*
;;;;;;;;;;;;*
comp;1735298..1736380;;cds;;209;209;;;361;;DUF262 domain-containing protein;*
;1736590..1736859;;23s°;;72;;;;268;;;*
;1736932..1737046;;5s;;52;;;;113;;;*
;1737099..1737175;;atgf;;93;93;;;;;;*
comp;1737269..1737694;;cds;;;;;;142;;type II toxin-antitoxin system VapC family toxin;*
;;;;;;;;;;;;*
comp;1812365..1813924;;cds;;894;*894;;;520;;peptidoglycan DD-metalloendopeptidase family protein;*
;1814819..1815040;;16s°;;-7;*-7;;;222;;;*
<comp;1815034..1815837;;cds;;80;80;;;268;;p-elongation factor Tu;*
comp;1815918..1815991;;gga;;34;;34;;;;;*
comp;1816026..1816111;;tac;;144;144;;;;;;*
;1816256..1817143;;cds;;;;;;296;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
comp;1833109..1833603;;cds;;83;83;;;165;;MBL fold metallo-hydrolase;*
comp;1833687..1833762;;aag;+;24;;24;;;;;*
comp;1833787..1833862;;aag;2 aag;198;198;;;;;;*
comp;1834061..1835224;;cds;;;;;;388;;rod shape-determining protein RodA;*
;;;;;;;;;;;;*
>;1941413..1943059;;cds;;-30;*-30;;;549;;p-recombinase family protein;*
comp;1943030..1943121;;agc;;160;160;;;;;;*
comp;1943282..1944133;;cds;;;;;;284;;FAD-dependent thymidylate synthase;*
;;;;;;;;;;;;*
comp;2087696..2090938;;cds;;705;*705;;;1081;;PAS domain-containing protein;*
;2091644..2091826;;16s°;;7;7;;;181;;;*
;2091834..2092247;;cds;;;;;;138;;hp;*
;;;;;;;;;;;;*
comp;2095044..2095490;;cds;;48;48;;;149;;hp;*
comp;2095539..2095733;;16s°;;614;*614;;;193;;;*
comp;2096348..2097337;;cds;;;;;;330;;trypsin-like serine protease;*
;;;;;;;;;;;;*
comp;2113248..2114603;;cds;;219;219;;;452;;hp;*
comp;2114823..2114899;;aga;;55;55;;;;;;*
comp;2114955..2115251;;cds;;71;71;;;99;;ETC complex I subunit;*
comp;2115323..2115399;;cca;;261;261;;;;;;*
comp;2115661..2115960;;cds;;;;;;100;;hp;*
;;;;;;;;;;;;*
comp;2144042..2146288;;cds;;308;308;;;749;;HAMP domain-containing protein;*
;2146597..2147256;;23s°;;72;;;;658;;;*
;2147329..2147443;;5s;;52;;;;113;;;*
;2147496..2147572;;atgf;;645;*645;;;;;;*
comp;2148218..2148664;;cds;;;;;;149;;hp;*
;;;;;;;;;;;;*
;2268003..2268461;;cds;;87;87;;;153;;23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH;*
comp;2268549..2268625;;ccg;+;165;;*165;;;;;*
comp;2268791..2268867;;ccg;2 ccg;56;56;;;;;;*
comp;2268924..2269910;;cds;;;;;;329;;farnesyltranstransferase;*
;;;;;;;;;;;;*
comp;2321621..2322145;;cds;;332;332;;;175;;hp;*
;2322478..2322554;;ccc;;225;225;;;;;;*
;2322780..2322974;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;2393295..2396009;;cds;@3;1003;*1003;;;905;;CRISPR-associated helicase/endonuclease Cas3;*
;2397013..2397919;;16s°;;2;2;;;905;;;*
;2397922..2400888;;cds;;;;;;989;;hp;*
;;;;;;;;;;;;*
comp;2517845..2520559;;cds;;229;229;;;905;;phosphoenolpyruvate carboxylase;*
comp;2520789..2520903;;5s;;72;;;;113;;;*
comp;2520976..2521339;;23s°;;189;189;;;362;;;*
comp;2521529..2522152;;cds;;;;;;208;;3-isopropylmalate dehydratase small subunit;*
;;;;;;;;;;;;*
comp;2596508..2596738;;cds;;989;989;;;77;;motility twitching protein PilT;*
comp;2597728..2597815;;tca;;194;194;;;;;;*
;2598010..2599204;;cds;;;;;;398;;hp;*
;;;;;;;;;;;;*
comp;2621435..2622058;;cds;;106;106;;;208;;helix-turn-helix transcriptional regulator;*
comp;2622165..2622251;;ctc;;202;202;;;;;;*
;2622454..2623107;;cds;;;;;;218;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;2631201..2631554;;cds;;192;192;;;118;;hp;*
;2631747..2631822;;gcc;+;70;;70;;;;;*
;2631893..2631968;;gcc;4 gcc;69;;69;;;;;*
;2632038..2632113;;gcc;;57;;57;;;;;*
;2632171..2632246;;gcc;;166;166;;;;;;*
<;2632413..2632965;;cds;;-41;*-41;;;184;;p-IS256 family transposase;*
;2632925..2633473;;cds;;30;30;;;183;;hp;*
comp;2633504..2633579;;aca;;93;93;;;;;;*
comp;2633673..2634200;;cds;;271;271;;;176;;N-acetyltransferase;*
comp;2634472..2634561;;tcg;;155;155;;;;;;*
;2634717..2635742;;cds;;;;;;342;;hp;*
;;;;;;;;;;;;*
comp;2655872..2656489;;cds;;182;182;;;206;;YitT family protein;*
comp;2656672..2656747;;gag;;141;141;;;;;;*
comp;2656889..2657674;;cds;;;;;;262;;MetQ/NlpA family ABC transporter substrate-binding protein;*
;;;;;;;;;;;;*
;2758160..2758312;;cds;;110;110;;;51;;light-harvesting protein;*
comp;2758423..2758509;;tta;;94;94;;;;;;*
comp;2758604..2759899;;cds;;;;;;432;;bifunctional folylpolyglutamate synthase/dihydrofolate synthase;*
;;;;;;;;;;;;*
>;2768823..2769518;;cds;;-12;*-12;;;232;;methyltransferase;*
;2769507..2769776;;23s°;;71;;;;268;;;*
;2769848..2769962;;5s;;118;118;;;113;;;*
comp;2770081..2771016;;cds;;;;;;312;;tetratricopeptide repeat protein;*
;;;;;;;;;;;;*
;2792922..2794778;;cds;;129;129;;;619;;glutathione-regulated potassium-efflux system protein KefB;*
;2794908..2794982;;caa;;92;92;;;;;;*
comp;2795075..2795686;;cds;;;;;;204;;hp;*
;;;;;;;;;;;;*
;2862755..2862982;;cds;;123;123;;;76;;hp;*
;2863106..2863182;;cca;;117;;*117;;;;;*
;2863300..2863374;;atgi;;373;;*373;;;;;*
;2863748..2863823;;gca;;157;;*157;;;;;*
;2863981..2864056;;aca;;15;;;;;;;*
;2864072..2864317;;cds;;8;;;;82;;DUF2829 domain-containing protein;*
;2864326..2864401;;aaa;;250;250;;;;;;*
>;2864652..2865041;;cds;;;;;;130;;p-hp;*
;;;;;;;;;;;;*
;2867066..2868112;;cds;;76;76;;;349;;tyrosine-type recombinase/integrase;*
comp;2868189..2868264;;aaa;;99;99;;;;;;*
comp;2868364..2868870;;cds;;;;;;169;;peptidylprolyl isomerase;*
;;;;;;;;;;;;*
;2893891..2894430;;cds;;25;25;;;180;;phage portal protein;*
;2894456..2894570;;5s;;51;;;;113;;;*
;2894622..2894698;;atgf;;285;285;;;;;;*
;2894984..2895400;;cds;;;;;;139;;p-hp;*
;;;;;;;;;;;;*
comp;3034652..3035092;;cds;;250;250;;;147;;hp;*
comp;3035343..3035418;;aaa;;8;8;;;;;;*
comp;3035427..3035986;;cds;;;;;;187;;DUF2829 domain-containing protein;*
;;;;;;;;;;;;*
comp;3305068..3306534;;cds;;379;*379;;;489;;S8 family serine peptidase;*
comp;3306914..3306989;;ttc;+;29;;29;;;;;*
comp;3307019..3307094;;ttc;4 ttc;34;;34;;;;;*
comp;3307129..3307204;;ttc;;33;;33;;;;;*
comp;3307238..3307313;;ttc;;60;60;;;;;;*
comp;3307374..3308864;;cds;;;;;;497;;RimK family protein;*
;;;;;;;;;;;;*
comp;3332977..3334356;;cds;;54;54;;;460;;type II secretion system protein;*
;3334411..3334487;;cgg;;176;176;;;;;;*
< comp;3334664..3335983;;cds;;;;;;440;;p-hp;*
;;;;;;;;;;;;*
;3408217..3409026;;cds;;91;91;;;270;;hp;*
comp;3409118..3409232;;5s;;71;;;;113;;;*
comp;3409304..3409410;;23s°;;1;*1;;;105;;;*
<;3409412..3409711;;cds;;;;;;100;;p-IS5/IS1182 family transposase;*
;;;;;;;;;;;;*
comp;3456276..3461666;;cds;;387;*387;;;1797;;alpha-2-macroglobulin family protein;*
;3462054..3462130;;agg;;29;29;;;;;;*
;3462160..3462951;;cds;;;;;;264;;amino acid ABC transporter substrate-binding protein;*
;;;;;;;;;;;;*
comp;3500025..3500675;;cds;;210;210;;;217;;protein-L-isoaspartate O-methyltransferase;*
;3500886..3500959;;tgc;+;27;;27;;;;;*
;3500987..3501061;;aac;2 aac;31;;31;;;;;*
;3501093..3501167;;aac;;84;84;;;;;;*
comp;3501252..3501659;;cds;;;;;;136;;hp;*
;;;;;;;;;;;;*
;3639978..3641276;;cds;;172;172;;;433;;outer membrane efflux protein;*
;3641449..3641525;;gcg;+;70;;70;;;;;*
;3641596..3641671;;gcg;3 gcg;33;;33;;;;;*
;3641705..3641780;;gcg;;389;*389;;;;;;*
;3642170..3644392;;cds;;;;;;741;;sigma-54-dependent Fis family transcriptional regulator;*
;;;;;;;;;;;;*
;3651524..3652711;;cds;;55;55;;;396;;aminotransferase;*
;3652767..3652843;;cac;;202;202;;;;;;*
<comp;3653046..3653543;;cds;;;;;;166;;arsenical-resistance protein;*
;;;;;;;;;;;;*
;3710072..3710840;;cds;;126;126;;;256;;TonB family protein;*
comp;3710967..3711042;;gaa;+;214;;*214;;;;;*
comp;3711257..3711332;;gaa;2 gaa;125;125;;;;;;*
comp;3711458..3711664;;cds;;;;;;69;;cold-shock protein;*
;;;;;;;;;;;;*
comp;3727874..3729085;;cds;;828;*828;;;404;;hp;*
;3729914..3730068;;16s°;;87;87;;;153;;;*
;3730156..3730545;;cds;;;;;;130;;hp;*
;;;;;;;;;;;;*
comp;3804728..3805231;;cds;;118;118;;;168;;response regulator;*
comp;3805350..3805425;;gag;;241;241;;;;;;*
comp;3805667..3806140;;cds;;;;;;158;;transcription elongation factor GreA;*
;;;;;;;;;;;;*
;3813820..3815895;;cds;;138;138;;;692;;RNA polymerase sigma factor RpoD;*
;3816034..3816109;;atgi;;94;94;;;;;;*
;3816204..3818993;;cds;;;;;;930;;diguanylate cyclase;*
;;;;;;;;;;;;*
comp;3827982..3828878;;cds;;90;90;;;299;;phosphoserine phosphatase SerB;*
comp;3828969..3829042;;ggg;@5;292;292;;;;;;*
;3829335..3830670;;cds;;;;;;445;;chemotaxis protein;*
;;;;;;;;;;;;*
comp;3832305..3833264;;cds;;311;311;;;320;;complex I NDUFA9 subunit family protein;*
;3833576..3833662;;ctg;+;47;;47;;;;;*
;3833710..3833796;;ctg;5 ctg;153;;*153;;;;;*
;3833950..3834036;;ctg;;48;;48;;;;;*
;3834085..3834171;;ctg;;47;;47;;;;;*
;3834219..3834305;;ctg;;113;113;;;;;;*
;3834419..3835039;;cds;;;;;;207;;ribonuclease D;*

rpm cumuls[modifier | modifier le wikicode]

rpm cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cds 300
avec rRNA;opérons;27;1;0;;1;9;1;;100;20;1;0
;16s°atc23s°;7;20;2;;50;15;40;;200;35;30;0
;16s°gca23s°;1;40;14;;100;30;80;;300;30;60;3
;16s°23s°;1;60;7;;150;24;120;;400;23;90;10
;max a;1;80;3;;200;23;160;;500;14;120;10
;a doubles;0;100;0;;250;16;200;;600;7;150;14
;spéciaux;18;120;1;;300;5;240;;700;2;180;13
;total aas;13;140;0;;350;4;280;;800;3;210;11
sans ;opérons;47;160;2;;400;5;320;;900;0;240;6
;1 aa;30;180;1;;450;2;360;;1000;4;270;9
;max a;5;200;0;;500;0;400;;1100;1;300;9
;a doubles;15;;2;;;14;;;;2;;56
;total aas;79;;32;0;;147;;0;;141;;141
total aas;;92;;;;;;;;;;;
remarques;;5;;;;;;;;;;;
avec jaune;;;moyenne;69;;;194;;;;310;;
;;;variance;75;;;197;;;;248;;
sans jaune;;;moyenne;39;;;147;;;;252;;170
;;;variance;16;;;112;;;;134;;71

rpm blocs[modifier | modifier le wikicode]

rpm blocs protéines[modifier | modifier le wikicode]

23s;23s rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB
3-isop;3-isopropylmalate dehydrogenase
3-isop-sub;3-isopropylmalate dehydratase small subunit
acetyl;acetyl-CoA carboxylase biotin carboxylase subunit
cas3;CRISPR-associated helicase/endonuclease Cas3
CDP;CDP-diacylglycerol--serine O-phosphatidyltransferase
ComF;ComF family protein
CRISPR;CRISPR
DUF262;DUF262 domain-containing protein
FeFe;[FeFe] hydrogenase H-cluster radical SAM maturase HydE
glyco;glycosyltransferase
HAMP;HAMP domain-containing protein
LysM ;LysM peptidoglycan-binding domain-containing protein
methyl;methyltransferase
NAD;NAD(P) transhydrogenase subunit alpha
p-elon;p-elongation factor Tu
p-EscV;p-EscV/YscV/HrcVfamilytypeIIIsecretionsystemexportapparatusprotein
p-glyco;p-glycosyltransferase
P-glyco1;p-glycosyl transferase family 1
p-IS5;p-IS5/IS1182 family transposase
p-tetra;p-tetratricopeptide repeat protein
p-trans;p-transposase
PAS;PAS domain-containing protein
peptido;peptidoglycan DD-metalloendopeptidase family protein
phage;phage portal protein
phospho;phosphoenolpyruvate carboxylase
polypho;polyphosphate kinase
respons;response regulator
SAM;SAM-dependent chlorinase/fluorinase
SEL1;SEL1-like repeat protein
tetra;tetratricopeptide repeat protein
TraY;TraY domain-containing protein
trypsin;trypsin-like serine protease
type II;type II toxin-antitoxin system VapC family toxin
VWA;VWA domain-containing protein
winged ;winged helix-turn-helix domain-containing protein

rpm blocs construits[modifier | modifier le wikicode]

  • Lien tableau: rpm blocs construits
  • Notes: J'ai gardé les symboles de coloration. Il suffit de les rechercher et les remplacer et sans désélectionner colorer comme suite:
    - * jaune, ffff00
    - $ orange, ff6600
    - ? cyan, 66ffff
    - § vert, 99ff33
    - & bleu, 00ccff
    - ( gris, dddddd
    - enlever le gras, et surligne.
rpm blocs;;;;;;;;;;;;;;;;;;
;;9 blocs 16s° solitaires, 6 blocs atc gca;;;;;;;;;;9 blocs 23s°5s, 3 blocs complets;;;;;;
sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait;;sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait
;21325..22362;;cds;586;346;hp;1493;;;comp;13874..15127;;cds;-7;418;hp;1505;
;22949..23237;;*16s°;85;§287;;;;;comp;13628..13880;;*23s°;?72;§251;;;
comp;23323..23490;;cds;;56;hp;;b3;;comp;13441..13555;;$5s;242;§113;;;
;;;;;;;;;;comp <;12458..13198;;cds;;247;p-trans;;b5
<;45496..45768;;cds;553;91;p-glyco1;1383;;;;;;;;;;;
;46322..47040;;*16s°;0;§717;;;;;comp;691078..691773;;cds;4;232;ComF;814;
comp;47041..47433;;cds;;131;winged ;;b4;;;691778..691897;;*23s°;?72;§118;;;
;;;;;;;;;;;691970..692084;;$5s;114;§113;;;
comp;839981..840214;;cds;4;78;hp;492;;;comp;692199..694505;;cds;;769;VWA;;b9
comp;840219..840478;;*16s°;568;§258;;;;;;;;;;;;;
comp;841047..844388;;cds;;1114;&respons;;b7;;;753203..753760;;cds;388;186;hp;1028;
;;;;;;;;;;;752603..752814;;rpr;597;71;CRISPR;;
;1213113..1214459;;cds;210;449;&acetyl;'''1445;;;comp;751747..752005;;*23s°;?72;§257;;;
comp;1214670..1214874;;*16s°;600;§203;;;;;comp;751560..751674;;$5s;161;§113;;;
comp;1215475..1216716;;cds;;414;&polypho;;;;;750262..751398;;cds;;379;&FeFe;;b8
;;;;;;;;;;;;;;;;;;
comp;1812365..1813924;;cds;894;520;&peptido;1026;;;comp;2521529..2522152;;cds;189;208;&3-isop-sub;986;
;1814819..1815040;;*16s°;-7;§222;;;;;comp;2520976..2521339;;*23s°;?72;§362;;;
<comp;1815034..1815837;;cds;;268;p-elon;;b5;;comp;2520789..2520903;;$5s;229;§113;;;
;;;;;;;;;;comp;2517845..2520559;;cds;;905;&phospho;;b7
comp;2087696..2090938;;cds;705;1081;PAS;595;;;;;;;;;;;
;2091644..2091826;;*16s°;7;§181;;;;;>;2768823..2769518;;cds;-12;232;&methyl;964;
;2091834..2092247;;cds;;138;hp;;b9;;;2769507..2769776;;*23s°;?71;§268;;;
;;;;;;;;;;;2769848..2769962;;$5s;118;§113;;;
comp;2095044..2095490;;cds;48;149;hp;640;;;comp;2770081..2771016;;cds;;312;tetra;;b6
comp;2095539..2095733;;*16s°;614;§193;;;;;;;;;;;;;
comp;2096348..2097337;;cds;;330;&trypsin;;b8;;<;3409412..3409711;;cds;1;100;p-IS5;405;
;;;;;;;;;;comp;3409304..3409410;;*23s°;?71;§105;;;
comp;2393295..2396009;;cds;1003;905;&cas3;;;;comp;3409118..3409232;;$5s;91;§113;;;
;2397013..2397919;;*16s°;2;§905;;905;;;;3408217..3409026;;cds;;270;hp;;b4
;2397922..2400888;;cds;;989;hp;;b10;;;;;;;;;;
;;;;;;;;;;comp;467261..468370;;cds;167;370;&3-isop;'''1238;
comp;3727874..3729085;;cds;828;404;hp;1755;;;;468538..468667;;*23s°;?72;§128;;;
;3729914..3730068;;*16s°;87;§153;;;;;;468740..468854;;$5s;?51;§113;;;
;3730156..3730545;;cds;;130;hp;;b2;;;468906..468982;;atgf;125;;;;
;;;;;;;;;;;469108..469863;;cds;;252;&SAM;;
;434306..435142;;cds;512;279;&CDP;;;;;;;;;;;;
;435655..435842;;*16s°;-6;§186;;'''1023;;;comp;1735298..1736380;;cds;209;361;DUF262;1351;
;;;;;;;;;;;1736590..1736859;;*23s°;?72;§268;;;
comp;3322..4194;;cds;30;291;LysM ;;;;;1736932..1737046;;$5s;?52;§113;;;
comp;4225..4821;;*23s°;?196;§595;;1468;;;;1737099..1737175;;atgf;93;;;;
comp;5018..5093;;gca;?182;;;;;;comp;1737269..1737694;;cds;;142;type II;;b10
comp;5276..5684;;*16s°;38;§407;;;;;;;;;;;;;
;5723..6664;;cds;;314;SEL1;;b6;;comp;2144042..2146288;;cds;308;749;HAMP;2905;
;;;;;;;;;;;2146597..2147256;;*23s°;?72;§658;;;
comp;32782..33759;;cds;190;326;&glyco;;;;;2147329..2147443;;$5s;?52;§113;;;
;33950..34357;;*16s°;?112;§406;;;;;;2147496..2147572;;atgf;645;;;;
;34470..34546;;atc;?216;;;;;;comp;2148218..2148664;;cds;;149;hp;;b2
;34763..35591;;*23s°;44;§827;;827;b7;;;;;;;;;;
comp;35636..35750;;$5s;72;§113;;;;;comp;24015..24287;;cds;250;91;TraY;;
comp;35823..38589;;$23s;?215;§2765;;;;;comp;24538..24652;;$5s;?71;§113;;;
comp;38805..38881;;atc;?112;;;;;;comp;24724..27490;;$23s;?212;§2765;;;
comp;38994..40502;;$16s;260;§1507;;;b0;;comp;27703..27779;;atc;?112;;;;
comp;40763..42629;;*23s°;-15;§1865;;1865;b4;;comp;27892..28378;;*16s°;18;§485;;;
;42615..42903;;*16s°;?112;§287;;;;;<>;28397..29119;;cds;;241;p-EscV;;b1
;43016..43092;;atc;?213;;;;;;;;;;;;;;
;43306..44132;;*23s°;-1;§825;;825;b8;;comp;35636..35750;;$5s;?72;§113;;;
comp;44132..44835;;*23s°;-5;§702;;993;;;comp;35823..38589;;$23s;?215;§2765;;;
;44831..45121;;cds;;97;hp;;b5;;comp;38805..38881;;atc;?112;;;;
;;;;;;;;;;comp;38994..40502;;$16s;260;§1507;;;b0
comp;49761..51017;;cds;128;419;&glyco;1331;;;;;;;;;;;
comp;51146..51221;;*23s°;?214;§74;;;;;;434306..435142;;cds;512;279;&CDP;;
comp;51436..51512;;atc;?112;;;;;;;435655..435842;;*16s°;-6;§186;;'''1023;
comp;51625..52017;;*16s°;-7;§391;;;b9;;;435837..436075;;*23s°;?72;§237;;;
;52011..52881;;*23s°;106;§869;;1346;;;;436148..436262;;$5s;?51;§113;;237;
;52988..53464;;cds;-37;159;hp;;;;;436314..436390;;atgf;196;;;;
>;53428..53694;;cds;86;89;p-glyco;;;;;436587..436883;;cds;;99;hp;;b3
comp;53781..54709;;*23s°;26;§927;;1194;b3;;;;;;;;;;
;54736..54898;;*16s°;?112;§161;;;;;;2893891..2894430;;cds;25;180;&phage;;
;55011..55087;;atc;?216;;;697;;;;2894456..2894570;;$5s;?51;§113;;'''540;
;55304..55741;;*23s°;438;§436;;;;;;2894622..2894698;;atgf;285;;;;
;56180..56440;;cds;;87;hp;;b10;;;2894984..2895400;;cds;;139;p-hp;;
;;;Fait: 4 blocs sans aas;;;;;;;;;;;Fait: 5 blocs atc, gca;;;;
sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait;;sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait
comp;35636..35750;;$5s;?72;§113;;;b0;;;5723..6664;;cds;;314;SEL1;'''1349;b6
comp;35823..38589;;$23s;?215;§2765;;'''2765;;;comp;5276..5684;;*16s°;38;§407;;;
comp;38805..38881;;atc;?112;;;;;;comp;5018..5093;;gca;?182;;;;
comp;38994..40502;;$16s;260;§1507;;'''1507;;;comp;4225..4821;;*23s°;?196;§595;;;
;;;;;;;;;;comp;3322..4194;;cds;30;291;LysM ;1468;
comp;24015..24287;;cds;250;91;TraY;;b1;;>;2768823..2769518;;cds;-12;(232;&methyl;964;
comp;24538..24652;;$5s;?71;§113;;;;;;2769507..2769776;;*23s°;?71;§268;;;
comp;24724..27490;;$23s;?212;§2765;;'''2765;;;;2769848..2769962;;$5s;118;§113;;;
comp;27703..27779;;atc;?112;;;;;;comp;2770081..2771016;;cds;;312;tetra;'''2432;
comp;27892..28378;;*16s°;18;§485;;'''1208;;;;;;;;;;;
<>;28397..29119;;cds;;241;p-EscV;;;;comp;841047..844388;;cds;;1114;&respons;'''898;b7
;;;;;;;;;;comp;840219..840478;;*16s°;568;§258;;492;
comp;3727874..3729085;;cds;828;404;hp;'''1755;b2;;comp;839981..840214;;cds;4;78;hp;;
;3729914..3730068;;*16s°;87;§153;;<u>1365;;;comp;32782..33759;;cds;190;326;&glyco;;
;3730156..3730545;;cds;;130;hp;;;;;33950..34357;;*16s°;?112;§406;;406;
comp;2144042..2146288;;cds;308;749;HAMP;;;;;34470..34546;;atc;?216;;;;
;2146597..2147256;;*23s°;?72;§658;;;;;;34763..35591;;*23s°;44;§827;;827;
;2147329..2147443;;$5s;?52;§113;;;;;comp;2521529..2522152;;cds;189;(208;&3-isop-sub;986;
;2147496..2147572;;atgf;645;;;;;;comp;2520976..2521339;;*23s°;?72;§362;;;
comp;2148218..2148664;;cds;;149;hp;'''2905;;;comp;2520789..2520903;;$5s;229;§113;;<u>1238;
;;;;;;;;;;comp;2517845..2520559;;cds;;905;&phospho;'''1813;
;21325..22362;;cds;586;346;hp;'''1493;b3;;;;;;;;;;
;22949..23237;;*16s°;85;§287;;<u>1325;;;;;;;;;;;
comp;23323..23490;;cds;;56;hp;;;;comp;2096348..2097337;;cds;;330;&trypsin;'''927;b8
;52011..52881;;*23s°;106;§869;;1346;;;comp;2095539..2095733;;*16s°;614;§193;;640;
;52988..53464;;cds;-37;159;hp;;;;comp;2095044..2095490;;cds;48;149;hp;;
>;53428..53694;;cds;86;89;p-glyco;;;;;42615..42903;;*16s°;?112;§287;;287;
comp;53781..54709;;*23s°;26;§927;;1194;;;;43016..43092;;atc;?213;;;;
;435837..436075;;*23s°;?72;§237;;237;;;;43306..44132;;*23s°;-1;§825;;825;
;436148..436262;;$5s;?51;§113;;;;;;753203..753760;;cds;388;186;hp;;
;436314..436390;;atgf;196;;;;;;;752603..752814;;rpr;597;71;CRISPR;1028;
;436587..436883;;cds;;99;hp;'''2777;;;comp;751747..752005;;*23s°;?72;§257;;;
;;;;;;;;;;comp;751560..751674;;$5s;161;§113;;;
<;45496..45768;;cds;553;91;p-glyco1;'''1383;b4;;;750262..751398;;cds;;379;&FeFe;'''1853;
;46322..47040;;*16s°;0;§717;;;;;;;;;;;;;
comp;47041..47433;;cds;;131;winged ;;;;comp;2087696..2090938;;cds;705;1081;PAS;'''986;b9
comp;40763..42629;;*23s°;-15;§1865;;1865;;;;2091644..2091826;;*16s°;7;§181;;595;
<;3409412..3409711;;cds;1;100;p-IS5;;;;;2091834..2092247;;cds;;138;hp;;
comp;3409304..3409410;;*23s°;?71;§105;;405;;;comp;51625..52017;;*16s°;-7;§391;;391;
comp;3409118..3409232;;$5s;91;§113;;;;;comp;51436..51512;;atc;?112;;;;
;3408217..3409026;;cds;;270;hp;'''2270;;;comp;51146..51221;;*23s°;?214;§74;;;
;;;;;;;;;;comp;49761..51017;;cds;128;(419;&glyco;1331;
comp;1812365..1813924;;cds;894;520;&peptido;;b5;;comp;691078..691773;;cds;4;232;ComF;;
;1814819..1815040;;*16s°;-7;§222;;'''1026;;;;691778..691897;;*23s°;?72;§118;;814;
<comp;1815034..1815837;;cds;;268;p-elon;;;;;691970..692084;;$5s;114;§113;;;
comp;44132..44835;;*23s°;-5;§702;;993;;;comp;692199..694505;;cds;;769;VWA;'''2145;
;44831..45121;;cds;;97;hp;;;;;;;;;;;;
comp;13874..15127;;cds;-7;418;hp;1505;;;comp;2393295..2396009;;cds;1003;905;&cas3;'''1066;b10
comp;13628..13880;;*23s°;?72;§251;;;;;;2397013..2397919;;*16s°;2;§905;;905;
comp;13441..13555;;$5s;242;§113;;;;;;2397922..2400888;;cds;;989;hp;;
comp <;12458..13198;;cds;;247;p-trans;'''2498;;;;54736..54898;;*16s°;?112;§161;;161;
;;;;;;;;;;;55011..55087;;atc;?216;;;;
;;;;;;;;;;;55304..55741;;*23s°;438;§436;;;
;2893891..2894430;;cds;25;180;&phage;;;;;56180..56440;;cds;;87;hp;697;
;2894456..2894570;;$5s;?51;§113;;(540;;;comp;1735298..1736380;;cds;209;361;DUF262;1351;
;2894622..2894698;;atgf;285;;;;;;;1736590..1736859;;*23s°;?72;§268;;;
;2894984..2895400;;cds;;139;p-hp;;;;;1736932..1737046;;$5s;?52;§113;;;
;;;;;;;;;;;1737099..1737175;;atgf;93;;;;
;1213113..1214459;;cds;210;449;&acetyl;(1445;;;comp;1737269..1737694;;cds;;142;type II;'''2048;
comp;1214670..1214874;;*16s°;600;§203;;;;;;;;;;;;;
comp;1215475..1216716;;cds;;414;&polypho;;;;;;;;;;;;
;;;;;;;;;;;434306..435142;;cds;512;279;&CDP;;
comp;467261..468370;;cds;167;370;&3-isop;(1238;;;;435655..435842;;*16s°;-6;§186;;(1023;
;468538..468667;;*23s°;?72;§128;;;;;;435837..436075;;*23s°;?72;§237;;;
;468740..468854;;$5s;?51;§113;;;;;;436148..436262;;$5s;?51;§113;;237;
;468906..468982;;atgf;125;;;;;;;436314..436390;;atgf;196;;;;
;469108..469863;;cds;;252;&SAM;;;;;436587..436883;;cds;;99;hp;;

rpm distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;5
att;;act;;aat;;agt;;aac2;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;aag2;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;acc3;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;;atgj2;ttc;;tcc;;tac;1;tgc;1;;ttc;4;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;1;cag2;atc;;acc;;aac;;agc;;;atc;;acc;3;aac;2;agc;;;atc;;acc;;aac;;agc;
ctc;1;ccc;2;cac;2;cgt;;ccg2;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;3;;ctc;;ccc;;cac;;cgt;
gtc;2;gcc;;gac;;ggc;;cgt3;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;4;gac;2;ggc;4;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;;ctg5;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;3;aga;1;gaa2;ata;;aca;1;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;gac2;cta;;cca;1;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;1;gca;;gaa;;gga;;gcc4;gta;;gca;1;gaa;;gga;1;;gta;;gca;;gaa;2;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;1;gcg3;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;;agg;1;ggc4;atgj;;acg;;aag;;agg;;;atgj;2;acg;;aag;2;agg;;;atgj;;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;1;gtg2;ctg;;ccg;;cag;;cgg;;;ctg;5;ccg;2;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;2;ggg;1;ttc4;gtg;;gcg;;gag;;ggg;;;gtg;2;gcg;3;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;gca >1 16s;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
rpm;;30;;;;;30;;rpm;7;;;;;;7;;rpm;42;;;;;;42;;rpm;;;;5;;;5
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5 1-3aas;;;

rpm remarques[modifier | modifier le wikicode]

rpm remarques texte[modifier | modifier le wikicode]
rpm listes[modifier | modifier le wikicode]
alpha codes[modifier | modifier le wikicode]
rpm;25;;;;;95;88;;rru;12;;;;;55;51;;rpl;2;;;;;33;31
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;1;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;4;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;7;acc;3;aac;2;agc;1;;atc;4;acc;2;aac;1;agc;1;;atc;1;acc;1;aac;1;agc;1
ctc;1;ccc;2;cac;2;cgt;3;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;1;ccc;0;cac;1;cgt;1
gtc;2;gcc;4;gac;2;ggc;4;;gtc;1;gcc;2;gac;1;ggc;1;;gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;2;aca;2;aaa;4;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;2;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;2;gaa;2;gga;1;;gta;1;gca;4;gaa;1;gga;1;;gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1;;ttg;1;tcg;1;tag;;tgg;1;;ttg;0;tcg;0;tag;;tgg;1
atg;5/2;acg;1;aag;3;agg;1;;atg;3/1;acg;1;aag;1;agg;1;;atg;1/1;acg;1;aag;0;agg;0
ctg;5;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;0;ccg;0;cag;0;cgg;1
gtg;2;gcg;3;gag;2;ggg;1;;gtg;1;gcg;1;gag;1;ggg;1;;gtg;0;gcg;0;gag;0;ggg;0
;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;
abq;20;;;;;88;83;;oan;11;;;;;61;52;;rtb;2;;;;;33;31
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;8;acc;2;aac;3;agc;1;;atc;4;acc;1;aac;1;agc;1;;atc;1;acc;1;aac;1;agc;1
ctc;2;ccc;1;cac;2;cgt;2;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;1;ccc;0;cac;1;cgt;1
gtc;2;gcc;3;gac;4;ggc;4;;gtc;1;gcc;1;gac;2;ggc;2;;gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;1;;tta;1;tca;1;taa;;tga;
ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;8;gaa;1;gga;1;;gta;1;gca;4;gaa;2;gga;1;;gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;1;tcg;1;tag;;tgg;1;;ttg;0;tcg;0;tag;;tgg;1
atg;3/1;acg;1;aag;2;agg;1;;atg;5/2;acg;1;aag;1;agg;1;;atg;1/1;acg;1;aag;0;agg;0
ctg;3;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;0;ccg;0;cag;0;cgg;1
gtg;2;gcg;2;gag;2;ggg;1;;gtg;1;gcg;0;gag;1;ggg;1;;gtg;0;gcg;0;gag;0;ggg;0
;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;
abs;20;;;;;85;76;;agr;9;;;;;58;51;;aua;12;;;;;55;55
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;4;acc;2;aac;3;agc;1;;atc;5;acc;1;aac;1;agc;1;;atc;1;acc;1;aac;2;agc;1
ctc;2;ccc;1;cac;2;cgt;2;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;2;ccc;1;cac;1;cgt;2
gtc;2;gcc;3;gac;4;ggc;4;;gtc;1;gcc;1;gac;2;ggc;2;;gtc;3;gcc;1;gac;2;ggc;2
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;4;gaa;1;gga;2;;gta;1;gca;5;gaa;2;gga;1;;gta;1;gca;1;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;1;tcg;1;tag;;tgg;1;;ttg;1;tcg;1;tag;;tgg;1
atg;5/1;acg;1;aag;2;agg;1;;atg;6/1;acg;1;aag;1;agg;0;;atg;4;acg;1;aag;1;agg;1
ctg;3;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1
gtg;2;gcg;2;gag;2;ggg;1;;gtg;0;gcg;0;gag;0;ggg;1;;gtg;1;gcg;1;gag;1;ggg;1
gamma codes[modifier | modifier le wikicode]
19/01/20;Paris;;;;;;
gamma;10500;1161;;;;88462;86720
ttt;18;tct;20;tat;15;tgt;2
att;1;act;6;aat;2;agt;0
ctt;11;cct;1;cat;3;cgc;0
gtt;6;gct;0;gat;0;ggt;6
ttc;2,075;tcc;1,795;tac;2,687;tgc;1,345
atc;3,369;acc;1,829;aac;3,679;agc;1,256
ctc;1,204;ccc;1,012;cac;1,369;cgt;3,520
gtc;2,046;gcc;1,973;gac;3,421;ggc;4,151
tta;1,422;tca;1,662;taa;12;tga;762
ata;10;aca;1,666;aaa;4,457;aga;1,784
cta;1,516;cca;1,671;caa;2,239;cga;156
gta;3,798;gca;3,342;gaa;3,829;gga;1,347
ttg;1,214;tcg;984;tag;32;tgg;1,340
atg;7,009;acg;845;aag;282;agg;1,298
ctg;2,977;ccg;729;cag;1,208;cgg;1,182
gtg;98;gcg;82;gag;90;ggg;855
;;;;;;;
indices;;;;;;;
gamma;904;1161;;;;88462;7469
ttt;1.55;tct;1.72;tat;1.29;tgt;0.17
att;0.09;act;0.52;aat;0.17;agt;0
ctt;0.95;cct;0.09;cat;0.26;cgc;0
gtt;0.52;gct;0;gat;0;ggt;0.52
ttc;179;tcc;155;tac;231;tgc;116
atc;290;acc;158;aac;317;agc;108
ctc;104;ccc;87;cac;118;cgt;303
gtc;176;gcc;170;gac;295;ggc;358
tta;122;tca;143;taa;1.03;tga;66
ata;0.86;aca;143;aaa;384;aga;154
cta;131;cca;144;caa;193;cga;13.4
gta;327;gca;288;gaa;330;gga;116
ttg;105;tcg;85;tag;2.76;tgg;115
atg;604;acg;73;aag;24.3;agg;112
ctg;256;ccg;63;cag;104;cgg;102
gtg;8.4;gcg;7.1;gag;7.8;ggg;74

rru[modifier | modifier le wikicode]

rru opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Rhod_rubr_ATCC_11170/rhodRubr_ATCC11170-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_007643.1;rru;;genome;3.8.16;;;;;;;;
64.97%GC;26.12.19 Paris;16s  4 ;55 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rhodospirillum rubrum ATCC 11170;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
comp;16232..16852;;cds;;163;163;;;207;;3'-5' exonuclease;*
comp;17016..17102;;ctg;;253;253;;;;;;*
;17356..18378;;cds;;;;;;341;;3-beta-hydroxy-delta(5)-steroid dehydrogenase;*
;;;;;;;;;;;;*
;117072..117287;;cds;;37;37;;;72;;slyX;*
comp;117325..117401;;agg;;341;341;;;;;;*
;117743..123022;;cds;;;;;;*1760;;alpha-2-macroglobulin-like protein;*
;;;;;;;;;;;;*
comp;149921..151015;;cds;;225;225;;;365;;hp;*
;151241..151317;;cgg;;136;136;;;;;;*
comp;151454..152929;;cds;;;;;;492;;chemotaxis sensory transducer protein;*
;;;;;;;;;;;;*
;189941..191668;;cds;;859;*859;;;576;;sulfate transporter/antisigma-factor antagonist;*
;192528..194004;;16s;;184;;;;1477;;;*
;194189..194265;;atc;;66;;;66;;;;*
;194332..194407;;gca;;362;;;;;;;*
;194770..197527;;23s;;119;;;;2758;;;*
;197647..197761;;5s;;96;;;;115;;;*
;197858..197934;;atgf;;287;287;;;;;;*
comp;198222..198455;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;305449..306648;;cds;;257;257;;;400;;Ppx/GppA phosphatase;*
;306906..306979;;cag;;319;319;;;;;;*
comp;307299..308303;;cds;;;;;;335;;LacI family transcriptional regulator;*
;;;;;;;;;;;;*
comp;322896..323807;;cds;;292;292;;;304;;hp;*
comp;324100..324174;;caa;;98;98;;;;;;*
comp;324273..325601;;cds;;;;;;443;;chemotaxis sensory transducer protein;*
;;;;;;;;;;;;*
;362552..362881;;cds;;224;224;;;110;;hp;*
;363106..363181;;gcc;+;202;;202;;;;;*
;363384..363459;;gcc;2 gcc;43;43;;;;;;*
comp;363503..364531;;cds;;;;;;343;;esterase;*
;;;;;;;;;;;;*
;407067..407606;;cds;;92;92;;;180;;YbaK/prolyl-tRNA synthetase associated domain-containing protein;*
;407699..407790;;agc;;141;141;;;;;;*
;407932..408774;;cds;;;;;;281;;hp;*
;;;;;;;;;;;;*
;466945..467925;;cds;;115;115;;;327;;hp;*
comp;468041..468126;;tta;;83;83;;;;;;*
comp;468210..468458;;cds;;;;;;83;;hp;*
;;;;;;;;;;;;*
comp;559038..559610;;cds;;86;86;;;191;;OsmC-like protein;*
;559697..559772;;aag;;140;140;;;;;;*
;559913..560608;;cds;;;;;;232;;hp;*
;;;;;;;;;;;;*
comp;794877..795188;;cds;;-81;*-81;;;104;;hp;*
comp;795108..795188;;Sig-pep;;217;217;;;27;;hp;*
;795406..795496;;tcc;;44;44;;;;;;*
;795541..795846;;cds;;;;;;102;;hp;*
;;;;;;;;;;;;*
comp;908584..910185;;cds;;-102;*-102;;;534;;peptidase M23B;*
comp;910084..910185;;Sig-pep;@1;1212;*1212;;;34;;hp;*
;911398..912874;;16s;;182;;;;1477;;;*
;913057..913133;;atc;;66;;;66;;;;*
;913200..913275;;gca;;361;;;;;;;*
;913637..916394;;23s;;118;;;;2758;;;*
;916513..916627;;5s;;95;;;;115;;;*
;916723..916799;;atgf;;573;*573;;;;;;*
;917373..921860;;cds;;;;;;*1496;;hp;*
;;;;;;;;;;;;*
;1159249..1160091;;cds;;71;71;;;281;;Linocin_M18 bacteriocin protein;*
;1160163..1160238;;gag;;117;117;;;;;;*
;1160356..1160613;;cds;;;;;;86;;prevent-host-death protein;*
;;;;;;;;;;;;*
comp;1464820..1465122;;cds;;283;283;;;101;;50S ribosomal protein L21;*
;1465406..1465495;;tcg;;139;139;;;;;;*
comp;1465635..1466303;;cds;;;;;;223;;cytochrome B561;*
;;;;;;;;;;;;*
;1791953..1792159;;cds;;116;116;;;69;;hp;*
comp;1792276..1792351;;gaa;;131;131;;;;;;*
comp;1792483..1792689;;cds;;;;;;69;;cold-shock DNA-binding protein family protein;*
;;;;;;;;;;;;*
;1824302..1825738;;cds;;98;98;;;479;;malonyl-CoA decarboxylase;*
;1825837..1825921;;cta;;102;102;;;;;;*
;1826024..1827415;;cds;;;;;;464;;trigger factor;*
;;;;;;;;;;;;*
;1833133..1833408;;cds;;284;284;;;92;;histone-like DNA-binding protein;*
;1833693..1833768;;gta;;70;70;;;;;;*
comp;1833839..1835326;;cds;;;;;;496;;methyl-accepting chemotaxis sensory transducer;*
;;;;;;;;;;;;*
;1933506..1934138;;cds;;-633;*-633;;;211;;hp;*
;1933506..1933652;;Sig-pep;;571;*571;;;49;;hp;*
;1934224..1934300;;cca;;63;63;;;;;;*
;1934364..1934663;;cds;;12;12;;;100;;ETC complex I subunit region;*
;1934676..1934752;;aga;;396;*396;;;;;;*
;1935149..1939624;;cds;;;;;;*1492;;hp;*
;;;;;;;;;;;;*
;1959133..1959858;;cds;;175;175;;;242;;MerR family transcriptional regulator;*
;1960034..1960110;;ccc;@2;1062;*1062;;;;;;*
;1961173..1961367;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;1996760..1998124;;cds;;-120;*-120;;;455;;lytic murein transglycosylase;*
comp;1998005..1998124;;Sig-pep;;119;119;;;40;;hp;*
;1998244..1998333;;tca;;927;*927;;;;;;*
comp;1999261..1999929;;cds;;;;;;223;;hp;*
;;;;;;;;;;;;*
;2032027..2032863;;cds;;123;123;;;279;;phage integrase;*
comp;2032987..2033062;;aaa;;186;186;;;;;;*
comp;2033249..2033755;;cds;;;;;;169;;peptidyl-prolyl isomerase;*
;;;;;;;;;;;;*
comp;2093327..2093977;;cds;;295;295;;;217;;protein-L-isoaspartate(D-aspartate) O-methyltransferase;*
;2094273..2094346;;tgc;;81;;81;;;;;*
;2094428..2094502;;aac;;150;150;;;;;;*
;2094653..2094916;;cds;;;;;;88;;prevent-host-death protein;*
;;;;;;;;;;;;*
comp;2304404..2305834;;cds;;89;89;;;477;;divalent cation transporter;*
comp;2305924..2306010;;ctc;;178;178;;;;;;*
;2306189..2306839;;cds;;;;;;217;;lipoate-protein ligase B;*
;;;;;;;;;;;;*
;2331183..2331521;;cds;;73;73;;;113;;hp;*
;2331595..2331671;;atgj;;126;126;;;;;;*
comp;2331798..2332040;;cds;;;;;;81;;hp;*
;;;;;;;;;;;;*
comp;2411337..2411804;;cds;;-72;*-72;;;156;;CreA;*
comp;2411733..2411804;;Sig-pep;;202;202;;;24;;hp;*
comp;2412007..2412083;;cac;;75;75;;;;;;*
comp;2412159..2413343;;cds;;;;;;395;;hp;*
;;;;;;;;;;;;*
;2729598..2731271;;cds;;449;*449;;;558;;macrocin-O-methyltransferase;*
comp;2731721..2731797;;atgf;;95;;;;;;;*
comp;2731893..2732007;;5s;;119;;;115;;;;*
comp;2732127..2734884;;23s;;362;;;2758;;;;*
comp;2735247..2735322;;gca;;66;;;66;;;;*
comp;2735389..2735465;;atc;;184;;;;;;;*
comp;2735650..2737126;;16s;;606;*606;;1477;;;;*
comp;2737733..2738110;;cds;;;;;;126;;hp;*
;;;;;;;;;;;;*
comp;2959802..2961874;;cds;;354;*354;;;*691;;chemotaxis sensory transducer protein;*
comp;2962229..2962303;;gtc;;123;123;;;;;;*
;2962427..2963359;;cds;;;;;;311;;N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;3124836..3125033;;cds;;151;151;;;66;;preprotein translocase subunit SecE;*
comp;3125185..3125260;;tgg;;343;343;;;;;;*
comp;3125604..3126794;;cds;;93;93;;;397;;elongation factor Tu;*
comp;3126888..3126961;;gga;;27;;27;;;;;*
comp;3126989..3127074;;tac;;37;37;;;;;;*
;3127112..3128158;;cds;;57;57;;;349;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;3128216..3128291;;aca;;127;127;;;;;;*
;3128419..3128652;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;3193350..3194507;;cds;;430;*430;;;386;;acyltransferase;*
comp;3194938..3195013;;ttc;;103;103;;;;;;*
comp;3195117..3195635;;cds;;;;;;173;;hp;*
;;;;;;;;;;;;*
;3320745..3322115;;cds;;-1371;*-1371;;;457;;virulence protein;*
;3320745..3320816;;Sig-pep;;1389;*1389;;;24;;hp;*
comp;3322206..3322281;;atgi;;60;60;;;;;;*
comp;3322342..3324432;;cds;;;;;;*697;;RNA polymerase sigma factor RpoD;*
;;;;;;;;;;;;*
comp;3377932..3378114;;cds;;140;140;;;61;;hp;*
;3378255..3378329;;acc;+;165;;165;;;;;*
;3378495..3378569;;acc;2 acc;237;237;;;;;;*
;3378807..3379370;;cds;;234;234;;;188;;hp;*
;3379605..3379681;;gac;;77;77;;;;;;*
comp;3379759..3380517;;cds;;;;;;253;;diguanylate phosphodiesterase;*
;;;;;;;;;;;;*
comp;3399207..3399494;;cds;;262;262;;;96;;hp;*
comp;3399757..3399833;;ccg;;56;56;;;;;;*
comp;3399890..3400972;;cds;;;;;;361;;farnesyltranstransferase;*
;;;;;;;;;;;;*
;3490378..3491148;;cds;;84;84;;;257;;2-phosphoglycolate phosphatase;*
;3491233..3491307;;gtg;;407;*407;;;;;;*
;3491715..3492080;;cds;;;;;;122;;hp;*
;;;;;;;;;;;;*
comp;3719367..3719753;;cds;;163;163;;;129;;hp;*
comp;3719917..3719990;;ggg;;95;95;;;;;;*
comp;3720086..3720859;;cds;;;;;;258;;enoyl-ACP reductase;*
;;;;;;;;;;;;*
;3805869..3806813;;cds;;130;130;;;315;;inner-membrane translocator;*
comp;3806944..3807058;;5s;;116;;;;115;;;*
comp;3807175..3809932;;23s;;362;;;;2758;;;*
comp;3810295..3810370;;gca;;66;;;66;;;;*
comp;3810437..3810513;;atc;;184;;;;;;;*
comp;3810698..3812174;;16s;;1227;*1227;;;1477;;;*
;3813402..3814118;;cds;;;;;;239;;transposase;*
;;;;;;;;;;;;*
comp;3824154..3825854;;cds;;76;76;;;567;;phage integrase;*
comp;3825931..3826007;;cgt;;387;*387;;;;;;*
;3826395..3827531;;cds;;;;;;379;;hp;*
;;;;;;;;;;;;*
;4021982..4023163;;cds;;27;27;;;394;;diguanylate phosphodiesterase;*
comp;4023191..4023277;;ttg;;224;224;;;;;;*
;4023502..4023855;;cds;;;;;;118;;hp;*
;;;;;;;;;;;;*
comp;4058818..4059117;;cds;;187;187;;;100;;hp;*
;4059305..4059380;;gcg;;179;179;;;;;;*
comp;4059560..4060126;;cds;;;;;;189;;hp;*
;;;;;;;;;;;;*
comp;4105626..4107317;;cds;;-114;*-114;;;564;;chemotaxis sensory transducer;*
comp;4107204..4107317;;Sig-pep;;721;*721;;;38;;hp;*
comp;4108039..4108113;;acg;;148;148;;;;;;*
;4108262..4108843;;cds;;;;;;194;;D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase;*
;;;;;;;;;;;;*
comp;4261100..4262038;;cds;;269;269;;;313;;thioredoxin-like protein;*
;4262308..4262382;;ggc;;118;118;;;;;;*
;4262501..4263136;;cds;;;;;;212;;lysine exporter protein LysE/YggA;*

rru cumuls[modifier | modifier le wikicode]

rru cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cds 300
avec rRNA;opérons;4;1;;;1;7;1;;100;23;1;0
;16atcgca235;1;20;;;50;6;40;;200;17;30;3
;Id-atgf;3;40;1;;100;19;80;;300;16;60;4
;-;;60;;;150;20;120;;400;17;90;12
;max a;3;80;;4;200;8;160;;500;8;120;10
;a doubles;0;100;1;;250;7;200;;600;5;150;3
;spéciaux;0;120;;;300;9;240;;700;2;180;4
;total aas;11;140;;;350;3;280;;800;0;210;5
sans ;opérons;40;160;;;400;3;320;;900;0;240;8
;1 aa;36;180;1;;450;3;360;;1000;0;270;4
;max a;2;200;;;500;0;400;;1100;0;300;3
;a doubles;2;;1;;;10;;;;3;;35
;total aas;44;;4;4;;95;;0;;91;;91
total aas;;55;;;;;;;;;;;
remarques;;;;;;;;;;;;;
avec jaune;;;moyenne;119;66;;208;;;;292;;
;;;variance;79;0;;333;;;;187;;
sans jaune;;;moyenne;;;;148;;;;237;;140
;;;variance;;;;83;;;;132;;69

rru blocs[modifier | modifier le wikicode]

rru blocs;;;;;;;
cds;859;576;sulfate;cds;606;126;hp
16s;184;1477;;16s;184;1477;
atc;66;;;atc;66;;
gca;362;;;gca;362;;
23s;119;2758;;23s;119;2758;
5s;96;115;;5s;95;115;
atgf;287;;;atgf;449;;
cds;;78;hp;cds;;558;macrocin
;;;;;;;
cds;-102;534;peptidase;;;;
Sig-pep;1212;34;hp;cds;1227;239;transposase
16s;182;1477;;16s;184;1477;
atc;66;;;atc;66;;
gca;361;;;gca;362;;
23s;118;2758;;23s;116;2758;
5s;95;115;;5s;130;115;
atgf;573;;;cds;;315;inner
cds;;1496;hp;;;;
;;;;;;;
sulfate;sulfate transporter/antisigma-factor antagonist;;;;;;
inner;inner-membrane translocator;;;;;;
macrocin;macrocin-O-methyltransferase;;;;;;
peptidase;peptidase M23B;;;;;;

rru distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;;;ttc;;tcc;;tac;1;tgc;1;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;;agc;1;;atc;;acc;;aac;1;agc;;;atc;;acc;2;aac;;agc;;;atc;;acc;;aac;;agc;
ctc;1;ccc;1;cac;1;cgt;1;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;;gac;1;ggc;1;;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;2;gac;;ggc;;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;1;gca;;gaa;1;gga;;;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;1;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;1;cag;1;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;1;gcg;1;gag;1;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
rru;;36;;;;;36;;rru;4;;;;;;4;;rru;4;;;;;;4;;rru;;;;3;;;3
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;3 1-3aas;;;

rru intercalaires entre cds[modifier | modifier le wikicode]

rru;27.1.21 paris;NCBI;10.3.20;;;;;;;;;
rru;intercalaires;total;%;intercalaires;moyennes;ecartype;plage;ADN;intercal;<u>frequence5;intercal;<u>frequencez
;'''négatif;683;18.0;'''négatif ;-8;15;-73 à -1;'''4 352 825;-1;683;610;1
;'''zéro;13;0.3;;;;;'''intercals;0;13;620;0
;'''1 à 200;2368;62.5;'''0 à 200;78;58;;'''429 144;5;180;630;5
;'''201 à 370;535;14.1;'''201 à 370;268;46;;'''9.9%;10;109;640;6
;'''371 à 600;139;3.7;'''371 à 600;453;60;;;15;155;650;1
;'''601 à max;48;1.3;'''601 à 1028;733;105;;;20;84;660;4
;'''total 3786;<201;80.9;'''total 3779;112;136;-73 à 995;;25;86;670;3
adresse;intercal;intercal;fréquence1;intercal;fréquence;cumul et %;intercal;fréquence;30;81;680;1
3818575;1469;-1;683;-70;8;;0;13;35;54;690;2
844364;995;0;13;-60;5;;-1;°81;40;56;700;1
3816901;954;1;25;-50;8;;-2;1;45;59;710;1
3134490;938;2;34;-40;8;;-3;0;50;63;720;0
3477618;929;3;°41;-30;6;'''min à -1;-4;°421;55;67;730;0
1097019;885;4;°47;-20;21;683;-5;0;60;67;740;3
3856065;884;5;°33;-10;75;18.0%;-6;2;65;61;750;0
566184;881;6;20;0;565;;-7;5;70;52;760;1
1833839;873;7;16;10;289;;-8;°42;75;59;770;2
3136049;866;8;°27;20;239;;-9;0;80;52;780;3
2475546;802;9;20;30;167;;-10;9;85;58;790;3
93164;788;10;26;40;110;;-11;°26;90;64;800;0
409696;787;11;°41;50;122;;-12;0;95;51;810;1
400635;785;12;37;60;134;;-13;4;100;75;820;0
1366462;777;13;28;70;113;;-14;°13;105;49;830;0
3456663;777;14;°28;80;111;;-15;1;110;53;840;0
3312945;771;15;21;90;122;'''1 à 100;-16;3;115;49;850;0
550038;769;16;16;100;126;1533;-17;°14;120;45;860;0
2493887;767;17;°25;110;102;41%;-18;0;125;44;870;1
1410707;755;18;16;120;94;;-19;5;130;45;880;1
1423514;739;19;13;130;89;;-20;°7;135;48;890;3
2688282;734;20;°14;140;92;;-21;1;140;44;900;0
3627241;732;21;13;150;83;;-22;1;145;41;910;0
2706640;702;22;°20;160;87;;-23;°2;150;42;920;0
3937050;697;23;15;170;92;;-24;0;155;44;930;1
1011650;686;24;17;180;62;;-25;2;160;43;940;1
742860;682;25;°21;190;68;'''1 à 200;-26;°4;165;42;950;0
3424033;675;26;10;200;66;2368;-27;1;170;50;960;1
139185;669;27;18;210;45;62.5%;-28;0;175;31;970;0
880072;663;28;°20;220;56;;-29;°3;180;31;980;0
1976647;662;29;17;230;47;;-30;0;185;28;990;0
2640270;659;30;16;240;39;;-31;2;190;40;1000;1
90214;657;31;10;250;39;;-32;1;195;39;1010;0
961964;656;32;°14;260;43;;;664;200;27;1020;0
1209394;652;33;10;270;33;'''0 à 200;reste;32;205;19;1030;0
2536913;650;34;13;280;33;2381;total;696;210;26;1040;0
2591508;639;35;7;290;31;;;;215;25;1050;0
55947;637;36;10;300;29;;intercal;<u>frequencef;220;31;1060;0
1786743;636;37;°13;310;33;;600;3738;225;25;1070;0
2231609;636;38;11;320;22;;620;1;230;22;1080;0
3609912;633;39;10;330;15;;640;11;235;18;1090;0
3187318;631;40;°12;340;19;;660;5;240;21;1100;0
;;reste;2285;350;17;;680;4;245;24;1110;0
;;total;3786;360;14;'''201 à 370;700;3;250;15;1120;0
;;;;370;20;535;720;1;255;21;1130;0
;;;;380;9;14.1%;740;3;260;22;1140;0
;;;;390;9;;760;1;265;23;1150;0
'''adresse;'''intercaln;'''décalage;'''long;400;9;;780;5;270;10;1160;0
2068001;-137;shift2;1009;410;14;;800;3;275;15;1170;0
651352;-122;comp;;420;14;;820;1;280;18;1180;0
2462962;-120;comp;;430;9;;840;0;285;13;1190;0
1155908;-106;comp;;440;4;;860;0;290;18;1200;0
2381188;-104;comp;;450;15;;880;2;295;14;reste;1
3871151;-104;comp;;460;5;;900;3;300;15;total;3786
4292550;-73;shift2;662;470;5;'''371 à 600;920;0;305;18;;
664620;-70;comp;;480;4;139;940;2;310;15;;
3822351;-68;shift2;682;490;4;3.7%;960;1;315;10;;
3867765;-65;shift2;451;500;5;;980;0;320;12;;
1091959;-64;shift2;1268;510;7;;1000;1;325;8;;
3289914;-62;;;520;1;;;47;330;7;;
1568904;-61;;;530;3;;;;335;11;;
465562;-59;;;540;4;;;;340;8;;
2309068;-59;;;550;7;;;;345;12;;
780196;-58;;;560;2;;;;350;5;;
2759874;-55;;;570;1;;;;355;7;;
3267314;-53;;;580;5;'''601 à max;;;360;7;;
210683;-52;;;590;1;48;;;365;7;;
1365051;-52;;;600;2;1.3%;;;370;13;;
622208;-50;;;reste;48;;reste;1;reste;187;;
2342888;-49;;;total;3786;;total;3786;total;3786;;

rru autres intercalaires[modifier | modifier le wikicode]

rru;autres intercalaires;;adresses1;;;rru;autres intercalaires;;adresses2;;;rru;autres intercalaires;;adresses2;
;;;;;;;;;;;;;;;;
deb;°CDS;16232;163;comp;;deb;°CDS;1362782;177;comp;;deb;°CDS;2729598;449;
;&tRNA;17016;253;comp;;;repeat_region;1363865;208;;;;&tRNA;2731721;95;comp
fin;°CDS;17356;;;;fin;°CDS;1364648;;comp;;5s;$rRNA;2731893;119;comp
deb;°CDS;117072;37;;;deb;°CDS;1464820;283;comp;;23s;$rRNA;2732127;347;comp
;&tRNA;117325;299;comp;;;&tRNA;1465406;139;;;;&tRNA;2735247;66;comp
fin;°CDS;117701;;;;fin;°CDS;1465635;;comp;;;&tRNA;2735389;180;comp
deb;°CDS;149921;147;comp;;deb;°CDS;1499517;136;comp;;16s;$rRNA;2735646;972;comp
;&tRNA;151241;136;;;;regulatory;1501675;100;comp;;fin;°CDS;2738117;;comp
fin;°CDS;151454;;comp;;fin;°CDS;1502001;;;;deb;°CDS;2959802;354;comp
deb;°CDS;189941;841;;;deb;°CDS;1578910;1039;;;;&tRNA;2962229;171;comp
16s;$rRNA;192510;180;;;;repeat_region;1580591;284;;;fin;°CDS;2962475;;
;&tRNA;194189;66;;;fin;°CDS;1582246;;comp;;deb;°CDS;3124836;151;comp
;&tRNA;194332;347;;;deb;°CDS;1692844;162;comp;;;&tRNA;3125185;343;comp
23s;$rRNA;194755;119;;;;repeat_region;1694053;193;;;deb;°CDS;3125604;93;comp
5s;$rRNA;197647;96;;;fin;°CDS;1696161;;comp;;;&tRNA;3126888;27;comp
;&tRNA;197858;287;;;deb;°CDS;1706399;230;comp;;;&tRNA;3126989;166;comp
deb;°CDS;198222;222;comp;;;regulatory;1707586;93;;;deb;°CDS;3127241;57;
;repeat_region;198678;145;;;fin;°CDS;1707876;;;;;&tRNA;3128216;127;
fin;°CDS;200012;;comp;;deb;°CDS;1791953;116;;;fin;°CDS;3128419;;
deb;°CDS;211593;261;comp;;;&tRNA;1792276;131;comp;;deb;°CDS;3193350;430;comp
;repeat_region;213597;128;;;fin;°CDS;1792483;;comp;;;&tRNA;3194938;103;comp
fin;°CDS;214303;;comp;;deb;°CDS;1824299;98;;;fin;°CDS;3195117;;comp
deb;°CDS;305449;257;comp;;;&tRNA;1825837;150;;;deb;°CDS;3320745;90;
;&tRNA;306906;319;;;fin;°CDS;1826072;;;;;&tRNA;3322206;60;comp
fin;°CDS;307299;;comp;;deb;°CDS;1833133;284;;;fin;°CDS;3322342;;comp
deb;°CDS;322896;406;comp;;;&tRNA;1833693;70;;;deb;°CDS;3377932;140;comp
;&tRNA;324100;98;comp;;fin;°CDS;1833839;;comp;;;&tRNA;3378255;165;
fin;°CDS;324273;;comp;;deb;°CDS;1933548;85;;;;&tRNA;3378495;237;
deb;°CDS;362552;224;;;;&tRNA;1934224;63;;;deb;°CDS;3378807;234;
;&tRNA;363106;202;;;deb;°CDS;1934364;12;;;;&tRNA;3379605;77;
;&tRNA;363384;43;;;;&tRNA;1934676;396;;;fin;°CDS;3379759;;comp
fin;°CDS;363503;;comp;;fin;°CDS;1935149;;;;deb;°CDS;3399207;262;comp
deb;°CDS;407067;92;;;deb;°CDS;1959133;175;;;;&tRNA;3399757;56;comp
;&tRNA;407699;141;;;;&tRNA;1960034;215;;;fin;°CDS;3399890;;comp
fin;°CDS;407932;;;;fin;°CDS;1960326;;;;deb;°CDS;3490378;84;
deb;°CDS;419952;57;;;deb;°CDS;1996760;164;comp;;;&tRNA;3491233;407;
;repeat_region;420333;228;;;;&tRNA;1998244;261;;;fin;°CDS;3491715;;
fin;°CDS;423032;;comp;;fin;°CDS;1998595;;comp;;deb;°CDS;3514107;56;comp
deb;°CDS;466945;115;;;deb;°CDS;2008544;206;comp;;;regulatory;3515291;4;comp
;&tRNA;468041;83;comp;;;regulatory;2009119;129;;;;regulatory;3515401;88;comp
fin;°CDS;468210;;comp;;fin;°CDS;2009470;;;;fin;°CDS;3515601;;comp
deb;°CDS;529650;67;;;deb;°CDS;2031997;123;;;deb;°CDS;3523910;371;
;repeat_region;530056;180;;;;&tRNA;2032987;186;comp;;;repeat_region;3524497;79;
fin;°CDS;530734;;comp;;fin;°CDS;2033249;;comp;;fin;°CDS;3525452;;comp
deb;°CDS;536858;111;comp;;deb;°CDS;2093327;295;comp;;deb;°CDS;3705744;56;comp
;regulatory;537266;38;;;;&tRNA;2094273;81;;;;regulatory;3707042;399;comp
fin;°CDS;537511;;;;;&tRNA;2094428;150;;;fin;°CDS;3707518;;
deb;°CDS;559038;239;comp;;fin;°CDS;2094653;;;;deb;°CDS;3719367;163;comp
;&tRNA;559697;170;;;deb;°CDS;2304404;89;comp;;;&tRNA;3719917;95;comp
fin;°CDS;559943;;;;;&tRNA;2305924;178;comp;;fin;°CDS;3720086;;comp
deb;°CDS;571949;20;;;fin;°CDS;2306189;;;;deb;°CDS;3805869;130;
;regulatory;572902;194;;;deb;°CDS;2318681;138;comp;;5s;$rRNA;3806944;116;comp
fin;°CDS;573329;;;;;regulatory;2319857;73;;;23s;$rRNA;3807175;347;comp
deb;°CDS;794877;217;comp;;fin;°CDS;2320063;;;;;&tRNA;3810295;66;comp
;&tRNA;795406;86;;;deb;°CDS;2331183;73;;;;&tRNA;3810437;180;comp
fin;°CDS;795583;;;;;&tRNA;2331595;126;;;16s;$rRNA;3810694;999;comp
deb;°CDS;908584;1193;comp;;fin;°CDS;2331798;;comp;;fin;°CDS;3813192;;
16s;$rRNA;911379;178;;;deb;°CDS;2411337;202;comp;;deb;°CDS;3824154;103;comp
;&tRNA;913057;66;;;;&tRNA;2412007;75;comp;;;&tRNA;3825931;387;comp
;&tRNA;913200;346;;;fin;°CDS;2412159;;comp;;fin;°CDS;3826395;;
23s;$rRNA;913622;118;;;deb;°CDS;2550773;186;comp;;deb;°CDS;3996560;58;comp
5s;$rRNA;916513;95;;;;regulatory;2551172;147;;;;ncRNA;3998598;106;comp
;&tRNA;916723;738;;;fin;°CDS;2551477;;;;fin;°CDS;3998802;;comp
fin;°CDS;917538;;;;deb;°CDS;2559473;36;;;deb;°CDS;4021982;27;
deb;°CDS;988887;204;;;;tmRNA;2560658;131;;;;&tRNA;4023191;224;comp
;repeat_region;989382;533;;;fin;°CDS;2561126;;;;fin;°CDS;4023502;;
fin;°CDS;992381;;comp;;deb;°CDS;2667051;354;;;deb;°CDS;4058818;187;comp
deb;°CDS;1144656;314;comp;;;repeat_region;2668113;204;;;;&tRNA;4059305;179;
;ncRNA;1145438;15;comp;;fin;°CDS;2669862;;comp;;fin;°CDS;4059560;;comp
fin;°CDS;1145882;;comp;;deb;°CDS;2714978;129;;;deb;°CDS;4105626;721;comp
deb;°CDS;1159249;71;;;;repeat_region;2715965;262;;;;&tRNA;4108039;148;comp
;&tRNA;1160163;117;;;fin;°CDS;2716563;;;;fin;°CDS;4108262;;
fin;°CDS;1160356;;;;;;;;;;deb;°CDS;4261100;269;comp
deb;°CDS;1339162;168;;;;;;;;;;&tRNA;4262308;118;
;regulatory;1340533;238;;;;;;;;;fin;°CDS;4262501;;
fin;°CDS;1340988;;;;;;;;;;;;;;

rru intercalaires tRNA[modifier | modifier le wikicode]

rru;intercalaires tRNA;;;;;;;;;
comp’;entre aas;;cds aa deb;;cds aa fin ;;deb;fin;;
;;;;;;;;;;
;66;;163;comp’;253;;12;56;'''deb;
;202;comp’;37;comp’;299;;57;60;<201;15
;66;comp’;147;comp’;136;;71;63;total;24
;81;;;;287;;73;75;taux;63%
;66;comp’;257;comp’;319;;84;83;;
;27;;406;;98;;85;86;'''fin;
;165;;224;comp’;43;;89;95;<201;18
;66;;92;;141;;92;98;total;25
;;comp’;115;;83;;93;103;taux;72%
;;comp’;239;;170;;98;117;;
;;comp’;217;;86;;103;118;'''total;
;;;;;738;;151;127;<201;33
;;;71;;117;;163;131;total;49
;;comp’;283;comp’;139;;163;141;taux;67%
;;comp’;116;;131;;175;150;;
;;;98;;150;;202;150;;
;;;284;comp’;70;;224;170;;
;;;85;;63;;234;186;;
;;;12;;396;;262;215;;
;;;175;;215;;284;237;;
;;comp’;164;comp’;261;;354;287;;
;;comp’;123;;186;;406;343;;
;;comp’;295;;150;;430;396;;
;;;89;comp’;178;;721;407;;
;;;73;comp’;126;;'''-;738;'''comp’;'''cumuls
;;;202;;75;;27;43;;
;;comp’;449;;;;37;70;'''deb;
;;;354;comp’;171;;90;77;<201;10
;;;151;;343;;115;126;total;17
;;;93;comp’;166;;116;136;taux;59%
;;;57;;127;;123;139;;
;;;430;;103;;140;148;'''fin;
;;comp’;90;;60;;147;166;<201;11
;;comp’;140;;237;;164;171;total;17
;;;234;comp’;77;;187;178;taux;65%
;;;262;;56;;217;179;;
;;;84;;407;;239;224;'''total;
;;;163;;95;;257;253;<201;21
;;;103;comp’;387;;269;261;total;34
;;comp’;27;comp’;224;;283;299;taux;62%
;;comp’;187;comp’;179;;295;319;;
;;;721;comp’;148;;449;387;;
;;comp’;269;;118;;;;;
;;;;;;;;;;
;;;;;;;;;;
;;;deb;fin;total;;;;;
;;<201;25;29;54;;;;;
;;total;41;42;83;;;;;
;;taux;61%;69%;65%;;;;;

oan[modifier | modifier le wikicode]

oan opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;oan;;genome;;;;;;;;;
56.1%GC;27.12.19 Paris;16s  4 ;61 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Ochrobactrum anthropi ATCC 49188 ;;;;;;;;;;;;
chromosom1;;;;;;;;;;;;
;34057..34446;;cds;;224;224;;;130;;TIGR02300 family protein;*
;34671..34746;;gcc;@1;-40;*-40;;;;;;*
;34707..35480;;cds;;;;;;258;;glutathione S-transferase family protein;*
;;;;;;;;;;;;*
;223549..224394;;cds;;164;164;;;282;;3'(2'),5'-bisphosphate nucleotidase CysQ;*
;224559..224635;;ccg;;109;109;;;;;;*
comp;224745..225806;;cds;;;;;;354;;site-specific integrase;*
;;;;;;;;;;;;*
comp;337757..338197;;cds;;158;158;;;147;;DMT family transporter;*
comp;338356..338431;;ttc;;171;171;;;;;;*
comp;338603..338818;;cds;;;;;;72;;DNA gyrase inhibitor YacG;*
;;;;;;;;;;;;*
comp;344419..344598;;cds;;147;147;;;60;;hp;*
;344746..344820;;acc;;397;397;;;;;;*
;345218..346030;;cds;;;;;;271;;DUF2189 domain-containing protein;*
;;;;;;;;;;;;*
comp;351922..353328;;cds;;167;167;;;469;;deoxyribodipyrimidine photo-lyase;*
comp;353496..353572;;cgt;;159;159;;;;;;*
comp;353732..355285;;cds;;;;;;*518;;HAMP domain-containing histidine kinase;*
;;;;;;;;;;;;*
comp;725472..726479;;cds;;219;219;;;336;;glycosyltransferase family 4 protein;*
;726699..726773;;caa;;61;61;;;;;;*
comp;726835..727413;;cds;;;;;;193;;hp;*
;;;;;;;;;;;;*
comp;934613..934987;;cds;;333;333;;;125;;transposase;*
comp;935321..935397;;agg;;114;114;;;;;;*
comp;935512..936675;;cds;;;;;;388;;amidohydrolase;*
;;;;;;;;;;;;*
;1049919..1051202;;cds;;24;24;;;428;;cystathionine gamma-synthase family protein;*
comp;1051227..1051311;;ttg;@2;593;*593;;;;;;*
comp;1051905..1053539;;cds;;;;;;*545;;phosphoethanolamine transferase;*
;;;;;;;;;;;;*
comp;1081066..1083021;;cds;;998;*998;;;*652;;M23 family metallopeptidase;*
;1084020..1085508;;16s;;268;;;;1489;;;*
;1085777..1085853;;atc;;11;;;11;;;;*
;1085865..1085940;;gca;;39;39;;;;;;*
>comp;1085980..1086168;;cds;@3;38;38;;;63;;P-hp;*
;1086207..1089125;;23s;;186;;;;2919;;;*
;1089312..1089426;;5s;;54;;;;115;;;*
;1089481..1089557;;atgf;;363;363;;;;;;*
;1089921..1090091;;cds;;;;;;57;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
;1096454..1096912;;cds;;7;7;;;153;;hp;*
comp;1096920..1097009;;tcg;;352;352;;;;;;*
;1097362..1097751;;cds;;;;;;130;;50S ribosomal protein L21;*
;;;;;;;;;;;;*
;1311344..1311823;;cds;;211;211;;;160;;hp;*
;1312035..1312109;;gag;;88;88;;;;;;*
;1312198..1312467;;cds;;;;;;90;;hp;*
;;;;;;;;;;;;*
;1344750..1345565;;cds;;677;*677;;;272;;IclR family transcriptional regulator;*
;1346243..1347731;;16s;;268;;;;1489;;;*
;1348000..1348076;;atc;;11;;;11;;;;*
;1348088..1348163;;gca;;39;39;;;;;;*
>comp;1348203..1348391;;cds;;38;38;;;63;;P-hp;*
;1348430..1351348;;23s;;186;;;;2919;;;*
;1351535..1351649;;5s;;54;;;;115;;;*
;1351704..1351780;;atgf;;360;360;;;;;;*
;1352141..1353082;;cds;;;;;;314;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
;1354558..1355604;;cds;;85;85;;;349;;polysaccharide deacetylase family protein;*
comp;1355690..1355764;;ggc;;136;136;;;;;;*
comp;1355901..1357280;;cds;;;;;;460;;MFS transporter;*
;;;;;;;;;;;;*
comp;1386666..1387982;;cds;;819;*819;;;439;;hp;*
comp;1388802..1388891;;tcc;;374;374;;;;;;*
;1389266..1389589;;cds;;;;;;108;;hp;*
;;;;;;;;;;;;*
comp;1405236..1405859;;cds;;139;139;;;208;;5,6-dimethylbenzimidazole synthase;*
comp;1405999..1406085;;ctg;;146;146;;;;;;*
comp;1406232..1406852;;cds;;;;;;207;;2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;*
;;;;;;;;;;;;*
comp;1604615..1604854;;cds;;26;26;;;80;;hp;*
comp;1604881..1604958;;atgj;;10;10;;;;;;*
comp;1604969..1605214;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
;1639492..1640289;;cds;;-44;*-44;;;266;;hp;*
comp;1640246..1640322;;atgj;;55;55;;;;;;*
;1640378..1640572;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;1778816..1779571;;cds;;385;385;;;252;;SIMPL domain-containing protein;*
;1779957..1780033;;atgi;;265;265;;;;;;*
;1780299..1780844;;cds;;;;;;182;;sigma-70 family RNA polymerase sigma factor;*
;;;;;;;;;;;;*
>;1945985..1946374;;cds;;721;*721;;;130;;P-hp;*
comp;1947096..1947171;;aag;;-38;*-38;;;;;;*
comp;1947134..1947319;;cds;;;;;;62;;hp;*
;;;;;;;;;;;;*
comp;2014813..2015097;;cds;;103;103;;;95;;DUF2218 domain-containing protein;*
comp;2015201..2015275;;gaa;+;146;;146;;;;;*
comp;2015422..2015496;;gaa;2 gaa;200;200;;;;;;*
comp;2015697..2016962;;cds;;;;;;422;;DUF882 domain-containing protein;*
;;;;;;;;;;;;*
comp;2040234..2040453;;cds;;91;91;;;73;;hp;*
;2040545..2040629;;tac;;24;;24;;;;;*
;2040654..2040727;;gga;;6;6;;;;;;*
comp;2040734..2040916;;cds;;-50;*-50;;;61;;hp;*
;2040867..2042042;;cds;;65;65;;;392;;elongation factor Tu;*
;2042108..2042183;;tgg;;420;*420;;;;;;*
;2042604..2042804;;cds;;;;;;67;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
;2168416..2168658;;cds;;28;28;;;81;;PepSY domain-containing protein;*
comp;2168687..2168760;;ggg;;289;289;;;;;;*
;2169050..2169946;;cds;;;;;;299;;lipid kinase;*
;;;;;;;;;;;;*
comp;2244184..2245050;;cds;;112;112;;;289;;mechanosensitive ion channel;*
comp;2245163..2245248;;tta;;200;200;;;;;;*
;2245449..2246705;;cds;;;;;;419;;threonine ammonia-lyase IlvA;*
;;;;;;;;;;;;*
;2267888..2268835;;cds;;305;305;;;316;;patatin family protein;*
;2269141..2269225;;ctc;;66;66;;;;;;*
comp;2269292..2270185;;cds;;;;;;298;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
;2332394..2333530;;cds;;393;393;;;379;;glycosyltransferase family 2 protein;*
comp;2333924..2334000;;cgg;;169;169;;;;;;*
comp;2334170..2335792;;cds;;;;;;*541;;ABC-F family ATP-binding cassette domain-containing protein;*
;;;;;;;;;;;;*
comp;2339396..2340514;;cds;;1650;*1650;;;373;;porin;*
comp;2342165..2342239;;gtg;;178;178;;;;;;*
comp;2342418..2344424;;cds;;;;;;*669;;murein L,D-transpeptidase;*
;;;;;;;;;;;;*
comp;2369668..2370441;;cds;;152;152;;;258;;NAD kinase;*
;2370594..2370669;;aca;;987;*987;;;;;;*
comp;2371657..2372076;;cds;;;;;;140;;SUF system Fe-S cluster assembly protein;*
;;;;;;;;;;;;*
comp;2442729..2443145;;cds;;299;299;;;139;;hp;*
comp;2443445..2443519;;atgf;;70;70;;;;;;*
<comp;2443590..2443799;;cds;;;;;;70;;helix-turn-helix domain-containing protein;*
;;;;;;;;;;;;*
comp;2449947..2451311;;cds;;156;156;;;455;;tyrosine-type recombinase/integrase;*
comp;2451468..2451550;;cta;;236;236;;;;;;*
comp;2451787..2452356;;cds;;;;;;190;;hp;*
;;;;;;;;;;;;*
comp;2548914..2550098;;cds;;513;*513;;;395;;alpha/beta hydrolase;*
comp;2550612..2550688;;gac;+;245;;245;;;;;*
comp;2550934..2551010;;gac;2 gac;328;328;;;;;;*
;2551339..2551956;;cds;;;;;;206;;TetR/AcrR family transcriptional regulator;*
;;;;;;;;;;;;*
;2604616..2605908;;cds;;824;*824;;;431;;FAD-binding oxidoreductase;*
comp;2606733..2606808;;gta;;264;264;;;;;;*
comp;2607073..2607996;;cds;;;;;;308;;sugar kinase;*
;;;;;;;;;;;;*
;2641040..2641360;;cds;;97;97;;;107;;YnfA family protein;*
;2641458..2641534;;ccc;;94;94;;;;;;*
;2641629..2642357;;cds;;;;;;243;;SDR family oxidoreductase;*
;;;;;;;;;;;;*
;2696299..2697183;;cds;;54;54;;;295;;transcriptional regulator GcvA;*
comp;2697238..2697314;;aga;;123;123;;;;;;*
comp;2697438..2697743;;cds;;156;156;;;102;;ETC complex I subunit;*
comp;2697900..2697976;;cca;;186;186;;;;;;*
;2698163..2698309;;cds;;;;;;49;;hp;*
;;;;;;;;;;;;*
comp;2771579..2772697;;cds;;584;*584;;;373;;porin;*
;2773282..2773372;;agc;;203;203;;;;;;*
;2773576..2774643;;cds;;;;;;356;;porin;*
chromosom2;;;;;;;;;;;;*
;149537..151504;;cds;;355;355;;;*656;;selenocysteine-specific translation elongation factor;*
;151860..151955;;tga;;14;14;;;;;;*
comp;151970..152605;;cds;;;;;;212;;lipase;*
;;;;;;;;;;;;*
comp;298403..299422;;cds;;300;300;;;340;;TerC family protein;*
comp;299723..299796;;cag;;361;361;;;;;;*
comp;300158..300460;;cds;;;;;;101;;DUF1127 domain-containing protein;*
;;;;;;;;;;;;*
;455428..456111;;cds;;713;*713;;;228;;FkbM family methyltransferase;*
;456825..458313;;16s;;268;;;;1489;;;*
;458582..458658;;atc;;11;;;11;;;;*
;458670..458745;;gca;;39;39;;;;;;*
>comp;458785..458973;;cds;;38;38;;;63;;P-hp;*
;459012..461930;;23s;;186;;;;2919;;;*
;462117..462231;;5s;;54;;;;115;;;*
;462286..462362;;atgf;;-44;*-44;;;;;;*
comp;462319..463974;;cds;;;;;;*552;;recombinase family protein;*
;;;;;;;;;;;;*
comp;572059..572721;;cds;;545;*545;;;221;;response regulator transcription factor;*
comp;573267..573357;;other;@4;620;*620;;;;;;*
comp;573978..575285;;cds;;;;;;436;;SidA/IucD/PvdA family monooxygenase;*
;;;;;;;;;;;;*
comp;611464..611742;;cds;;88;88;;;93;;hp;*
comp;611831..611905;;ggc;;387;387;;;;;;*
;612293..612814;;cds;;;;;;174;;prolyl-tRNA synthetase associated domain-containing protein;*
;;;;;;;;;;;;*
;991265..991999;;cds;;217;217;;;245;;alpha/beta hydrolase;*
comp;992217..992306;;tca;;323;323;;;;;;*
;992630..992884;;cds;;;;;;85;;DUF2171 domain-containing protein;*
;;;;;;;;;;;;*
comp;1031528..1032946;;cds;;607;*607;;;473;;PepSY domain-containing protein;*
comp;1033554..1033629;;aaa;;327;327;;;;;;*
;1033957..1035651;;cds;;;;;;*565;;membrane protein;*
;;;;;;;;;;;;*
;1067405..1068742;;cds;;131;131;;;446;;DNA polymerase IV;*
;1068874..1068947;;tgc;;739;*739;;;;;;*
;1069687..1069905;;cds;;;;;;73;;hp;*
;;;;;;;;;;;;*
;1081639..1082031;;cds;;103;103;;;131;;hp;*
comp;1082135..1082209;;aac;;168;168;;;;;;*
;1082378..1082653;;cds;;;;;;92;;hp;*
;;;;;;;;;;;;*
comp;1333375..1333587;;cds;;209;209;;;71;;hp;*
comp;1333797..1333873;;cac;;352;352;;;;;;*
;1334226..1337393;;cds;;;;;;*1056;;PAS domain S-box protein;*
;;;;;;;;;;;;*
;1473437..1474405;;cds;;269;269;;;323;;nitronate monooxygenase;*
;1474675..1474750;;acg;;156;156;;;;;;*
>comp;1474907..1475239;;cds;;;;;;111;;DNA adenine methylase;*
;;;;;;;;;;;;*
comp;1597496..1597666;;cds;;363;363;;;57;;LysR family transcriptional regulator;*
comp;1598030..1598106;;atgf;;54;;;;;;;*
comp;1598161..1598275;;5s;;186;;;;115;;;*
comp;1598462..1601380;;23s;;38;38;;;2919;;;*
<;1601419..1601607;;cds;;39;39;;;63;;P-hp;*
comp;1601647..1601722;;gca;;11;;;11;;;;*
comp;1601734..1601810;;atc;;268;;;;;;;*
comp;1602079..1603567;;16s;;743;*743;;;1489;;;*
;1604311..1605192;;cds;;;;;;294;;ATPase;*
;;;;;;;;;;;;*
;1720169..1720531;;cds;;113;113;;;121;;response regulator;*
;1720645..1720719;;gtc;;465;*465;;;;;;*
;1721185..1721838;;cds;;;;;;218;;protein-L-isoaspartate(D-aspartate) O-methyltransferase;*

oan cumuls[modifier | modifier le wikicode]

oan cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;4;1;;4;1;5;1;;100;25;1;0
;16atcgca-cds;4;20;;;50;15;40;;200;20;30;0
;-;;40;1;;100;12;80;;300;21;60;4
;-;;60;;;150;12;120;;400;15;90;18
;max a;3;80;;;200;15;160;;500;11;120;8
;a doubles;0;100;;;250;7;200;;600;5;150;9
;spéciaux;0;120;;;300;6;240;;700;3;180;3
;total aas;12;140;;;350;5;280;;800;0;210;6
sans ;opérons;45;160;1;;400;12;320;;900;0;240;4
;1 aa;42;180;;;450;1;360;;1000;0;270;6
;max a;2;200;;;500;1;400;;1100;1;300;8
;a doubles;2;;1;;;16;;;;0;;35
;total aas;48;;3;4;;107;;0;;101;;101
total aas;;60;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;138;11;;258;;;;256;;
;;;variance;111;0;;268;;;;180;;
sans jaune;;;moyenne;;;;174;;;;218;;150
;;;variance;;;;117;;;;132;;81

oan blocs[modifier | modifier le wikicode]

oan blocs;;;;
Constantes;;;;
cds;;intercal;cdsa;
16s;;268;1489;
atc;;11;;
gca;;39;;
cds;;38;63;P-hp
23s;;186;2919;
5s;;54;115;
atgf;;;;
cds;;;;
Variations;;;;
blocs 16s;;intercal;cdsa;
1084020..1085508;;998;652;M23 family metallopeptidase
;;363;57;LysR family transcriptional regulator
;;;;
1346243..1347731;;677;272;IclR family transcriptional regulator
;;360;314;LysR family transcriptional regulator
;;;;
456825..458313;;713;228;FkbM family methyltransferase
;;-44;552;recombinase family protein
;;;;
1602079..1603567;;743;294;ATPase
;;363;57;LysR family transcriptional regulator

oan distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;;;;;;;;;;atgi;;tct;;tat;;atgf;4
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;;;;;;;;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;;;;;;;;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;;;;;;;;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;1;tgc;;;;;;;;;;;;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;1;agc;1;;atc;;acc;;aac;;agc;;;;;;;;;;;;atc;;acc;;aac;;agc;
ctc;1;ccc;1;cac;1;cgt;1;;ctc;;ccc;;cac;;cgt;;;;;;;;;;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;2;;gtc;;gcc;;gac;2;ggc;;;;;;;;;;;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;1;;tta;;tca;;taa;;tga;;;;;;;;;;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;;;;;;;;;;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;;;;;;;;;;;;cta;;cca;;caa;;cga;
gta;1;gca;;gaa;;gga;;;gta;;gca;;gaa;2;gga;1;;;;;;;;;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;;;;;;;;;;ttg;;tcg;;tag;;tgg;
atgj;2;acg;1;aag;1;agg;1;;atgj;;acg;;aag;;agg;;;;;;;;;;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;1;cag;1;cgg;1;;ctg;;ccg;;cag;;cgg;;;;;;;;;;;;ctg;;ccg;;cag;;cgg;
gtg;1;gcg;;gag;1;ggg;1;;gtg;;gcg;;gag;;ggg;;;;;;;;;;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;;;;;;;;;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
oan;;41;;;;;41;;oan;6;;;;;;6;;;;;;;;;;;oan;;;;4;;;4
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4 1-3aas;;;

abq[modifier | modifier le wikicode]

abq opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;abq;;genome;;;;;;;;;
68.45%GC;29.12.19 Paris;16s  9 ;88 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Azospirillum brasilense strain Az39;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
;125527..126444;;cds;;127;127;;;306;;restriction endonuclease;*
comp;126572..126647;;gcg;;206;206;;;;;;*
;126854..127138;;cds;;;;;;95;;YggT family protein;*
;;;;;;;;;;;;*
comp;163237..164982;;cds;;175;175;;;582;;hydrogenase maturation nickel metallochaperone HypA;*
;165158..165234;;agg;;59;59;;;;;;*
;165294..166022;;cds;;;;;;243;;SDR family NAD(P)-dependent oxidoreductase;*
;;;;;;;;;;;;*
comp;188235..189860;;cds;;42;42;;;542;;glycosyltransferase;*
comp;189903..189977;;acg;;81;81;;;;;;*
comp;190059..191987;;cds;;;;;;643;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;250833..251111;;cds;;169;169;;;93;;hp;*
comp;251281..251356;;gcc;;141;141;;;;;;*
comp;251498..251893;;cds;;;;;;132;;TIGR02300 family protein;*
;;;;;;;;;;;;*
comp;458142..458459;;cds;;209;209;;;106;;50S ribosomal protein L21;*
;458669..458758;;tcg;;63;63;;;;;;*
comp;458822..459664;;cds;;;;;;281;;alpha/beta hydrolase fold domain-containing protein;*
;;;;;;;;;;;;*
comp;496776..497171;;cds;;162;162;;;132;;cupin domain-containing protein;*
comp;497334..497420;;ttg;;137;137;;;;;;*
;497558..498085;;cds;;;;;;176;;disulfide bond formation protein B;*
;;;;;;;;;;;;*
comp;615937..616350;;cds;;121;121;;;138;;hp;*
comp;616472..616548;;ccg;+;206;;206;;;;;*
comp;616755..616831;;ccg;2 ccg;109;109;;;;;;*
comp;616941..617957;;cds;;;;;;339;;farnesyltranstransferase;*
;;;;;;;;;;;;*
comp;748703..749161;;cds;;38;38;;;153;;hp;*
comp;749200..749275;;aca;;91;91;;;;;;*
comp;749367..750221;;cds;;144;144;;;285;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;750366..750451;;tac;;60;;60;;;;;*
;750512..750585;;gga;;81;81;;;;;;*
;750667..751857;;cds;;153;153;;;397;;elongation factor Tu;*
;752011..752086;;tgg;;69;69;;;;;;*
;752156..752353;;cds;;;;;;66;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
comp;794457..795983;;cds;;296;296;;;509;;methyltransferase domain-containing protein;*
;796280..796355;;aag;+;76;;76;;;;;*
;796432..796507;;aag;2 aag;109;109;;;;;;*
comp;796617..797057;;cds;;;;;;147;;MaoC family dehydratase;*
;;;;;;;;;;;;*
;870412..872373;;cds;;159;159;;;654;;RNA polymerase sigma factor RpoD;*
;872533..872608;;atgi;;5;5;;;;;;*
comp;872614..873093;;cds;;134;134;;;160;;GNAT family N-acetyltransferase;*
comp;873228..873304;;cgt;;212;212;;;;;;*
;873517..874023;;cds;;;;;;169;;hp;*
;;;;;;;;;;;;*
;931962..933011;;cds;;68;68;;;350;;low specificity L-threonine aldolase;*
;933080..933155;;gag;+;38;;38;;;;;*
;933194..933269;;gag;2 gag;72;72;;;;;;*
comp;933342..934340;;cds;;;;;;333;;transglycosylase SLT domain-containing protein;*
;;;;;;;;;;;;*
;997881..998357;;cds;;246;246;;;159;;peptidoglycan-associated lipoprotein Pal;*
comp;998604..998678;;acc;;175;175;;;;;;*
comp;998854..1000815;;cds;;;;;;654;;polysaccharide biosynthesis protein;*
;;;;;;;;;;;;*
comp;1164137..1165048;;cds;;159;159;;;304;;DUF3108 domain-containing protein;*
;1165208..1165282;;gtg;+;132;;132;;;;;*
;1165415..1165489;;gtg;2 gtg;231;231;;;;;;*
;1165721..1165885;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
;1242416..1242919;;cds;;85;85;;;168;;MerR family transcriptional regulator;*
;1243005..1243081;;ccc;;139;139;;;;;;*
comp;1243221..1244999;;cds;;;;;;593;;cyclic nucleotide-binding domain-containing protein;*
;;;;;;;;;;;;*
comp;1353398..1353895;;cds;;118;118;;;166;;hp;*
;1354014..1354091;;cca;;49;49;;;;;;*
;1354141..1354437;;cds;;10;10;;;99;;ETC complex I subunit;*
;1354448..1354524;;aga;;443;*443;;;;;;*
;1354968..1355213;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
comp;1370270..1370500;;cds;;196;196;;;77;;hp;*
comp;1370697..1370772;;aac;@2;220;;220;;;;;*
comp;1370993..1371066;;tgc;;218;218;;;;;;*
;1371285..1371941;;cds;;;;;;219;;protein-L-isoaspartate O-methyltransferase;*
;;;;;;;;;;;;*
comp;1427443..1427733;;cds;;236;236;;;97;;YkgJ family cysteine cluster protein;*
comp;1427970..1428085;;5s;;129;;;;116;;;*
comp;1428215..1430967;;23s;;266;;;;2753;;;*
comp;1431234..1431309;;gca;;30;;;30;;;;*
comp;1431340..1431416;;atc;;108;;;;;;;*
comp;1431525..1433015;;16s;;779;*779;;;1491;;;*
;1433795..1437778;;cds;;;;;;1328;;non-ribosomal peptide synthetase;*
;;;;;;;;;;;;*
comp;1576457..1577296;;cds;;243;243;;;280;;aldo/keto reductase;*
comp;1577540..1577615;;gaa;;123;123;;;;;;*
comp;1577739..1579538;;cds;;;;;;600;;single-stranded-DNA-specific exonuclease RecJ;*
;;;;;;;;;;;;*
comp;1723089..1723457;;cds;;344;344;;;123;;NADH-quinone oxidoreductase subunit A;*
comp;1723802..1723878;;gac;;164;;164;;;;;*
comp;1724043..1724117;;gta;;106;106;;;;;;*
comp;1724224..1724496;;cds;;;;;;91;;HU family DNA-binding protein;*
;;;;;;;;;;;;*
comp;1730385..1731719;;cds;;91;91;;;445;;trigger factor;*
comp;1731811..1731895;;cta;;173;173;;;;;;*
comp;1732069..1733634;;cds;;;;;;522;;malonyl-CoA decarboxylase;*
;;;;;;;;;;;;*
comp;1733741..1735207;;cds;;129;129;;;489;;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;*
comp;1735337..1735412;;cac;+;109;;109;;;;;*
comp;1735522..1735597;;cac;2 cac;337;337;;;;;;*
;1735935..1736273;;cds;;;;;;113;;P-II family nitrogen regulator;*
;;;;;;;;;;;;*
;1951126..1951752;;cds;;149;149;;;209;;nitrogen fixation protein NifQ;*
;1951902..1951987;;tac;;74;74;;;;;;*
comp;1952062..1952424;;cds;;;;;;121;;hp;*
;;;;;;;;;;;;*
;1996903..1997244;;cds;;595;*595;;;114;;hp;*
comp;1997840..1997914;;atgj;;131;131;;;;;;*
comp;1998046..1999179;;cds;;;;;;378;;tRNA 2-thiouridine(34) synthase MnmA;*
;;;;;;;;;;;;*
;2086487..2088658;;cds;;156;156;;;724;;malate synthase G;*
comp;2088815..2088889;;gtc;;234;234;;;;;;*
;2089124..2090002;;cds;;;;;;293;;N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;2303404..2303880;;cds;;414;*414;;;159;;bacterioferritin;*
comp;2304295..2304377;;tta;;406;*406;;;;;;*
comp;2304784..2305029;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
;2482875..2484518;;cds;;365;*365;;;548;;recombinase family protein;*
comp;2484884..2484974;;tcc;;120;120;;;;;;*
comp;2485095..2485898;;cds;;;;;;268;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;2640759..2641325;;cds;;149;149;;;189;;prolyl-tRNA synthetase associated domain-containing protein;*
;2641475..2641549;;ggc;;688;*688;;;;;;*
;2642238..2642915;;cds;;;;;;226;;dimethylmenaquinone methyltransferase;*
;;;;;;;;;;;;*
comp;2764482..2765567;;cds;;659;*659;;;362;;hp;*
comp;2766227..2766300;;ggg;;35;35;;;;;;*
comp;2766336..2766995;;cds;;;;;;220;;N-acetyltransferase;*
;;;;;;;;;;;;*
;2781933..2783774;;cds;;187;187;;;614;;EAL and GGDEF domain-containing protein;*
comp;2783962..2784077;;5s;;129;;;;116;;;*
comp;2784207..2786959;;23s;;255;;;;2753;;;*
comp;2787215..2787290;;gca;;30;;;30;;;;*
comp;2787321..2787397;;atc;;108;;;;;;;*
comp;2787506..2789006;;16s;;496;*496;;;1501;;;*
comp;2789503..2790207;;cds;;;;;;235;;phosphatase PAP2 family protein;*
;;;;;;;;;;;;*
;2843264..2843443;;cds;;77;77;;;60;;hp;*
comp;2843521..2843597;;cgt;;170;170;;;;;;*
;2843768..2844268;;cds;;;;;;167;;xanthine phosphoribosyltransferase;*
plasmide2;;;;;;;;;;;;*
comp;51090..51836;;cds;;481;*481;;;249;;sigma-70 family RNA polymerase sigma factor;*
comp;52318..52393;;tgg;;363;*363;;;;;;*
;52757..53587;;cds;;;;;;277;;hp;*
;;;;;;;;;;;;*
comp;809229..810019;;cds;;870;*870;;;264;;IS5 family transposase;*
comp;810890..810966;;atgf;;96;;;;;;;*
comp;811063..811178;;5s;;127;;;;116;;;*
comp;811306..814058;;23s;;266;;;;2753;;;*
comp;814325..814400;;gca;;30;;;30;;;;*
comp;814431..814507;;atc;;108;;;;;;;*
comp;814616..816106;;16s;;452;*452;;;1491;;;*
comp;816559..817443;;cds;;;;;;295;;helix-turn-helix domain-containing protein;*
plasmide4;;;;;;;;;;;;*
;196992..199346;;cds;;148;148;;;785;;mechanosensitive ion channel;*
;199495..199581;;ctg;;30;;30;;;;;*
;199612..199687;;gcc;;188;188;;;;;;*
;199876..201333;;cds;;;;;;486;;hp;*
;;;;;;;;;;;;*
;237538..238578;;cds;;92;92;;;347;;response regulator;*
comp;238671..238747;;cgg;;96;96;;;;;;*
comp;238844..239821;;cds;;;;;;326;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;257739..258470;;cds;;125;125;;;244;;lipoyl(octanoyl) transferase LipB;*
;258596..258682;;ctc;;123;123;;;;;;*
comp;258806..259108;;cds;;;;;;101;;STAS domain-containing protein;*
;;;;;;;;;;;;*
comp;399367..400527;;cds;;278;278;;;387;;PQQ-dependent sugar dehydrogenase;*
comp;400806..400921;;5s;;129;;;;116;;;*
comp;401051..403803;;23s;;255;;;;2753;;;*
comp;404059..404134;;gca;;30;;;30;;;;*
comp;404165..404241;;atc;;108;;;;;;;*
comp;404350..405850;;16s;;502;*502;;;1501;;;*
comp;406353..406547;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
;504531..504893;;cds;;82;82;;;121;;response regulator;*
;504976..505051;;aac;;3;;3;;;;;*
;505055..505131;;gac;;4;;4;;;;;*
;505136..505210;;ggc;;102;102;;;;;;*
comp;505313..506080;;cds;;83;83;;;256;;helix-turn-helix transcriptional regulator;*
;506164..506790;;cds;;202;202;;;209;;pyridoxamine 5'-phosphate oxidase;*
comp;506993..507108;;5s;;127;;;;116;;;*
comp;507236..509988;;23s;;266;;;;2753;;;*
comp;510255..510330;;gca;;30;;;30;;;;*
comp;510361..510437;;atc;;110;;;;;;;*
comp;510548..512038;;16s;;615;*615;;;1491;;;*
;512654..513568;;cds;;;;;;305;;lytic transglycosylase domain-containing protein;*
;;;;;;;;;;;;*
comp;588108..590768;;cds;;340;340;;;887;;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;*
;591109..591184;;ttc;;286;286;;;;;;*
;591471..592979;;cds;;;;;;503;;FAD-binding oxidoreductase;*
plasmide5;;;;;;;;;;;;*
;86421..87089;;cds;;455;*455;;;223;;RraA family protein;*
;87545..87619;;ggc;;193;193;;;;;;*
;87813..88865;;cds;;;;;;351;;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);*
plasmide1;;;;@3;;;;;;;;*
>comp;115594..115896;;cds;;394;*394;;;101;;P-IS5/IS1182 family transposase;*
comp;116291..116367;;atgf;;96;;;;;;;*
comp;116464..116579;;5s;;129;;;;116;;;*
comp;116709..119461;;23s;;255;;;;2753;;;*
comp;119717..119792;;gca;;30;;;30;;;;*
comp;119823..119899;;atc;;108;;;;;;;*
comp;120008..121498;;16s;;740;*740;;;1491;;;*
;122239..123597;;cds;;;;;;453;;peptidoglycan DD-metalloendopeptidase family protein;*
;;;;;;;;;;;;*
comp;217550..218176;;cds;;123;123;;;209;;ribonuclease D;*
comp;218300..218386;;ctg;;228;228;;;;;;*
;218615..219604;;cds;;;;;;330;;complex I NDUFA9 subunit family protein;*
;;;;;;;;;;;;*
comp;300477..301733;;cds;;472;*472;;;419;;exonuclease subunit SbcD;*
;302206..303696;;16s;;108;;;;1491;;;*
;303805..303881;;atc;;30;;;30;;;;*
;303912..303987;;gca;;255;;;;;;;*
;304243..306995;;23s;;129;;;;2753;;;*
;307125..307240;;5s;;96;;;;116;;;*
;307337..307413;;atgf;;161;161;;;;;;*
<comp;307575..307805;;cds;;;;;;77;;p-ATP-binding protein;*
;;;;;;;;;;;;*
comp;466493..467710;;cds;;231;231;;;406;;site-specific integrase;*
comp;467942..468031;;tca;;205;205;;;;;;*
comp;468237..468809;;cds;;;;;;191;;hp;*
;;;;;;;;;;;;*
;512242..512790;;cds;;136;136;;;183;;pantetheine-phosphate adenylyltransferase;*
;512927..513002;;aaa;;209;209;;;;;;*
;513212..514036;;cds;;;;;;275;;DUF3618 domain-containing protein;*
;;;;;;;;;;;;*
;931813..933912;;cds;;79;79;;;700;;membrane protein;*
;933992..934066;;caa;;382;*382;;;;;;*
comp;934449..935270;;cds;;;;;;274;;hp;*
;;;;;;;;;;;;*
comp;948715..949743;;cds;;199;199;;;343;;Ppx/GppA family phosphatase;*
;949943..950016;;cag;;246;246;;;;;;*
comp;950263..950829;;cds;;;;;;189;;IS3 family transposase;*
;;;;;;;;;;;;*
>;971260..971532;;cds;;493;*493;;;91;;P-hp;*
comp;972026..972119;;agc;;197;197;;;;;;*
;972317..972550;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;1302373..1303350;;cds;;166;166;;;326;;alpha-1,3-fucosyltransferase;*
comp;1303517..1303592;;ttc;;98;98;;;;;;*
comp;1303691..1303876;;cds;;;;;;62;;DNA gyrase inhibitor YacG;*
;;;;;;;;;;;;*
;1349823..1350929;;cds;;145;145;;;369;;GNAT family N-acetyltransferase;*
comp;1351075..1353828;;23s;;262;;;;2754;;;*
comp;1354091..1355591;;16s;@1;676;*676;;;1501;;;*
;1356268..1356726;;cds;;;;;;153;;MarR family transcriptional regulator;*
;;;;;;;;;;;;*
comp;1441708..1443066;;cds;;153;153;;;453;;hp;*
;1443220..1443294;;acc;;1;;1;;;;;*
;1443296..1443371;;gcg;;99;;99;;;;;*
;1443471..1443547;;gac;;44;;44;;;;;*
;1443592..1443666;;gtc;;1;;1;;;;;*
;1443668..1443741;;cag;;137;137;;;;;;*
comp;1443879..1446428;;cds;;;;;;850;;dipeptide ABC transporter ATP-binding protein;*
;;;;;;;;;;;;*
;1566394..1566612;;cds;;193;193;;;73;;hp;*
comp;1566806..1566921;;5s;;128;;;;116;;;*
comp;1567050..1569802;;23s;;254;;;;2753;;;*
comp;1570057..1570132;;gca;;30;;;30;;;;*
comp;1570163..1570239;;atc;;94;;;;;;;*
comp;1570334..1571834;;16s;;444;*444;;;1501;;;*
comp;1572279..1572707;;cds;;;;;;143;;DUF1489 domain-containing protein;*
;;;;;;;;;;;;*
;1723583..1724962;;cds;;94;94;;;460;;hp;*
comp;1725057..1725143;;ctc;;475;*475;;;;;;*
;1725619..1726311;;cds;;;;;;231;;FadR family transcriptional regulator;*
;;;;;;;;;;;;*
;1757680..1760568;;cds;;308;308;;;963;;PAS domain-containing protein;*
;1760877..1760963;;ctg;;29;;29;;;;;*
;1760993..1761068;;gcc;;247;247;;;;;;*
comp;1761316..1761840;;cds;;;;;;175;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;1854042..1855049;;cds;;135;135;;;336;;inorganic phosphate transporter;*
comp;1855185..1855259;;ggc;;243;243;;;;;;*
;1855503..1858685;;cds;;;;;;1061;;AAA family ATPase;*
;;;;;;;;;;;;*
>comp;1883235..1883816;;cds;;210;210;;;194;;P-hp;*
;1884027..1884102;;aac;;4;;4;;;;;*
;1884107..1884183;;gac;;32;32;;;;;;*
comp;1884216..1884821;;cds;;;;;;202;;hp;*

abq cumuls[modifier | modifier le wikicode]

abq cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;cdsa 30-300;
avec rRNA;opérons;9;1;2;;1;0;1;;100;17;1;0
;16atcgca235;5;20;3;;50;7;40;;200;29;30;0
;Id-atgf;3;40;3;8;100;19;80;;300;24;60;2
;16s23s;1;60;2;;150;26;120;;400;18;90;9
;max a;3;80;1;;200;20;160;;500;8;120;11
;a doubles;0;100;1;;250;18;200;;600;8;150;8
;spéciaux;0;120;1;;300;3;240;;700;5;180;11
;total aas;19;140;1;;350;4;280;;800;2;210;9
sans ;opérons;51;160;0;;400;4;320;;900;2;240;6
;1 aa;38;180;1;;450;4;360;;1000;1;270;6
;max a;5;200;0;;500;7;400;;1100;1;300;8
;a doubles;5;;2;;;9;;;;1;;46
;total aas;68;;17;8;;121;;0;;116;;116
total aas;;87;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;72;30;;227;;;;308;;
;;;variance;72;0;;175;;;;230;;
sans jaune;;;moyenne;;;;153;;;;249;;166
;;;variance;;;;74;;;;142;;71

abq blocs[modifier | modifier le wikicode]

abq blocs;;;;;;;;;;;;;;;
bloc;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;
cds;779;1328;non ribosom;496;235;PAP2 fam;502;65;hp;615;305;lytic dom;444;143;DUF1489
$16s;108;§1491;;108;§1501;;108;§1501;;110;1491;;94;§1501;
atc;30;;;30;;;30;;;30;;;30;;
gca;266;;;255;;;255;;;266;;;254;;
$23s;129;§2753;;129;§2753;;129;§2753;;127;2753;;128;§2753;
$5s;236;§116;;187;§116;;278;§116;;202;116;;193;§116;
cds;;97;YkgJ fam;;614;EAL & GGDEF;;387;PQQ;;209;pyridoxamine;;73;hp
;;;;;;;;;;;;;;;
cds;452;295;Hx-t-Hx;740;453;peptido fam;472;419;exo SbcD;;;;;;
$16s;108;§1491;;108;§1491;;108;§1491;;;;;;;
atc;30;;;30;;;30;;;;;;;;
gca;266;;;255;;;255;;;;cds;676;153;MarR fam;
$23s;127;§2753;;129;§2753;;129;§2753;;;$16s;262;§1501;;
$5s;96;§116;;96;§116;;96;§116;;;$23s;145;§2754;;
atgf;870;;;394;;;161;;;;cds;;369;GNAT fam;
cds;;264;IS5 fam;;101;p-IS5/IS1182;;77;p-ATP-bind;;;;;;

abq distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;aag2;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;cac2;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;ccg2;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;;gag2;ttc;;tcc;;tac;1;tgc;1;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;;agc;1;gtg2;atc;;acc;1;aac;3;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;
ctc;2;ccc;1;cac;;cgt;2;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;3;ggc;gtc;1;gcc;2;gac;3;ggc;3;;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;;3 1aa;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;1 >1aa;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;1;gga;;;gta;;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;2;agg;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;;cag;1;cgg;1;;ctg;2;ccg;;cag;1;cgg;;;ctg;;ccg;2;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;1;gag;;ggg;1;;gtg;;gcg;1;gag;;ggg;;;gtg;2;gcg;;gag;2;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
abq;;38;;;;;38;;abq;20;;;;;;20;;abq;10;;;;;;10;;abq;;;;3;;;3
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;3 1-3aas;;;

abs[modifier | modifier le wikicode]

abs opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;abs;;genome;;;;;;;;;
68.45%GC;10.1.20 Paris;16s  5 ;80 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Azospirillum brasilense strain Sp245;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
comp;16414..16980;;cds;;163;163;;;189;;prolyl-tRNA synthetase associated domain-containing protein;*
;17144..17218;;ggc;;670;*670;;;;;;*
;17889..18566;;cds;;;;;;226;;demethylmenaquinone methyltransferase;*
;;;;;;;;;;;;*
;84790..85017;;cds;;114;114;;;76;;osmotically-inducible lipoprotein B;*
comp;85132..85205;;ggg;;35;35;;;;;;*
comp;85241..85900;;cds;;;;;;220;;N-acetyltransferase;*
;;;;;;;;;;;;*
comp;93530..94258;;cds;;60;60;;;243;;SDR family NAD(P)-dependent oxidoreductase;*
comp;94319..94395;;agg;;175;175;;;;;;*
;94571..96262;;cds;;;;;;564;;hp;*
;;;;;;;;;;;;*
comp;131833..132117;;cds;;206;206;;;95;;YggT family protein;*
;132324..132399;;gcg;;140;140;;;;;;*
comp;132540..133586;;cds;;;;;;349;;DMT family transporter;*
;;;;;;;;;;;;*
comp;483582..484082;;cds;;170;170;;;167;;xanthine phosphoribosyltransferase;*
;484253..484329;;cgt;;77;77;;;;;;*
comp;484407..484586;;cds;;;;;;60;;hp;*
;;;;;;;;;;;;*
;536869..537573;;cds;;495;*495;;;235;;phosphatase PAP2 family protein;*
;538069..539152;;16s’;@1;189;;;;1084;;;*
;539342..540019;;23s°;;127;;;;678;;;*
;540147..540262;;5s;;153;153;;;116;;;*
comp;540416..542290;;cds;;;;;;*625;;GGDEF domain-containing protein;*
;;;;;;;;;;;;*
;600048..601079;;cds;;79;79;;;344;;tyrosine-type recombinase/integrase;*
comp;601159..601233;;acg;;81;81;;;;;;*
comp;601315..603243;;cds;;;;;;*643;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;656242..656520;;cds;;169;169;;;93;;hp;*
comp;656690..656765;;gcc;;141;141;;;;;;*
comp;656907..657305;;cds;;;;;;133;;TIGR02300 family protein;*
;;;;;;;;;;;;*
comp;864141..864458;;cds;;209;209;;;106;;50S ribosomal protein L21;*
;864668..864757;;tcg;;79;79;;;;;;*
comp;864837..865679;;cds;;;;;;281;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
;927651..927896;;cds;;392;*392;;;82;;hp;*
;928289..928371;;tta;;175;175;;;;;;*
;928547..929164;;cds;;;;;;206;;hp;*
;;;;;;;;;;;;*
comp;1148345..1149223;;cds;;234;234;;;293;;N-formylglutamate amidohydrolase;*
;1149458..1149532;;gtc;;106;106;;;;;;*
comp;1149639..1151516;;cds;;;;;;*626;;methyl-accepting chemotaxis protein;*
;;;;;;;;;;;;*
;1243974..1245108;;cds;;131;131;;;378;;tRNA 2-thiouridine(34) synthase MnmA;*
;1245240..1245314;;atgj;;354;*354;;;;;;*
comp;1245669..1246637;;cds;;;;;;323;;NAD(+) diphosphatase;*
;;;;;;;;;;;;*
;1279875..1280237;;cds;;74;74;;;121;;hp;*
comp;1280312..1280397;;tac;;148;148;;;;;;*
comp;1280546..1281172;;cds;;;;;;209;;nitrogen fixation protein NifQ;*
;;;;;;;;;;;;*
comp;1500772..1501110;;cds;;338;338;;;113;;P-II family nitrogen regulator;*
;1501449..1501524;;cac;+;109;;109;;;;;*
;1501634..1501709;;cac;2 cac;129;129;;;;;;*
;1501839..1503305;;cds;;106;106;;;489;;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;*
;1503412..1504977;;cds;;173;173;;;522;;malonyl-CoA decarboxylase;*
;1505151..1505235;;cta;;91;91;;;;;;*
;1505327..1506661;;cds;;;;;;445;;trigger factor;*
;;;;;;;;;;;;*
;1511745..1512017;;cds;;105;105;;;91;;HU family DNA-binding protein;*
;1512123..1512197;;gta;;163;;163;;;;;*
;1512361..1512437;;gac;;344;344;;;;;;*
;1512782..1513150;;cds;;;;;;123;;NADH-quinone oxidoreductase subunit A;*
;;;;;;;;;;;;*
;1657596..1659397;;cds;;123;123;;;*601;;p-single-stranded-DNA-specific exonuclease RecJ;*
;1659521..1659596;;gaa;;234;234;;;;;;*
;1659831..1660671;;cds;;;;;;280;;aldo/keto reductase;*
;;;;;;;;;;;;*
comp;1808199..1808735;;cds;;79;79;;;179;;hp;*
;1808815..1808892;;cca;;49;49;;;;;;*
;1808942..1809238;;cds;;10;10;;;99;;ETC complex I subunit;*
;1809249..1809325;;aga;;442;*442;;;;;;*
;1809768..1810013;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
comp;1825075..1825305;;cds;;210;210;;;77;;hp;*
comp;1825516..1825591;;aac;@2;219;;219;;;;;*
comp;1825811..1825884;;tgc;;217;217;;;;;;*
;1826102..1826758;;cds;;;;;;219;;protein-L-isoaspartate O-methyltransferase;*
;;;;;;;;;;;;*
comp;1878424..1878714;;cds;;244;244;;;97;;YkgJ family cysteine cluster protein;*
comp;1878959..1879074;;5s;;123;;;;116;;;*
comp;1879198..1881950;;23s;;272;;;;2753;;;*
comp;1882223..1882298;;gca;;32;;;32;;;;*
comp;1882331..1882407;;atc;;110;;;;;;;*
comp;1882518..1883224;;16s°;;100;100;;;707;;;*
<comp;1883325..1883763;;cds;;;;;;146;;p-erythrose-4-phosphate dehydrogenase;*
;;;;;;;;;;;;*
;1896604..1897080;;cds;;192;192;;;159;;peptidoglycan-associated lipoprotein Pal;*
comp;1897273..1897347;;acc;;162;162;;;;;;*
comp;1897510..1899495;;cds;;;;;;*662;;polysaccharide biosynthesis protein;*
;;;;;;;;;;;;*
comp;2032701..2033588;;cds;;165;165;;;296;;DUF3108 domain-containing protein;*
;2033754..2033828;;gtg;+;132;;132;;;;;*
;2033961..2034035;;gtg;2 gtg;231;231;;;;;;*
;2034267..2034431;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
;2113098..2113601;;cds;;85;85;;;168;;MerR family transcriptional regulator;*
;2113687..2113763;;ccc;;140;140;;;;;;*
comp;2113904..2115682;;cds;;;;;;593;;cyclic nucleotide-binding domain-containing protein;*
;;;;;;;;;;;;*
comp;2163405..2167388;;cds;;775;*775;;;*1328;;non-ribosomal peptide synthetase;*
;2168164..2168552;;16s°;;100;;;;389;;;*
comp;2168653..2169323;;16s°;;522;*522;;;671;;;*
comp;2169846..2170325;;cds;;;;;;160;;DUF2141 domain-containing protein;*
;;;;;;;;;;;;*
;2176963..2177427;;cds;;107;107;;;155;;membrane protein;*
comp;2177535..2177610;;gcc;;30;;30;;;;;*
comp;2177641..2177727;;ctg;;135;135;;;;;;*
comp;2177863..2180208;;cds;;;;;;*782;;mechanosensitive ion channel;*
;;;;;;;;;;;;*
;2233677..2234435;;cds;;92;92;;;253;;hp;*
comp;2234528..2234603;;gag;+;38;;38;;;;;*
comp;2234642..2234717;;gag;2 gag;68;68;;;;;;*
comp;2234786..2235836;;cds;;;;;;350;;p-low specificity L-threonine aldolase;*
;;;;;;;;;;;;*
comp;2293087..2293593;;cds;;211;211;;;169;;hp;*
;2293805..2293881;;cgt;;137;137;;;;;;*
;2294019..2294495;;cds;;5;5;;;159;;GNAT family N-acetyltransferase;*
comp;2294501..2294576;;atgi;;145;145;;;;;;*
comp;2294722..2296683;;cds;;;;;;*654;;RNA polymerase sigma factor RpoD;*
;;;;;;;;;;;;*
;2372946..2373401;;cds;;86;86;;;152;;MaoC family dehydratase;*
comp;2373488..2373563;;aag;+;74;;74;;;;;*
comp;2373638..2373713;;aag;2 aag;309;309;;;;;;*
;2374023..2375549;;cds;;;;;;509;;methyltransferase domain-containing protein;*
;;;;;;;;;;;;*
comp;2418203..2418400;;cds;;69;69;;;66;;preprotein translocase subunit SecE;*
comp;2418470..2418545;;tgg;;152;152;;;;;;*
comp;2418698..2419888;;cds;;81;81;;;397;;elongation factor Tu;*
comp;2419970..2420043;;gga;;60;;60;;;;;*
comp;2420104..2420189;;tac;;144;144;;;;;;*
;2420334..2421188;;cds;;91;91;;;285;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;2421280..2421355;;aca;;137;137;;;;;;*
;2421493..2423187;;cds;;;;;;565;;site-specific integrase;*
;;;;;;;;;;;;*
;2561207..2562223;;cds;;109;109;;;339;;farnesyltranstransferase;*
;2562333..2562409;;ccg;+;205;;205;;;;;*
;2562615..2562691;;ccg;2 ccg;136;136;;;;;;*
;2562828..2563241;;cds;;;;;;138;;hp;*
;;;;;;;;;;;;*
comp;2680406..2680930;;cds;;140;140;;;175;;disulfide bond formation protein B;*
;2681071..2681157;;ttg;;162;162;;;;;;*
;2681320..2681715;;cds;;;;;;132;;cupin domain-containing protein;*
;;;;;;;;;;;;*
;2856509..2858152;;cds;;365;*365;;;548;;recombinase family protein;*
comp;2858518..2858608;;tcc;;118;118;;;;;;*
comp;2858727..2859530;;cds;;;;;;268;;alpha/beta hydrolase;*
plasmide1;;;@3;;;;;;;;;*
;198109..199200;;cds;;84;84;;;364;;tyrosine-type recombinase/integrase;*
comp;199285..199360;;aaa;;135;135;;;;;;*
comp;199496..200044;;cds;;;;;;183;;pantetheine-phosphate adenylyltransferase;*
;;;;;;;;;;;;*
;243776..244348;;cds;;205;205;;;191;;hp;*
;244554..244643;;tca;;143;143;;;;;;*
;244787..245683;;cds;;;;;;299;;diguanylate cyclase;*
;;;;;;;;;;;;*
;338004..339383;;cds;;116;116;;;460;;hp;*
comp;339500..339586;;ctc;;257;257;;;;;;*
comp;339844..340836;;cds;;;;;;331;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;364473..365501;;cds;;200;200;;;343;;Ppx/GppA family phosphatase;*
;365702..365775;;cag;;746;*746;;;;;;*
;366522..367214;;cds;;;;;;231;;FadR family transcriptional regulator;*
;;;;;;;;;;;;*
;474173..477079;;cds;;298;298;;;*969;;PAS domain-containing protein;*
;477378..477464;;ctg;;30;;30;;;;;*
;477495..477570;;gcc;;238;238;;;;;;*
;477809..478123;;cds;;;;;;105;;hp;*
;;;;;;;;;;;;*
;599223..600230;;cds;;245;245;;;336;;inorganic phosphate transporter;*
comp;600476..600550;;ggc;;351;*351;;;;;;*
;600902..602071;;cds;;;;;;390;;adenylate/guanylate cyclase domain-containing protein;*
;;;;;;;;;;;;*
comp;629856..631229;;cds;;154;154;;;458;;tetratricopeptide repeat protein;*
;631384..631458;;acc;;1;;1;;;;;*
;631460..631535;;gcg;;99;;99;;;;;*
;631635..631711;;gac;;35;;35;;;;;*
;631747..631821;;gtc;;1;;1;;;;;*
;631823..631896;;cag;;153;153;;;;;;*
;632050..632259;;cds;;;;;;70;;hp;*
;;;;;;;;;;;;*
>comp;699265..699846;;cds;;210;210;;;194;;P-hp;*
;700057..700132;;aac;;4;;4;;;;;*
;700137..700213;;gac;;32;32;;;;;;*
comp;700246..700851;;cds;;;;;;202;;hp;*
;;;;;;;;;;;;*
;909530..909766;;cds;;153;153;;;79;;hp;*
comp;909920..910035;;5s;;127;;;;116;;;*
comp;910163..912915;;23s;;271;;;;2753;;;*
comp;913187..913262;;gca;;30;;;30;;;;*
comp;913293..913369;;atc;;110;;;;;;;*
comp;913480..914970;;16s;;486;*486;;;1491;;;*
;915457..916713;;cds;;;;;;419;;exonuclease subunit SbcD;*
;;;;;;;;;;;;*
comp;998160..999149;;cds;;229;229;;;330;;complex I NDUFA9 subunit family protein;*
;999379..999465;;ctg;;123;123;;;;;;*
;999589..1000215;;cds;;;;;;209;;ribonuclease D;*
;;;;;;;;;;;;*
comp;1098197..1098655;;cds;;675;*675;;;153;;MarR family transcriptional regulator;*
;1099331..1100821;;16s;;107;;;;1491;;;*
;1100929..1101005;;atc;;31;;;31;;;;*
;1101037..1101112;;gca;;271;;;;;;;*
;1101384..1104136;;23s;;147;147;;;2753;;;*
comp;1104284..1105390;;cds;;;;;;369;;GNAT family N-acetyltransferase;*
;;;;;;;;;;;;*
;1157171..1157356;;cds;;98;98;;;62;;DNA gyrase inhibitor YacG;*
;1157455..1157530;;ttc;;178;178;;;;;;*
;1157709..1158686;;cds;;;;;;326;;alpha-(1,3)-fucosyltransferase;*
;;;;;;;;;;;;*
;1394614..1396740;;cds;;453;*453;;;*709;;PAS domain S-box protein;*
;1397194..1397287;;agc;;52;52;;;;;;*
comp;1397340..1397858;;cds;;;;;;173;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
;1399009..1399830;;cds;;301;301;;;274;;hp;*
comp;1400132..1400206;;caa;;79;79;;;;;;*
comp;1400286..1402379;;cds;;;;;;*698;;hp;*
;;;;;;;;;;;;*
;1577667..1578095;;cds;;457;*457;;;143;;DUF1489 domain-containing protein;*
;1578553..1580043;;16s;;110;;;;1491;;;*
;1580154..1580230;;atc;;31;;;31;;;;*
;1580262..1580337;;gca;;269;;;;;;;*
;1580607..1581986;;23s°;;100;;;;1380;;;*
;1582087..1582616;;23s°;;123;;;;530;;;*
;1582740..1582855;;5s;;100;;;;116;;;*
;1582956..1583032;;atgf;;706;*706;;;;;;*
;1583739..1585157;;cds;;;;;;473;;pyruvate kinase;*
plasmide2;;;;;;;;;;;;*
;271302..272090;;cds;;529;*529;;;263;;ATP-binding cassette domain-containing protein;*
;272620..272695;;tgg;;480;*480;;;;;;*
;273176..273922;;cds;;;;;;249;;sigma-70 family RNA polymerase sigma factor;*
;;;;;;;;;;;;*
;449562..450338;;cds;;465;*465;;;259;;IclR family transcriptional regulator;*
;450804..452289;;16s;;584;;;;1486;;;*
;452874..453640;;23s°;;128;;;;767;;;*
;453769..453884;;5s;;101;;;;116;;;*
;453986..454062;;atgf;;359;*359;;;;;;*
comp;454422..457751;;cds;;;;;;*1110;;NERD domain-containing protein;*
plasmide4;;;;;;;;;;;;*
>comp;131140..131621;;cds;;193;193;;;161;;p-erythrose-4-phosphate dehydrogenase;*
;131815..131891;;atgf;;202;202;;;;;;*
comp;132094..132276;;cds;;;;;;61;;hp;*
;;;;;;;;;;;;*
comp;197300..198643;;cds;;738;*738;;;448;;peptidoglycan DD-metalloendopeptidase family protein;*
;199382..199953;;16s°;;193;;;;572;;;*
;200147..200223;;atgf;;437;*437;;;;;;*
comp;200661..202571;;cds;;;;;;*637;;PAS domain-containing sensor histidine kinase;*
;;;;;;;;;;;;*
;246777..248687;;cds;;208;208;;;*637;;RNA-directed DNA polymerase;*
comp;248896..248972;;cgg;;96;96;;;;;;*
comp;249069..249983;;cds;;;;;;305;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
;319641..319943;;cds;;134;134;;;101;;STAS domain-containing protein;*
comp;320078..320164;;ctc;;125;125;;;;;;*
;320290..321018;;cds;;;;;;243;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
comp;401067..402227;;cds;;281;281;;;387;;PQQ-dependent sugar dehydrogenase;*
comp;402509..402624;;5s;;129;;;;116;;;*
comp;402754..403402;;23s°;;106;;;;649;;;*
comp;403509..403880;;16s°;;502;*502;;;372;;;*
comp;404383..404577;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
;501394..501756;;cds;;95;95;;;121;;response regulator;*
;501852..501927;;aac;;4;;4;;;;;*
;501932..502008;;gac;;4;;4;;;;;*
;502013..502087;;ggc;;102;102;;;;;;*
comp;502190..502957;;cds;;;;;;256;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;503041..503667;;cds;;249;249;;;209;;pyridoxamine 5'-phosphate oxidase;*
comp;503917..504474;;16s°;;547;*547;;;558;;;*
;505022..506005;;cds;;;;;;328;;lytic transglycosylase domain-containing protein;*
;;;;;;;;;;;;*
comp;601019..603679;;cds;;358;*358;;;*887;;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;*
;604038..604113;;ttc;;318;318;;;;;;*
>;604432..605613;;cds;;;;;;394;;site-specific integrase;*
plasmide6;;;;;;;;;;;;*
;88804..89472;;cds;;397;*397;;;223;;RraA family protein;*
;89870..89944;;ggc;;249;249;;;;;;*
;90194..91186;;cds;;;;;;331;;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);*

abs cumuls[modifier | modifier le wikicode]

abs cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;cdsa 30-300;
avec rRNA;opérons;10;1;2;;1;0;1;;100;18;1;0
;16atcgca235;1;20;3;;50;5;40;;200;29;30;0
;Id-23s°-atgf;1;40;4;4;100;22;80;;300;26;60;3
;1623s°5atgf;1;60;1;;150;29;120;;400;20;90;10
;max a;3;80;1;;200;18;160;;500;7;120;9
;a doubles;0;100;1;;250;18;200;;600;6;150;8
;autres;7;120;1;;300;3;240;;700;9;180;13
;total aas;10;140;1;;350;5;280;;800;2;210;9
sans ;opérons;51;160;0;;400;7;320;;900;1;240;6
;1 aa;39;180;1;;450;2;360;;1000;1;270;8
;max a;5;200;0;;500;6;400;;1100;0;300;7
;a doubles;5;;2;;;10;;;;2;;48
;total aas;67;;17;4;;125;;0;;121;;121
total aas;;;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;71;31;;221;;;;308;;
;;;variance;72;1;;168;;;;230;;
sans jaune;;;moyenne;;;;151;;;;242;;166
;;;variance;;;;72;;;;137;;72

abs blocs[modifier | modifier le wikicode]

abs blocs abrégé[modifier | modifier le wikicode]
abs abq;;;
abrégé;nom;;
23s RlmB;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;;*
50s L21;50S ribosomal protein L21;;*
AAA fam;AAA family ATPase;;*
ab hydrolase;alpha/beta hydrolase;;*
ab hydrolase f;alpha/beta hydrolase fold domain-containing protein;;*
AG cyclase;adenylate/guanylate cyclase domain-containing protein;;*
ak reductase;aldo/keto reductase;;*
ATP bind;ATP-binding cassette domain-containing protein;;*
bacteriofer;bacterioferritin;;*
bif CoA;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;;*
bif NAD;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;;*
chemotaxis p;methyl-accepting chemotaxis protein;;*
cupin dom;cupin domain-containing protein;;*
cyclicN bind;cyclic nucleotide-binding domain-containing protein;;*
diG cyclase;diguanylate cyclase;;*
dip ABC;dipeptide ABC transporter ATP-binding protein;;*
disulfide;disulfide bond formation protein B;;*
DMT fam;DMT family transporter;;*
DUF1489;DUF1489 domain-containing protein;;*
DUF2141;DUF2141 domain-containing protein;;*
DUF3108;DUF3108 domain-containing protein;;*
DUF3618;DUF3618 domain-containing protein;;*
EAL & GGDEF;EAL and GGDEF domain-containing protein;;*
elonga Tu;elongation factor Tu;;*
ETC complex;ETC complex I subunit;;*
exo SbcD;exonuclease subunit SbcD;;*
FAD bind;FAD-binding oxidoreductase;;*
FadR fam;FadR family transcriptional regulator;;*
farnesyl;farnesyltranstransferase;;*
fucosyl;alpha-1,3-fucosyltransferase;;*
GGDEF dom;GGDEF domain-containing protein;;*
glycosyl;glycosyltransferase;;*
GNAT fam;GNAT family N-acetyltransferase;;*
gyrase YacG;DNA gyrase inhibitor YacG;;*
Hase HypA;hydrogenase maturation nickel metallochaperone HypA;;*
helicas RecQ;DNA helicase RecQ;;*
HU bind;HU family DNA-binding protein;;*
Hx-t-Hx;helix-turn-helix transcriptional regulator;;*
Hx-t-Hx dom;helix-turn-helix domain-containing protein;;*
IclR fam;IclR family transcriptional regulator;;*
inorganic  P;inorganic phosphate transporter;;*
IS3 fam;IS3 family transposase;;*
IS5 fam;IS5 family transposase;;*
L-iso-Asp;protein-L-isoaspartate O-methyltransferase;;*
lipoyl LipB;lipoyl(octanoyl) transferase LipB;;*
low Thr;low specificity L-threonine aldolase;;*
lytic dom;lytic transglycosylase domain-containing protein;;*
malate G;malate synthase G;;*
malonyl CoA;malonyl-CoA decarboxylase;;*
MaoC fam;MaoC family dehydratase;;*
MarR fam;MarR family transcriptional regulator;;*
mecano ion;mechanosensitive ion channel;;*
membrane p;membrane protein;;*
menaquinone;dimethylmenaquinone methyltransferase;;*
MerR fam;MerR family transcriptional regulator;;*
methyl trans;methyltransferase domain-containing protein;;*
N-acetyl trans;N-acetyltransferase;;*
N-formyl Glu;N-formylglutamate amidohydrolase;;*
NAD diP;NAD(+) diphosphatase;;*
NADH-quinone;NADH-quinone oxidoreductase subunit A;;*
NDUFA9;complex I NDUFA9 subunit family protein;;*
NERD dom;NERD domain-containing protein;;*
nitrogen NifQ;nitrogen fixation protein NifQ;;*
non ribosom;non-ribosomal peptide synthetase;;*
osmose LipB;osmotically-inducible lipoprotein B;;*
p-ATP-bind;p-ATP-binding protein;;*
p-erythrose;p-erythrose-4-phosphate dehydrogenase;;*
P-II nitrogen;P-II family nitrogen regulator;;*
p-IS5/IS1182;P-IS5/IS1182 family transposase;;*
p-low Thr;p-low specificity L-threonine aldolase;;*
p-ssDNA exo;p-single-stranded-DNA-specific exonuclease RecJ;;*
pantetheine;pantetheine-phosphate adenylyltransferase;;*
PAP2 fam;phosphatase PAP2 family protein;;*
PAS dom;PAS domain-containing protein;;*
PAS kinase;PAS domain-containing sensor histidine kinase;;*
PAS S-box;PAS domain S-box protein;;*
peptido fam;peptidoglycan DD-metalloendopeptidase family protein;;*
peptido Pal;peptidoglycan-associated lipoprotein Pal;;*
polymerase;RNA-directed DNA polymerase;;*
polysacchard;polysaccharide biosynthesis protein;;*
Ppx/GppA;Ppx/GppA family phosphatase;;*
PQQ;PQQ-dependent sugar dehydrogenase;;*
Prolyl-tRNA;prolyl-tRNA synthetase associated domain-containing protein;;*
pyridoxamine;pyridoxamine 5'-phosphate oxidase;;*
pyruvate kin;pyruvate kinase;;*
recombinase;recombinase family protein;;*
response reg;response regulator;;*
restriction end;restriction endonuclease;;*
ribonucleaseD;ribonuclease D;;*
RraA fam;RraA family protein;;*
SDR fam;SDR family NAD(P)-dependent oxidoreductase;;*
sigma RpoD;RNA polymerase sigma factor RpoD;;*
sigma-70 fam;sigma-70 family RNA polymerase sigma factor;;*
SLT dom;transglycosylase SLT domain-containing protein;;*
ss integrase;site-specific integrase;;*
Ss-DNA;single-stranded-DNA-specific exonuclease RecJ;;*
STAS dom;STAS domain-containing protein;;*
subunit SecE;preprotein translocase subunit SecE;;*
tetratricopep;tetratricopeptide repeat protein;;*
TIGR02300;TIGR02300 family protein;;*
trigger factor;trigger factor;;*
tRNA MnmA;tRNA 2-thiouridine(34) synthase MnmA;;*
Tyr rec/int;tyrosine-type recombinase/integrase;;*
UDP-N-acetyl;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);;*
xanthine;xanthine phosphoribosyltransferase;;*
YggT fam;YggT family protein;;*
YkgJ fam;YkgJ family cysteine cluster protein;;*
abs blocs tableau[modifier | modifier le wikicode]
abs blocs;;;;;;;;;;;
gène;inter;long;abrégé;gène;inter;long;abrégé;gène;inter;long;abrégé
cds;486;419;SbcD;cds;100;146;P-eryt;cds;675;153;MarR
16s;110;1491;;16s°;110;707;;16s;107;1491;
atc;30;;;atc;32;;;atc;31;;
gca;271;;;gca;272;;;gca;271;;
23s;127;2753;;23s;123;2753;;23s;147;2753;
5s;153;116;;5s;244;116;;cds;;369;GNAT
cds;;79;hp;cds;;97;YkgJ;;;;
;;;;;;;;;;;
cds;457;143;DUF1489;;;;;;;;
16s;110;1491;;;;;;;;;
atc;31;;;;;;;;;;
gca;269;;;;;10 cds < 259 sur 20;;;;;
23s°;100;1380;;;;Dont 2 hp + 1 p;;;;;
23s°;123;530;;;;;;;;;
5s;100;116;;;;;;;;;
atgf;706;;;;;;;;;;
cds;;473;pyruvat;;;;;;;;
;;;;;;;;;;;
cds;465;259;IclR;cds;502;65;hp;cds;495;235;PAP2
16s;584;1486;;16s°;106;372;;16s’;189;1084;
23s°;128;767;;23s°;129;649;;23s°;127;678;
5s;101;116;;5s;281;116;;5s;153;116;
atgf;359;;;cds;;387;PQQ;cds;;625;GGDEF
cds;;1110;NERD;;;;;;;;
;;;;;;;;;;;
cds;775;1328;non-rib;cds;738;448;peptido;cds;249;209;pyridox
16s°;100;389;;16s°;193;;;16s°;547;558;
16s°;522;671;;atgf;437;;;cds;;328;lytic
cds;;160;DUF2141;cds;;637;PAS;;;;
abs abq blocs[modifier | modifier le wikicode]
  • Lien tableau: abs abq blocs
  • Note: attention pour les couleurs de & (EAL & GDDEF) et de ? (d'où?) 3 fois
;gtRNAdb;;;;;;;;;;gtRNAdb;;;;;
;abs;genome;;;;;;;;;abq;genome;;;;
68.45%GC;10.1.20 Paris;80 aas;intercalaires;cdsa;protéines;;;;;68.45%GC;29.12.19 Paris;88 aas;intercalaires;cdsa;protéines;
Azospirillum brasilense strain Sp245;;;;;;;;;;Azospirillum brasilense strain Az39;;;;;;
chromosome;;;;;;;;;;chromosome;;;;;;
;2856509..2858152;cds;365;548;recombinase;*    CHA1;;*  comp;;;2482875..2484518;cds;365;548;recombinase;*    CHA1
comp;2858518..2858608;tcc;118;;;*;;*  hp caracter;;comp;2484884..2484974;tcc;120;;;*
comp;2858727..2859530;cds;;268;ab hydrolase;* ;;*  modif;;comp;2485095..2485898;cds;;268;ab hydrolase;*
;;;;;;;;*  déplacé;;;;;;;;*
comp;16414..16980;cds;163;189;Prolyl-tRNA;*   ;;*   d’où?;;comp;2640759..2641325;cds;149;189;Prolyl-tRNA;*
;17144..17218;ggc;670;;;*;;*   recomb;;;2641475..2641549;ggc;688;;;*
;17889..18566;cds;;226;menaquinone;*;;*  insertion;;;2642238..2642915;cds;;226;menaquinone;*
;;;;;;*;;*  bloc?;;;;;;;;*
;84790..85017;cds;114;76;@osmose LipB;*  comp;;*  réunion;;comp;2764482..2765567;cds;659;362;@hp;*
comp;85132..85205;ggg;35;;;*;;*  recombi;;comp;2766227..2766300;ggg;35;;;*
comp;85241..85900;cds;;220;N-acetyl trans;*;;;;comp;2766336..2766995;cds;;220;N-acetyl trans;*
;;;;;;;;;;;;;;;;
comp;93530..94258;cds;60;243;SDR fam;*  CHA;;;;;2781933..2783774;cds;187;614;EAL & GGDEF;*    CHA
comp;94319..94395;agg;175;;;*;;;;comp;2783962..2784077;$5s;129;§116;;*
;94571..96262;cds;;564;@hp;*  hp caracter;;;;comp;2784207..2786959;$23s;255;§2753;;*
;;;;;;*;;;;comp;2787215..2787290;gca;30;;;*
comp;131833..132117;cds;206;95;YggT fam;*;;;;comp;2787321..2787397;atc;108;;;*
;132324..132399;gcg;140;;;*;;;;comp;2787506..2789006;$16s;496;§1501;;*
comp;132540..133586;cds;;349;@DMT fam;*  modif;;;;comp;2789503..2790207;cds;;235;PAP2 fam;*
;;;;;;*;;;;;;;;;;*
comp;483582..484082;cds;170;167;xanthine;*;;;;;2843264..2843443;cds;77;60;hp;*
;484253..484329;cgt;77;;;*;;;;comp;2843521..2843597;cgt;170;;;*
comp;484407..484586;cds;;60;hp;*;;;;;2843768..2844268;cds;;167;xanthine;*
;;;;;;*;;;;;;;;;;
;536869..537573;cds;495;235;PAP2 fam;*;;;;;125527..126444;cds;127;306;@restriction end;*    
;538069..539152;?16s’;189;§1084;;*;;;;comp;126572..126647;gcg;206;;;*
;539342..540019;&23s°;127;§678;;*;;;;;126854..127138;cds;;95;YggT fam;*
;540147..540262;$5s;153;§116;;*;;;;;;;;;;*
comp;540416..542290;cds;;625;GGDEF dom;*;;;;comp;163237..164982;cds;175;582;@Hase HypA;*
;;;;;;;;;;;165158..165234;agg;59;;;*
;;;;;;;;;;;165294..166022;cds;;243;SDR fam;*
;;;;;;;;;;;;;;;;
;600048..601079;cds;79;344;@Tyr rec/int;*    comp;;;;comp;188235..189860;cds;42;542;@glycosyl;*    CHB
comp;601159..601233;acg;81;;;*;;;;comp;189903..189977;acg;81;;;*
comp;601315..603243;cds;;643;helicas RecQ;*;;;;comp;190059..191987;cds;;643;helicas RecQ;*
;;;;;;*  CHB;;;;;;;;;;*
comp;656242..656520;cds;169;93;hp;*;;;;comp;250833..251111;cds;169;93;hp;*
comp;656690..656765;gcc;141;;;*;;;;comp;251281..251356;gcc;141;;;*
comp;656907..657305;cds;;133;TIGR02300;*;;;;comp;251498..251893;cds;;132;TIGR02300;*
;;;;;;*;;;;;;;;;;*
comp;864141..864458;cds;209;106;50s L21;*;;;;comp;458142..458459;cds;209;106;50s L21;*
;864668..864757;tcg;79;;;*;;;;;458669..458758;tcg;63;;;*
comp;864837..865679;cds;;281;ab hydrolase;*;;;;comp;458822..459664;cds;;281;ab hydrolase f;*
;;;;;;;;;;;;;;;;
;2233677..2234435;cds;92;253;@hp;*    recomb;;;;comp;496776..497171;cds;162;132;cupin dom;*    CHC
comp;2234528..2234603;?gag;38;;;*;;;;comp;497334..497420;ttg;137;;;*
comp;2234642..2234717;?gag;68;;;*;;;;;497558..498085;cds;;176;disulfide;*
comp;2234786..2235836;cds;;350;@p-low Thr;*  modif;;;;;;;;;;*
;;;;;;*;;;;comp;615937..616350;cds;121;138;hp;*
comp;2293087..2293593;cds;211;169;hp;*  CHC;;;;comp;616472..616548;?ccg;206;;;*
;2293805..2293881;cgt;137;;;*;;;;comp;616755..616831;?ccg;109;;;*
;2294019..2294495;cds;5;159;GNAT fam;*;;;;comp;616941..617957;cds;;339;farnesyl;*
comp;2294501..2294576;atgi;145;;;*;;;;;;;;;;*
comp;2294722..2296683;cds;;654;sigma RpoD;*;;;;comp;748703..749161;cds;38;153;@hp;*
;;;;;;*;;;;comp;749200..749275;aca;91;;;*
;2372946..2373401;cds;86;152;MaoC fam;*;;;;comp;749367..750221;cds;144;285;23s RlmB;*
comp;2373488..2373563;?aag;74;;;*;;;;;750366..750451;tac;60;;;*
comp;2373638..2373713;?aag;309;;;*;;;;;750512..750585;gga;81;;;*
;2374023..2375549;cds;;509;methyl trans;*;;;;;750667..751857;cds;153;397;elonga Tu;*
;;;;;;*;;;;;752011..752086;tgg;69;;;*
comp;2418203..2418400;cds;69;66;subunit SecE;*;;;;;752156..752353;cds;;66;subunit SecE;*
comp;2418470..2418545;tgg;152;;;*;;;;;;;;;;*
comp;2418698..2419888;cds;81;397;elonga Tu;*;;;;comp;794457..795983;cds;296;509;methyl trans;*
comp;2419970..2420043;gga;60;;;*;;;;;796280..796355;?aag;76;;;*
comp;2420104..2420189;tac;144;;;*;;;;;796432..796507;?aag;109;;;*
;2420334..2421188;cds;91;285;23s RlmB;*;;;;comp;796617..797057;cds;;147;MaoC fam;*
;2421280..2421355;aca;137;;;*;;;;;;;;;;*
;2421493..2423187;cds;;565;@ss integrase;*    recombi;;;;;870412..872373;cds;159;654;sigma RpoD;*
;;;;;;*;;;;;872533..872608;atgi;5;;;*
;2561207..2562223;cds;109;339;farnesyl;*;;;;comp;872614..873093;cds;134;160;GNAT fam;*
;2562333..2562409;?ccg;205;;;*;;;;comp;873228..873304;cgt;212;;;*
;2562615..2562691;?ccg;136;;;*;;;;;873517..874023;cds;;169;hp;*
;2562828..2563241;cds;;138;hp;*;;;;;;;;;;*
;;;;;;*;;;;;931962..933011;cds;68;350;@low Thr;*
comp;2680406..2680930;cds;140;175;disulfide;*;;;;;933080..933155;?gag;38;;;*
;2681071..2681157;ttg;162;;;*;;;;;933194..933269;?gag;72;;;*
;2681320..2681715;cds;;132;cupin dom;*;;;;comp;933342..934340;cds;;333;@SLT dom;*
;;;;;;*;;;;;;;;;;
;1896604..1897080;cds;192;159;peptido Pal;*    CHD;;;;;997881..998357;cds;246;159;peptido Pal;*    CHD
comp;1897273..1897347;acc;162;;;*;;;;comp;998604..998678;acc;175;;;*
comp;1897510..1899495;cds;;662;polysacchard;*;;;;comp;998854..1000815;cds;;654;polysacchard;*
;;;;;;*;;;;;;;;;;*
comp;2032701..2033588;cds;165;296;DUF3108;*;;;;comp;1164137..1165048;cds;159;304;DUF3108;*
;2033754..2033828;?gtg;132;;;*;;;;;1165208..1165282;?gtg;132;;;*
;2033961..2034035;?gtg;231;;;*;;;;;1165415..1165489;?gtg;231;;;*
;2034267..2034431;cds;;55;hp;*;;;;;1165721..1165885;cds;;55;hp;*
;;;;;;*;;;;;;;;;;*
;2113098..2113601;cds;85;168;MerR fam;*;;;;;1242416..1242919;cds;85;168;MerR fam;*
;2113687..2113763;ccc;140;;;*;;;;;1243005..1243081;ccc;139;;;*
comp;2113904..2115682;cds;;593;cyclicN bind;*;;;;comp;1243221..1244999;cds;;593;cyclicN bind;*
;;;;;;;;;;;;;;;;*
comp;1808199..1808735;cds;79;179;hp;*    CHE;;;;comp;1353398..1353895;cds;118;166;hp;*    CHE
;1808815..1808892;cca;49;;;*;;;;;1354014..1354091;cca;49;;;*
;1808942..1809238;cds;10;99;ETC complex;*;;;;;1354141..1354437;cds;10;99;ETC complex;*
;1809249..1809325;aga;442;;;*;;;;;1354448..1354524;aga;443;;;*
;1809768..1810013;cds;;82;hp;*;;;;;1354968..1355213;cds;;82;hp;*
;;;;;;*;;;;;;;;;;*
comp;1825075..1825305;cds;210;77;hp;*;;;;comp;1370270..1370500;cds;196;77;hp;*
comp;1825516..1825591;aac;219;;;*;;;;comp;1370697..1370772;aac;220;;;*
comp;1825811..1825884;tgc;217;;;*;;;;comp;1370993..1371066;tgc;218;;;*
;1826102..1826758;cds;;219;L-iso-Asp;*;;;;;1371285..1371941;cds;;219;L-iso-Asp;*
;;;;;;*;;;;;;;;;;*
comp;1878424..1878714;cds;244;97;YkgJ fam;*;;;;comp;1427443..1427733;cds;236;97;YkgJ fam;*
comp;1878959..1879074;$5s;123;§116;;*;;;;comp;1427970..1428085;$5s;129;§116;;*
comp;1879198..1881950;$23s;272;§2753;;*;;;;comp;1428215..1430967;$23s;266;§2753;;*
comp;1882223..1882298;gca;32;;;*;;;;comp;1431234..1431309;gca;30;;;*
comp;1882331..1882407;atc;110;;;*;;;;comp;1431340..1431416;atc;108;;;*
comp;1882518..1883224;&16s°;100;§707;;*;;;;comp;1431525..1433015;$16s;779;§1491;;*
<comp;1883325..1883763;cds;;146;@p-erythrose;*  comp;;;;;1433795..1437778;cds;;1328;@non ribosom;*
;;;;;;;;;;;;;;;;
comp;2163405..2167388;cds;775;1328;@non ribosom;*  déplacé;;;;;;;;;;
;2168164..2168552;&16s°;100;§389;;*;;;;;;;;;;
comp;2168653..2169323;&16s°;522;§671;;*     d’où?;;;;;;;;;;
comp;2169846..2170325;cds;;160;DUF2141;*;;;;;;;;;;
;;;;;;;;;;;;;;;;
;927651..927896;cds;392;82;hp;*    CHF;;;;comp;1576457..1577296;cds;243;280;ak reductase;*    CHF
;928289..928371;tta;175;;;*;;;;comp;1577540..1577615;gaa;123;;;*
;928547..929164;cds;;206;@hp;*   recombi;;;;comp;1577739..1579538;cds;;600;ss-DNA;*
;;;;;;*;;;;;;;;;;*
comp;1148345..1149223;cds;234;293;N-formyl Glu;*;;;;comp;1723089..1723457;cds;344;123;NADH-quinone;*
;1149458..1149532;gtc;106;;;*;;;;comp;1723802..1723878;gac;164;;;*
comp;1149639..1151516;cds;;626;@chemotaxis p;*    modif;;;;comp;1724043..1724117;gta;106;;;*
;;;;;;*;;;;comp;1724224..1724496;cds;;91;HU bind;*
;1243974..1245108;cds;131;378;tRNA MnmA;*;;;;;;;;;;*
;1245240..1245314;atgj;354;;;*;;;;comp;1730385..1731719;cds;91;445;trigger factor;*
comp;1245669..1246637;cds;;323;@NAD diP;*   recombi;;;;comp;1731811..1731895;cta;173;;;*
;;;;;;*;;;;comp;1732069..1733634;cds;106;522;malonyl CoA;*
;1279875..1280237;cds;74;121;hp;*;;;;comp;1733741..1735207;cds;129;489;bif NAD;*
comp;1280312..1280397;tac;148;;;*;;;;comp;1735337..1735412;?cac;109;;;*
comp;1280546..1281172;cds;;209;nitrogen NifQ;*;;;;comp;1735522..1735597;?cac;337;;;*
;;;;;;*;;;;;1735935..1736273;cds;;113;P-II nitrogen;*
comp;1500772..1501110;cds;338;113;P-II nitrogen;*;;;;;;;;;;*
;1501449..1501524;?cac;109;;;*;;;;;1951126..1951752;cds;149;209;nitrogen NifQ;*
;1501634..1501709;?cac;129;;;*;;;;;1951902..1951987;tac;74;;;*
;1501839..1503305;cds;106;489;bif NAD;*;;;;comp;1952062..1952424;cds;;121;hp;*
;1503412..1504977;cds;173;522;malonyl CoA;*;;;;;;;;;;*
;1505151..1505235;cta;91;;;*;;;;;1996903..1997244;cds;595;114;@hp;*
;1505327..1506661;cds;;445;trigger factor;*;;;;comp;1997840..1997914;atgj;131;;;*
;;;;;;*;;;;comp;1998046..1999179;cds;;378;tRNA MnmA;*
;1511745..1512017;cds;105;91;HU bind;*;;;;;;;;;;*
;1512123..1512197;gta;163;;;*;;;;;2086487..2088658;cds;156;724;@malate G;*
;1512361..1512437;gac;344;;;*;;;;comp;2088815..2088889;gtc;234;;;*
;1512782..1513150;cds;;123;NADH-quinone;*;;;;;2089124..2090002;cds;;293;N-formyl Glu;*
;;;;;;*;;;;;;;;;;*
;1657596..1659397;cds;123;601;p-ssDNA exo;*;;;;comp;2303404..2303880;cds;414;159;@bacteriofer;*
;1659521..1659596;gaa;234;;;*;;;;comp;2304295..2304377;tta;406;;;*
;1659831..1660671;cds;;280;ak reductase;*;;;;comp;2304784..2305029;cds;;82;hp;*
plasmide1;;;;;;;;;;plasmide1;;;;;;
comp;197300..198643;cds;738;448;peptido fam;*   PL4;;;;>comp;115594..115896;cds;394;101;@p-IS5/IS1182;*   PL1A
;199382..199953;&16s°;193;§572;;*   déplacé;;;;comp;116291..116367;atgf;96;;;*
;200147..200223;atgf;437;;;*;;;;comp;116464..116579;$5s;129;§116;;*
comp;200661..202571;cds;;637;@PAS kinase;*  déplacé;;;;comp;116709..119461;$23s;255;§2753;;* 
;;;;;;;;;;comp;119717..119792;gca;30;;;*
;;;;;;;;;;comp;119823..119899;atc;108;;;*
;;;;;;;;;;comp;120008..121498;$16s;740;§1491;;*
;;;;;;;;;;;122239..123597;cds;;453;peptido fam;*
;;;;;;;;;;;;;;;;
;909530..909766;cds;153;79;@hp;*hp caracter;;;;comp;217550..218176;cds;123;209;ribonucleaseD;*   PL1B
comp;909920..910035;$5s;127;§116;;*;;;;comp;218300..218386;ctg;228;;;*
comp;910163..912915;$23s;271;§2753;;*;;;;;218615..219604;cds;;330;NDUFA9;*
comp;913187..913262;gca;30;;;*    PL1B;;;;;;;;;;*
comp;913293..913369;atc;110;;;*;;;;comp;300477..301733;cds;472;419;exo SbcD;*
comp;913480..914970;$16s;486;§1491;;*;;;;;302206..303696;$16s;108;§1491;;*
;915457..916713;cds;;419;exo SbcD;*;;;;;303805..303881;atc;30;;;*
;;;;;;*;;;;;303912..303987;gca;255;;;*
comp;998160..999149;cds;229;330;NDUFA9;*;;;;;304243..306995;$23s;129;§2753;;*
;999379..999465;ctg;123;;;*;;;;;307125..307240;$5s;96;§116;;*
;999589..1000215;cds;;209;ribonucleaseD;*;;;;;307337..307413;atgf;161;;;*
;;;;;;;;;;<comp;307575..307805;cds;;77;@p-ATP-bind;*
;;;;;;;;;;;;;;;;
;198109..199200;cds;84;364;@Tyr rec/int;*   comp;;;;comp;466493..467710;cds;231;406;@ss integrase;*   PL1C
comp;199285..199360;aaa;135;;;*;;;;comp;467942..468031;tca;205;;;*
comp;199496..200044;cds;;183;pantetheine;*    PL1C;;;;comp;468237..468809;cds;;191;hp;*
;;;;;;*;;;;;;;;;;*
;243776..244348;cds;205;191;hp;*;;;;;512242..512790;cds;136;183;pantetheine;*
;244554..244643;tca;143;;;*;;;;;512927..513002;aaa;209;;;*
;244787..245683;cds;;299;@diG cyclase;*   recomb;;;;;513212..514036;cds;;275;@DUF3618;*
;;;;;;;;;;;;;;;;*
;1399009..1399830;cds;301;274;hp;*   PL1D;;;;;931813..933912;cds;79;700;@membrane p;*   PL1D
comp;1400132..1400206;caa;79;;;*;;;;;933992..934066;caa;382;;;*
comp;1400286..1402379;cds;;698;@hp;*hp caracter;;;;comp;934449..935270;cds;;274;hp;*
;;;;;;;;;;;;;;;;*
comp;364473..365501;cds;200;343;Ppx/GppA;*   PL1E;;;;comp;948715..949743;cds;199;343;Ppx/GppA;*   PL1E
;365702..365775;cag;746;;;*;;;;;949943..950016;cag;246;;;*
;366522..367214;cds;;231;@FadR fam;*  comp;;;;comp;950263..950829;cds;;189;@IS3 fam;*
;;;;;;;;;;;;;;;;*
;1394614..1396740;cds;453;709;@PAS S-box;*   recomb;;;;>;971260..971532;cds;493;91;@P-hp;*   PL1F
;1397194..1397287;agc;52;;;*  PL1F;;;;comp;972026..972119;agc;197;;;*
comp;1397340..1397858;cds;;173;@Tyr rec/int;*   recomb;;;;;972317..972550;cds;;78;@hp;*
;;;;;;;;;;;;;;;;
comp;1098197..1098655;cds;675;153;MarR fam;*   PL1G;;;;comp;1302373..1303350;cds;166;326;fucosyl;*   PL1G
;1099331..1100821;$16s;107;§1491;;*;;;;comp;1303517..1303592;ttc;98;;;*
;1100929..1101005;@atc;31;;;*  insertion;;;;comp;1303691..1303876;cds;;62;gyrase YacG;*
;1101037..1101112;@gca;271;;;*;;;;;;;;;;*
;1101384..1104136;$23s;147;§2753;;*;;;;;1349823..1350929;cds;145;369;GNAT fam;*
comp;1104284..1105390;cds;;369;GNAT fam;*;;;;comp;1351075..1353828;$23s;262;§2754;;*
;;;;;;*;;;;comp;1354091..1355591;$16s;676;§1501;;*
;1157171..1157356;cds;98;62;gyrase YacG;*;;;;;1356268..1356726;cds;;153;MarR fam;*
;1157455..1157530;ttc;178;;;*;;;;;;;;;;*
;1157709..1158686;cds;;326;fucosyl;*;;;;;;;;;;
;;;;;;;;;;;;;;;;
comp;629856..631229;cds;154;458;tetratricopep;*   PL1H;;;;comp;1441708..1443066;cds;153;453;hp;*   PL1H
;631384..631458;acc;1;;;*;;;;;1443220..1443294;acc;1;;;*
;631460..631535;gcg;99;;;*;;;;;1443296..1443371;gcg;99;;;*
;631635..631711;gac;35;;;*;;;;;1443471..1443547;gac;44;;;*
;631747..631821;gtc;1;;;*;;;;;1443592..1443666;gtc;1;;;*
;631823..631896;cag;153;;;*;;;;;1443668..1443741;cag;137;;;*
;632050..632259;cds;;70;@hp;*   comp;;;;comp;1443879..1446428;cds;;850;@dip ABC;*
;;;;;;;;;;;;;;;;
;1577667..1578095;cds;457;143;DUF1489;*   PL1I;;;;;1566394..1566612;cds;193;73;@hp;*   PL1I
;1578553..1580043;$16s;110;§1491;@ ;*  bloc?;;;;comp;1566806..1566921;$5s;128;§116;;*
;1580154..1580230;atc;31;;;*;;;;comp;1567050..1569802;$23s;254;§2753;;*
;1580262..1580337;gca;269;;;*;;;;comp;1570057..1570132;gca;30;;;*
;1580607..1581986;&23s°;100;§1380;;*  réunion;;;;comp;1570163..1570239;atc;94;;;*
;1582087..1582616;&23s°;123;§530;;*;;;;comp;1570334..1571834;$16s;444;§1501;@ ;*
;1582740..1582855;$5s;100;§116;;*;;;;comp;1572279..1572707;cds;;143;DUF1489;*
;1582956..1583032;atgf;706;;;*  d’où?;;;;;;;;;;
;1583739..1585157;cds;;473;@pyruvate kin;*  comp;;;;;;;;;;
;;;;;;;;;;;;;;;;
;338004..339383;cds;116;460;hp;*   PL1J;;;;;1723583..1724962;cds;94;460;hp;*   PL1J
comp;339500..339586;ctc;257;;;*;;;;comp;1725057..1725143;ctc;475;;;*
comp;339844..340836;cds;;331;@ab hydrolase;*  comp;;;;;1725619..1726311;cds;;231;FadR fam;*
;;;;;;*;;;;;;;;;;*
;474173..477079;cds;298;969;PAS dom;*   PL1K;;;;;1757680..1760568;cds;308;963;PAS dom;*   PL1K
;477378..477464;ctg;30;;;*;;;;;1760877..1760963;ctg;29;;;*
;477495..477570;gcc;238;;;*;;;;;1760993..1761068;gcc;247;;;*
;477809..478123;cds;;105;@hp;*  comp;;;;comp;1761316..1761840;cds;;175;@Hx-t-Hx;*
;;;;;;*;;;;;;;;;;*
;599223..600230;cds;245;336;inorganic  P;*;;;;;1854042..1855049;cds;135;336;inorganic  P;*
comp;600476..600550;ggc;351;;;*;;;;comp;1855185..1855259;ggc;243;;;*
;600902..602071;cds;;390;@AG cyclase;*   recomb;;;;;1855503..1858685;cds;;1061;@AAA fam;*
;;;;;;;;;;;;;;;;
>comp;699265..699846;cds;210;194;p-hp;*   PL1L;;;;>comp;1883235..1883816;cds;210;194;P-hp;*   PL1L
;700057..700132;aac;4;;;*;;;;;1884027..1884102;aac;4;;;*
;700137..700213;gac;32;;;*;;;;;1884107..1884183;gac;32;;;*
comp;700246..700851;cds;;202;hp;*;;;;comp;1884216..1884821;cds;;202;hp;*
plasmide2;;;;;;*;;;;plasmide2;;;;;;*
;271302..272090;cds;529;263;@ATP bind;*  comp;;;;comp;51090..51836;cds;481;249;sigma-70 fam;*
;272620..272695;tgg;480;;;*;;;;comp;52318..52393;tgg;363;;;*
;273176..273922;cds;;249;sigma-70 fam;*;;;;;52757..53587;cds;;277;@hp;*
;;;;;;*;;;;;;;;;;*
;449562..450338;cds;465;259;@IclR fam;*    modif;;;;comp;809229..810019;cds;870;264;@IS5 fam;*
;450804..452289;$16s;584;§1486;;*;;;;comp;810890..810966;atgf;96;;;*
;452874..453640;&23s°;128;§767;;*;;;;comp;811063..811178;$5s;127;§116;;*
;453769..453884;$5s;101;§116;;*;;;;comp;811306..814058;$23s;266;§2753;;*
;453986..454062;atgf;359;;;*;;;;comp;814325..814400;gca;30;;;*
comp;454422..457751;cds;;1110;@NERD dom;*  comp;;;;comp;814431..814507;atc;108;;;*
;;;;;;;;;;comp;814616..816106;$16s;452;§1491;;*
;;;;;;;;;;comp;816559..817443;cds;;295;@Hx-t-Hx dom;*
plasmide4;;;;;;;;;;plasmide4;;;;;;*
;2176963..2177427;cds;107;155;@membrane p;*    comp;;;;;196992..199346;cds;148;785;mecano ion;*   PL4A
comp;2177535..2177610;gcc;30;;;*  ;;;;;199495..199581;ctg;30;;;*
comp;2177641..2177727;ctg;135;;;*  CH;;;;;199612..199687;gcc;188;;;*
comp;2177863..2180208;cds;;782;mecano ion;*;;;;;199876..201333;cds;;486;@hp;*
;;;;;;;;;;;;;;;;*
;246777..248687;cds;208;637;@polymerase;*   recomb;;;;;237538..238578;cds;92;347;@response reg;*  PL4B
comp;248896..248972;cgg;96;;;*;;;;comp;238671..238747;cgg;96;;;*
comp;249069..249983;cds;;305;ab hydrolase;*  PL4B;;;;comp;238844..239821;cds;;326;ab hydrolase;*
;;;;;;*;;;;;;;;;;*
;319641..319943;cds;134;101;STAS dom;*;;;;comp;257739..258470;cds;125;244;lipoyl LipB;*
comp;320078..320164;ctc;125;;;*;;;;;258596..258682;ctc;123;;;*
;320290..321018;cds;;243;lipoyl LipB;*;;;;comp;258806..259108;cds;;101;STAS dom;*
;;;;;;*;;;;;;;;;;*
comp;401067..402227;cds;281;387;PQQ;*;;;;comp;399367..400527;cds;278;387;PQQ;*
comp;402509..402624;$5s;129;§116;;*;;;;comp;400806..400921;$5s;129;§116;;*
comp;402754..403402;&23s°;106;§649;;*;;;;comp;401051..403803;$23s;255;§2753;;*
comp;403509..403880;&16s°;502;§372;;*;;;;comp;404059..404134;gca;30;;;*
comp;404383..404577;cds;;65;hp;*;;;;comp;404165..404241;atc;108;;;*
;;;;;;*;;;;comp;404350..405850;$16s;502;§1501;;*
;501394..501756;cds;95;121;response reg;*;;;;comp;406353..406547;cds;;65;hp;*
;501852..501927;aac;4;;;*;;;;;;;;;;*
;501932..502008;gac;4;;;*;;;;;504531..504893;cds;82;121;response reg;*
;502013..502087;ggc;102;;;*;;;;;504976..505051;aac;3;;;*
comp;502190..502957;cds;83;256;Hx-t-Hx;*;;;;;505055..505131;gac;4;;;*
;503041..503667;cds;249;209;pyridoxamine;*;;;;;505136..505210;ggc;102;;;*
comp;503917..504474;&16s°;547;§558;;*;;;;comp;505313..506080;cds;83;256;Hx-t-Hx;*
;505022..506005;cds;;328;@lytic dom;*    modif;;;;;506164..506790;cds;202;209;pyridoxamine;*
;;;;;;*;;;;comp;506993..507108;$5s;127;§116;;*
comp;601019..603679;cds;358;887;bif CoA;*;;;;comp;507236..509988;$23s;266;§2753;;*
;604038..604113;ttc;318;;;*;;;;comp;510255..510330;gca;30;;;*
>;604432..605613;cds;;394;@ss integrase;*   recomb;;;;comp;510361..510437;atc;110;;;*
;;;;;;;;;;comp;510548..512038;$16s;615;§1491;;*
>comp;131140..131621;cds;193;161;p-erythrose;*   ;;;;;512654..513568;cds;;305;@lytic dom;*
;131815..131891;atgf;202;;@ ;*  d’où?;;;;;;;;;;*
comp;132094..132276;cds;;61;hp;*;;;;comp;588108..590768;cds;340;887;bif CoA;*
;;;;;;;;;;;591109..591184;ttc;286;;;*
;;;;;;;;;;;591471..592979;cds;;503;@FAD bind;*
plasmide6;;;;;;;;;;plasmide5;;;;;;*
;88804..89472;cds;397;223;RraA fam;*;;;;;86421..87089;cds;455;223;RraA fam;*
;89870..89944;ggc;249;;;*;;;;;87545..87619;ggc;193;;;*
;90194..91186;cds;;331;UDP-N-acetyl;*;;;;;87813..88865;cds;;351;UDP-N-acetyl;*

abs distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;3
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;aag2;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;cac2;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;;ccg2;ttc;;tcc;;tac;1;tgc;1;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;;agc;1;gag2;atc;;acc;1;aac;3;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;
ctc;2;ccc;1;cac;;cgt;2;gtg2;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;2;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;3;;gtc;1;gcc;2;gac;4;ggc;1;;gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;;ggc;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;3 1aa;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;1 >1aa;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;1;gga;;;gta;1;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;2;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;2;agg;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;;cag;1;cgg;1;;ctg;2;ccg;;cag;1;cgg;;;ctg;;ccg;2;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;1;gag;;ggg;1;;gtg;;gcg;1;gag;;ggg;;;gtg;2;gcg;;gag;2;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
abs;;39;;;;;;;abs;20;;;;;;20;;abs;10;;;;;;10;;abs;;;;3;;;3
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;3 1-3aas;;;

agr[modifier | modifier le wikicode]

agr opérons[modifier | modifier le wikicode]

59.3%GC;29.12.19 Paris;16s  5 ;58 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Agrobacterium sp. H13-3 ;;;;;;;;;;;;
chromosoml;;;;;;;;;;;;
comp;1064633..1065274;;cds;;296;296;;;214;;hp;*
;1065571..1065655;;ttg;;266;266;;;;;;*
;1065922..1066437;;cds;;;;;;172;;disulfide bond formation protein B;*
;;;;;;;;;;;;*
comp;1178605..1179114;;cds;;256;256;;;170;;prolyl-tRNA synthetase associated domain-containing protein;*
;1179371..1179445;;ggc;@1;793;;793;;;;;*
comp;1180239..1180315;;atgj;;135;135;;;;;;*
comp;1180451..1181647;;cds;;;;;;399;;tRNA 2-thiouridine(34) synthase MnmA;*
;;;;;;;;;;;;*
comp;1320644..1321006;;cds;;318;318;;;121;;hp;*
comp;1321325..1321414;;tcg;;197;197;;;;;;*
comp;1321612..1322493;;cds;;;;;;294;;dihydrodipicolinate synthase family protein;*
;;;;;;;;;;;;*
comp;1361929..1362942;;cds;;554;*554;;;338;;sugar ABC transporter substrate-binding protein;*
comp;1363497..1363571;;gtc;;81;81;;;;;;*
comp;1363653..1364015;;cds;;;;;;121;;response regulator;*
;;;;;;;;;;;;*
<comp;1426814..1427137;;cds;;105;105;;;108;;hp;*
;1427243..1428733;;16s;;337;;;;1491;;;*
;1429071..1429147;;atc;;59;;;59;;;;*
;1429207..1429282;;gca;;146;146;;;;;;*
<comp;1429429..1429626;;cds;@2;241;241;;;66;;P-hp;*
;1429868..1432681;;23s;;242;;;;2814;;;*
;1432924..1433038;;5s;;257;;;;115;;;*
;1433296..1433372;;atgf;;311;311;;;;;;*
;1433684..1434118;;cds;;;;;;145;;acetyl-CoA carboxylase biotin carboxyl carrier protein subunit;*
;;;;;;;;;;;;*
;1503534..1504520;;cds;;122;122;;;329;;beta-ketoacyl-ACP synthase III;*
comp;1504643..1504716;;cag;;123;123;;;;;;*
comp;1504840..1505277;;cds;;;;;;146;;Lrp/AsnC family transcriptional regulator;*
;;;;;;;;;;;;*
;1605356..1605856;;cds;;71;71;;;167;;hp;*
comp;1605928..1606003;;gcc;;152;152;;;;;;*
comp;1606156..1606545;;cds;;;;;;130;;TIGR02300 family protein;*
;;;;;;;;;;;;*
<comp;1687683..1688015;;cds;;105;105;;;111;;hp;*
;1688121..1689611;;16s;;337;;;;1491;;;*
;1689949..1690025;;atc;;59;;;59;;;;*
;1690085..1690160;;gca;;146;146;;;;;;*
<comp;1690307..1690504;;cds;;241;241;;;66;;P-hp;*
;1690746..1693559;;23s;;242;;;;2814;;;*
;1693802..1693916;;5s;;257;;;;115;;;*
;1694174..1694250;;atgf;;203;203;;;;;;*
comp;1694454..1694645;;cds;;;;;;64;;hp;*
;;;;;;;;;;;;*
<comp;2103153..2103404;;cds;;105;105;;;84;;P-hp;*
;2103510..2105000;;16s;;337;;;;1491;;;*
;2105338..2105414;;atc;;59;;;59;;;;*
;2105474..2105549;;gca;;146;146;;;;;;*
<comp;2105696..2105893;;cds;;241;241;;;66;;P-hp;*
;2106135..2108948;;23s;;242;;;;2814;;;*
;2109191..2109305;;5s;;257;;;;115;;;*
;2109563..2109639;;atgf;;633;*633;;;;;;*
;2110273..2110680;;cds;;;;;;136;;membrane protein;*
chromosomc;;;;;;;;;;;;*
<comp;56862..57137;;cds;;105;105;;;92;;P-hp;*
;57243..58733;;16s;;337;;;;1491;;;*
;59071..59147;;atc;;59;;;59;;;;*
;59207..59282;;gca;;146;146;;;;;;*
<comp;59429..59626;;cds;;241;241;;;66;;P-hp;*
;59868..62681;;23s;;242;;;;2814;;;*
;62924..63038;;5s;;257;;;;115;;;*
;63296..63372;;atgf;;196;196;;;;;;*
;63569..65377;;cds;;;;;;*603;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;125821..127722;;cds;;287;287;;;*634;;molecular chaperone DnaK;*
comp;128010..128099;;tcc;;220;220;;;;;;*
;128320..128637;;cds;;;;;;106;;hp;*
;;;;;;;;;;;;*
;227621..228004;;cds;;240;240;;;128;;membrane protein;*
comp;228245..228331;;ctg;;120;120;;;;;;*
comp;228452..228757;;cds;;;;;;102;;SelT/SelW/SelH family protein;*
;;;;;;;;;;;;*
>;378307..378396;;cds;;40;40;;;30;;P-hp;*
;378437..378513;;cgt;;174;174;;;;;;*
;378688..379500;;cds;;;;;;271;;class I SAM-dependent methyltransferase;*
;;;;;;;;;;;;*
comp;407277..407435;;cds;;167;167;;;53;;YqaE/Pmp3 family membrane protein;*
comp;407603..407678;;acg;;137;137;;;;;;*
comp;407816..408778;;cds;;;;;;321;;nitronate monooxygenase;*
;;;;;;;;;;;;*
;425990..427087;;cds;;56;56;;;366;;2'-deoxycytidine 5'-triphosphate deaminase;*
;427144..427217;;ggg;;154;154;;;;;;*
;427372..428058;;cds;;;;;;229;;aquaporin Z;*
;;;;;;;;;;;;*
;458659..459081;;cds;;285;285;;;141;;hp;*
;459367..459442;;ttc;;246;246;;;;;;*
comp;459689..460033;;cds;;;;;;115;;cation:proton antiporter;*
;;;;;;;;;;;;*
comp;493759..494025;;cds;;155;155;;;89;;hp;*
;494181..494255;;acc;;195;195;;;;;;*
comp;494451..495686;;cds;;;;;;412;;flagellin;*
;;;;;;;;;;;;*
comp;564938..568684;;cds;;361;*361;;;*1249;;PAS domain S-box protein;*
;569046..569122;;cac;;79;79;;;;;;*
;569202..570920;;cds;;;;;;573;;Ppx/GppA family phosphatase;*
;;;;;;;;;;;;*
comp;763448..764356;;cds;;202;202;;;303;;MBL fold metallo-hydrolase;*
;764559..764633;;caa;;263;263;;;;;;*
comp;764897..766549;;cds;;;;;;551;;malate dehydrogenase (quinone);*
;;;;;;;;;;;;*
comp;767020..767439;;cds;;264;264;;;140;;hp;*
;767704..767780;;ccg;;159;159;;;;;;*
comp;767940..768260;;cds;;;;;;107;;hp;*
;;;;;;;;;;;;*
comp;960360..960701;;cds;;163;163;;;114;;hp;*
;960865..960955;;agc;;500;*500;;;;;;*
comp;961456..961671;;cds;;;;;;72;;hp;*
;;;;;;;;;;;;*
;1123408..1124136;;cds;;141;141;;;243;;hp;*
;1124278..1124363;;tta;;241;241;;;;;;*
;1124605..1127115;;cds;;;;;;*837;;copper-translocating P-type ATPase;*
;;;;;;;;;;;;*
;1154411..1154803;;cds;;91;91;;;131;;DUF2934 domain-containing protein;*
comp;1154895..1154969;;aac;;176;176;;;;;;*
;1155146..1155424;;cds;;;;;;93;;hp;*
;;;;;;;;;;;;*
comp;1162767..1163027;;cds;;138;138;;;87;;hp;*
comp;1163166..1163242;;ccc;;218;218;;;;;;*
;1163461..1163997;;cds;;;;;;179;;DUF1269 domain-containing protein;*
;;;;;;;;;;;;*
;1192452..1194650;;cds;;660;*660;;;*733;;esterase-like activity of phytase family protein;*
comp;1195311..1195386;;gta;+;446;;446;;;;;*
;1195833..1195909;;gac;2 gac;41;;41;;;;;*
;1195951..1196027;;gac;;435;*435;;;;;;*
;1196463..1196828;;cds;;;;;;122;;NADH-quinone oxidoreductase subunit A;*
;;;;;;;;;;;;*
;1421863..1422201;;cds;;134;134;;;113;;hp;*
comp;1422336..1422425;;tca;;88;88;;;;;;*
comp;1422514..1422678;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
comp;1468229..1469110;;cds;;180;180;;;294;;HNH endonuclease;*
comp;1469291..1469367;;atgf;;132;132;;;;;;*
comp;1469500..1470450;;cds;;;;;;317;;hp;*
;;;;;;;;;;;;*
comp;1508458..1508883;;cds;;558;*558;;;142;;PAS domain-containing protein;*
comp;1509442..1509526;;ctc;;189;189;;;;;;*
;1509716..1510447;;cds;;;;;;244;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;1531160..1531933;;cds;;447;*447;;;258;;amino acid ABC transporter ATP-binding protein;*
;1532381..1532455;;gaa;;121;121;;;;;;*
;1532577..1532818;;cds;;89;89;;;81;;P-hp;*
;1532908..1532982;;gaa;;129;129;;;;;;*
comp;1533112..1534920;;cds;;;;;;*603;;single-stranded-DNA-specific exonuclease RecJ;*
;;;;;;;;;;;;*
;1584509..1584763;;cds;;155;155;;;85;;GlsB/YeaQ/YmgE family stress response membrane protein;*
;1584919..1584994;;aag;;134;134;;;;;;*
comp;1585129..1585575;;cds;;;;;;149;;hp;*
;;;;;;;;;;;;*
comp;1612420..1613898;;cds;;240;240;;;493;;trigger factor;*
comp;1614139..1614221;;cta;;447;*447;;;;;;*
<;1614669..1614876;;cds;;;;;;69;;P-hp;*
;;;;;;;;;;;;*
comp;1672216..1672887;;cds;;245;245;;;224;;protein-L-isoaspartate O-methyltransferase;*
comp;1673133..1673206;;tgc;;240;240;;;;;;*
comp;1673447..1673599;;cds;;;;;;51;;DUF3309 family protein;*
;;;;;;;;;;;;*
comp;1744688..1745434;;cds;;341;341;;;249;;cytochrome c biogenesis protein CcdA;*
;1745776..1745851;;aaa;;310;310;;;;;;*
;1746162..1746743;;cds;;;;;;194;;DUF1003 domain-containing protein;*
;;;;;;;;;;;;*
comp;1770727..1772280;;cds;;91;91;;;518;;tyrosine-type recombinase/integrase;*
comp;1772372..1772448;;cca;;265;265;;;;;;*
;1772714..1773019;;cds;;51;51;;;102;;ETC complex I subunit;*
;1773071..1773147;;aga;;7;7;;;;;;*
comp;1773155..1773892;;cds;;;;;;246;;DUF429 domain-containing protein;*
;;;;;;;;;;;;*
comp;1902337..1902537;;cds;;184;184;;;67;;preprotein translocase subunit SecE;*
comp;1902722..1902797;;tgg;;241;241;;;;;;*
comp;1903039..1903845;;cds;;;;;;269;;glycosyltransferase;*
;;;;;;;;;;;;*
;1908698..1908892;;cds;;70;70;;;65;;hp;*
comp;1908963..1909036;;gga;;26;26;26;;;;;*
comp;1909063..1909147;;tac;;209;209;;;;;;*
;1909357..1910244;;cds;;;;;;296;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
;1922447..1922800;;cds;;55;55;;;118;;hp;*
comp;1922856..1922931;;aca;;207;207;;;;;;*
;1923139..1924878;;cds;;;;;;580;;GGDEF domain-containing protein;*
;;;;;;;;;;;;*
;2079925..2080287;;cds;;156;156;;;121;;hp;*
comp;2080444..2080519;;atgi;;178;178;;;;;;*
;2080698..2081441;;cds;;;;;;248;;SIMPL domain-containing protein;*
;;;;;;;;;;;;*
comp;2275632..2276138;;cds;;522;*522;;;169;;winged helix-turn-helix transcriptional regulator;*
;2276661..2276737;;cgg;;287;287;;;;;;*
;2277025..2277264;;cds;;;;;;80;;hp;*
;;;;;;;;;;;;*
comp;2388300..2388497;;cds;;87;87;;;66;;hp;*
;2388585..2388659;;ggc;;361;*361;;;;;;*
;2389021..2391024;;cds;;;;;;*668;;methyl-accepting chemotaxis protein;*
;;;;;;;;;;;;*
comp;2490745..2491854;;cds;;535;*535;;;370;;2Fe-2S iron-sulfur cluster binding domain-containing protein;*
comp;2492390..2492466;;atgf;;287;;;;115;;;*
comp;2492754..2492868;;5s;;242;;;;2814;;;*
comp;2493111..2495924;;23s;;241;241;;;;;;*
>;2496166..2496363;;cds;;146;146;;;66;;P-hp;*
comp;2496510..2496585;;gca;;59;;;59;;;;*
comp;2496645..2496721;;atc;;337;;;;;;;*
comp;2497059..2498549;;16s;;105;105;;;1491;;;*
>;2498655..2498930;;cds;;;;;;92;;P-hp;*

agr cumuls[modifier | modifier le wikicode]

agr cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;5;1;;;1;0;1;;100;24;1;0
;16atcgca235;0;20;;;50;3;40;;200;30;30;1
;Id-atgf;5;40;1;;100;12;80;;300;14;60;3
;16s23s;0;60;1;5;150;22;120;;400;8;90;17
;max a;3;80;;;200;17;160;;500;2;120;13
;a doubles;0;100;;;250;18;200;;600;4;150;14
;spéciaux;0;120;;;300;9;240;;700;4;180;5
;total aas;15;140;;;350;4;280;;800;1;210;1
sans ;opérons;38;160;;;400;2;320;;900;1;240;3
;1 aa;35;180;;;450;3;360;;1000;0;270;7
;max a;3;200;;;500;1;400;;1100;0;300;4
;a doubles;1;;2;;;6;;;;1;;21
;total aas;42;;4;5;;97;;0;;89;;89
total aas;;57;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;;59;;213;;;;230;;
;;;variance;;0;;134;;;;209;;
sans jaune;;;moyenne;33;;;172;;;;185;;137
;;;variance;;;;76;;;;131;;71

agr blocs[modifier | modifier le wikicode]

agr blocs;;;;;;;;;
chromoml;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;
cds;105;108;hp;105;111;hp;105;84;P-hp
16s;337;1491;;337;1491;;337;1491;
atc;59;;;59;;;59;;
gca;146;;;146;;;146;;
cds;241;66;P-hp;241;66;P-hp;241;66;P-hp
23s;242;2814;;242;2814;;242;2814;
5s;257;115;;257;115;;257;115;
atgf;311;;;203;;;633;;
cds;;145;CoA;;64;hp;;136;membrane
chromosomc;;;;;;;;;
cds;105;92;P-hp;105;92;P-hp;;;
16s;337;1491;;337;1491;;;;
atc;59;;;59;;;;;
gca;146;;;146;;;;;
cds;241;66;P-hp;241;66;P-hp;;;
23s;242;2814;;242;2814;;;;
5s;257;115;;287;115;;;;
atgf;196;;;535;;;;;
cds;;603;helicase;;370;2Fe-2S;;;
;;;;;;;;;
;;;;;;;;;
CoA;acetyl-CoA carboxylase biotin carboxyl carrier protein subunit;;;;;;;;
helicase;DNA helicase RecQ;;;;;;;;
2Fe-2S;2Fe-2S iron-sulfur cluster binding domain-containing protein;;;;;;;;
membrane;membrane protein;;;;;;;;

agr distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;5
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;;tgc;1;;ttc;;tcc;;tac;1;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;1;aac;1;agc;1;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;;;atc;;acc;;aac;;agc;
ctc;1;ccc;1;cac;1;cgt;1;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;
gtc;1;gcc;1;gac;;ggc;1;;gtc;;gcc;;gac;;ggc;1;;gtc;;gcc;;gac;2;ggc;;;gtc;;gcc;;gac;;ggc;
tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;2;gga;;;gta;1;gca;;gaa;;gga;1;;gta;;gca;;gaa;;gga;;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;;acg;1;aag;1;agg;;;atgj;1;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;1;cag;1;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
agr;;35;;;;;35;;agr;5;;;;;;5;;agr;2;;;;;;;;agr;;;;5;;;5

aua[modifier | modifier le wikicode]

aua opérons[modifier | modifier le wikicode]

https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP006367.1;aua;;genome;;pau20rrn;;;;;;;
67%GC;8.8.19 Paris;16s 1;;doubles;intercalaires;CDS;aa;avec aa;aas;cdsd;protéines;
Aureimonas sp. AU20;;;;;;;;;;;;
;;;;;;;;;;;;
pAU20rrn;;;;;;;;;;;;
;324..1028;;CDS rep;;461;;;;235;;replication initiation protein;*
comp;1490..1604;;5s;@1;82;;;;115;;;
comp;1687..4515;;23s;;-15;;;;2829;;;
comp;4501..4851;;CDS hp;;142;;;;117;;hp;
comp;4994..5069;;gca;;33;;;33;;;;
comp;5103..5179;;atc;;233;;;;;;;
comp;5413..6898;;16s;;1752;;;;1486;;;
comp;8651..9109;;CDS hp;;;;;;153;;hp;
;;;;;;;;;;;;
Chromosome;;;;;;;;;;;;
comp;170900..171925;;CDS;;368;368;;;342;;;
;172294..172378;;ctg;;130;130;;;;130;;
;172509..172772;;CDS;;;;;;88;;;
;;;;;;;;;;;;
comp;330094..330690;;CDS;;338;338;;;199;;;
;331029..331103;;ggc;@2;404;;*404;;;;;
comp;331508..331584;;atgf;+;44;;44;;;;;
comp;331629..331705;;atgf;2 atg;255;255;;;;255;;
comp;331961..333217;;CDS;;;;;;419;;;
;;;;;;;;;;;;
;344949..346025;;CDS;;589;589;;;359;589;;
;346615..346704;;tcg;;609;609;;;;;;
;347314..348471;;CDS;;;;;;386;;;
;;;;;;;;;;;;
comp;393335..395356;;CDS;;800;*800;;;*674;;;
comp;396157..396232;;gcc;;439;439;;;;439;;
comp;396672..397094;;CDS;;;;;;141;;;
;;;;;;;;;;;;
;635177..637537;;CDS;;640;640;;;*787;;;
comp;638178..638253;;gcg;;182;182;;;;182;;
;638436..638738;;CDS;;;;;;101;;;
;;;;;;;;;;;;
comp;924507..925466;;CDS;;529;529;;;320;;;
comp;925996..926085;;tcc;;349;349;;;;349;;
;926435..926767;;CDS;;;;;;111;;;
;;;;;;;;;;;;
;1216789..1217439;;CDS;;60;60;;;217;60;;
;1217500..1217576;;agg;;68;68;;;;;;
comp;1217645..1218760;;CDS;;;;;;372;;;
;;;;;;;;;;;;
;1350534..1352180;;CDS;@4;-30;*-30;;;*549;;;
comp;1352151..1352227;;cgt;+;51;;51;;;;;
comp;1352279..1352355;;cgt;2 cgt;169;169;;;;;;
comp;1352525..1353967;;CDS;;;;;;*481;;;
;;;;;;;;;;;;
;1401921..1402442;;CDS;;142;142;;;174;142;;
;1402585..1402661;;cac;;585;585;;;;;;
;1403247..1404875;;CDS;;;;;;*543;;;
;;;;;;;;;;;;
;1544580..1546277;;CDS;;455;455;;;*566;;;
comp;1546733..1546808;;ttc;@2;161;;161;;;;;
;1546970..1547044;;acc;;414;414;;;;414;;
;1547459..1549516;;CDS;;;;;;*686;;;
;;;;;;;;;;;;
;1609269..1610216;;CDS;;278;278;;;316;;;
comp;1610495..1610571;;cgg;;121;121;;;;121;;
comp;1610693..1611427;;CDS;;;;;;245;;;
;;;;;;;;;;;;
>;1683255..1683581;;CDS;;209;209;;;109;209;;
comp;1683791..1683864;;cag;;580;580;;;;;;
;1684445..1685734;;CDS;;;;;;430;;;
;;;;;;;;;;;;
;1700827..1701852;;CDS;;300;300;;;342;;;
comp;1702153..1702227;;gtc;+;128;;128;;;;;
comp;1702356..1702430;;gtc;3 gtc;186;;186;;;;;
comp;1702617..1702691;;gtc;;68;68;;;;68;;
comp;1702760..1703125;;CDS;;;;;;122;;;
;;;;;;;;;;;;
;1946715..1946936;;CDS;;6;6;;;74;6;;
comp;1946943..1947018;;atgi;;105;105;;;;;;
;1947124..1947345;;CDS;;;;;;74;;;
;;;;;;;;;;;;
;1981934..1983139;;CDS;;139;139;;;402;139;;
;1983279..1983368;;agc;;825;*825;;;;;;
;1984194..1985339;;CDS;;;;;;382;;;
;;;;;;;;;;;;
;1996083..1997171;;CDS;;243;243;;;363;;;
comp;1997415..1997490;;acg;;112;112;;;;112;;
comp;1997603..1998583;;CDS;;;;;;327;;;
;;;;;;;;;;;;
comp;2263930..2264781;;CDS;;30;30;;;284;30;;
comp;2264812..2264886;;gtg;;111;111;;;;;;
comp;2264998..2265768;;CDS;;;;;;257;;;
;;;;;;;;;;;;
;2363764..2364786;;CDS;;18;18;;;341;18;;
comp;2364805..2364879;;gaa;+;140;;140;;;;;
comp;2365020..2365094;;gaa;2 gaa;69;69;;;;69;;
comp;2365164..2366144;;CDS;;;;;;327;;;
;;;;;;;;;;;;
;2367774..2368247;;CDS;;105;105;;;158;;;
;2368353..2368429;;cca;@3;43;43;;;;43;;
;2368473..2368778;;CDS;;36;36;;;102;36;;
;2368815..2368890;;aga;;448;448;;;;;;
;2369339..2369929;;CDS;;;;;;197;;;
;;;;;;;;;;;;
comp;2401620..2402732;;CDS;;155;155;;;371;155;;
comp;2402888..2402963;;aaa;;169;169;;;;;;
;2403133..2403870;;CDS;;;;;;246;;;
;;;;;;;;;;;;
;2419689..2420852;;CDS;;13;13;;;388;13;;
;2420866..2420955;;tca;;238;238;;;;;;
;2421194..2421934;;CDS;;;;;;247;;;
;;;;;;;;;;;;
comp;2601493..2601858;;CDS;;287;287;;;122;287;;
comp;2602146..2602222;;gac;+;58;;58;;;;;
comp;2602281..2602357;;gac;2 gac;270;;270;;;;;
;2602628..2602703;;gta;@2;330;330;;;;;;
comp;2603034..2603312;;CDS;;;;;;93;;;
;;;;;;;;;;;;
comp;2608494..2609852;;CDS;;73;73;;;*453;73;;
comp;2609926..2610009;;cta;;307;307;;;;;;
;2610317..2610460;;CDS;;;;;;48;;;
;;;;;;;;;;;;
comp;2641174..2641824;;CDS;@3;125;125;;;217;125;;
comp;2641950..2642023;;tgc;;153;153;;;;;;
comp <;2642177..2642443;;CDS;;296;296;;;89;;;
;2642740..2642814;;aac;;269;269;;;;269;;
;2643084..2644127;;CDS;;;;;;348;;;
;;;;;;;;;;;;
comp;2651145..2652935;;CDS;;239;239;;;*597;239;;
;2653175..2653259;;tta;;265;265;;;;;;
;2653525..2653725;;CDS;;;;;;67;;;
;;;;;;;;;;;;
comp;2749758..2750318;;CDS;;3102;*3102;;;187;;;
comp;2753421..2753497;;atgf;;83;83;;;;83;;
comp;2753581..2754180;;CDS;;;;;;200;;;
;;;;;;;;;;;;
;2768127..2769224;;CDS;;63;63;;;366;63;;
comp;2769288..2769364;;ccg;@2;173;;173;;;;;
;2769538..2769612;;caa;;528;528;;;;;;
comp;2770141..2770566;;CDS;;;;;;142;;;
;;;;;;;;;;;;
comp;2787112..2788920;;CDS;;217;217;;;*603;217;;
comp;2789138..2789214;;ccc;;265;265;;;;;;
comp;2789480..2790022;;CDS;;;;;;181;;;
;;;;;;;;;;;;
;2927857..2928789;;CDS;;136;136;;;311;136;;
comp;2928926..2929010;;ctc;+;132;;132;;;;;
comp;2929143..2929227;;ctc;2 ctc;175;175;;;;;;
;2929403..2930164;;CDS;;;;;;254;;;
;;;;;;;;;;;;
comp;2971057..2971257;;CDS;;130;130;;;67;;;
comp;2971388..2971463;;tgg;;53;53;;;;53;;
comp;2971517..2972374;;CDS;;;;;;286;;;
;;;;;;;;;;;;
comp;2973322..2974497;;CDS;;291;291;;;392;;;
comp;2974789..2974862;;gga;;24;;24;;;;;
comp;2974887..2974971;;tac;;259;259;;;;259;;
;2975231..2976097;;CDS;;;;;;289;;;
;;;;;;;;;;;;
comp;2979955..2981049;;CDS;;221;221;;;365;;;
;2981271..2981346;;aca;;55;55;;;;55;;
comp;2981402..2981752;;CDS;;;;;;117;;;
;;;;;;;;;;;;
comp;3063743..3064045;;CDS;;106;106;;;101;106;;
comp;3064152..3064227;;aag;;147;147;;;;;;
comp;3064375..3064803;;CDS;;;;;;143;;;
;;;;;;;;;;;;
comp;3194307..3194906;;CDS;;249;249;;;200;;;
;3195156..3195232;;atgj;;173;173;;;;173;;
;3195406..3196356;;CDS;;;;;;317;;;
;;;;;;;;;;;;
comp;3206006..3206455;;CDS;;743;*743;;;150;;;
comp;3207199..3207273;;gag;;50;50;;;;50;;
comp;3207324..3207689;;CDS;;;;;;122;;;
;;;;;;;;;;;;
;3398165..3399901;;CDS;;554;554;;;*579;;;
;3400456..3400530;;aac;;115;115;;;;115;;
;3400646..3400924;;CDS;;;;;;93;;;
;;;;;;;;;;;;
;3401737..3403497;;CDS;;227;227;;;*587;;;
comp;3403725..3403799;;ggc;;208;;208;;;;;
comp;3404008..3404082;;ggg;;74;74;;;;74;;
comp;3404157..3404819;;CDS;;;;;;221;;;
;;;;;;;;;;;;
comp;3597872..3598414;;CDS;;370;370;;;181;;;
;3598785..3598869;;ttg;;151;151;;;;151;;
comp;3599021..3599251;;CDS;;;;;;77;;;

aua cumuls[modifier | modifier le wikicode]

aua cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds chromosome;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;1;1;0;-;1;1;1;0;100;10;1;0
;16 aas 23 5s ;0;20;0;;50;7;40;7;200;22;30;0
;16 atc gca hp;1;40;1;;100;10;80;9;300;11;60;1
;16 cds 23 5s ;0;60;3;;150;14;120;9;400;20;90;7
;max a;2;80;0;;200;8;160;4;500;5;120;8
;a doubles;0;100;0;;250;8;200;3;600;6;150;7
;spéciaux;0;120;0;;300;10;240;4;700;3;180;2
;total aas;2;140;3;;350;4;280;1;800;1;210;7
sans ;opérons;38;160;0;;400;2;320;0;900;0;240;3
;1 aa;26;180;2;;450;3;360;2;1000;0;270;5
;max a;3;200;1;;500;1;400;0;1100;0;300;3
;a doubles;6;;3;;;12;;1;;0;;35
;total aas;53;;13;0;;80;;40;;78;;78
total aas;;55;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;;;
;;;variance;;;;;;;;;;
sans jaune;;;moyenne;131;;;226;;153;;235;;158
;;;variance;75;;;165;;128;;125;;69

aua blocs[modifier | modifier le wikicode]

CDS ;1752;153;hp
16s;233;1486;
atc;33;;
gca;142;;
CDS;-15;117;hp
23s;82;2829;
5s;461;115;
CDS ;;235;replication initiation protein

aua distribution[modifier | modifier le wikicode]

atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;2
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;aua;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;ctc2;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;1;tac;;tgc;1;gtc3;ttc;1;tcc;;tac;1;tgc;;;ttc;;tcc;;tac;;tgc;
atc;;acc;;aac;2;agc;1;gac2;atc;;acc;1;aac;;agc;;;atc;;acc;;aac;;agc;
ctc;;ccc;1;cac;1;cgt;;gaa2;ctc;;ccc;;cac;;cgt;;;ctc;2;ccc;;cac;;cgt;2
gtc;;gcc;1;gac;;ggc;;cgt2;gtc;;gcc;;gac;;ggc;2;;gtc;3;gcc;;gac;2;ggc;
tta;1;tca;1;taa;;tga;;atgf2;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;;cga;;;cta;;cca;;caa;1;cga;;;cta;;cca;;caa;;cga;
gta;;gca;;gaa;;gga;;;gta;1;gca;;gaa;;gga;1;;gta;;gca;;gaa;2;gga;
ttg;1;tcg;1;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;1;acg;1;aag;1;agg;1;;atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;
ctg;1;ccg;;cag;1;cgg;1;;ctg;;ccg;1;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;1;gcg;1;gag;1;ggg;;;gtg;;gcg;;gag;;ggg;1;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;duplicata;1aa;-5s;+5s;-16s;+16s;total
aua;;30;;;;;30;;aua;10;;;;;;10;;aua;13;;;;;;13

alpha synthèse[modifier | modifier le wikicode]

alpha distribution par génome[modifier | modifier le wikicode]

alpha8;>1aa;1aa;-5s;+5s;-16s;+16s;duplicata;1-3aas;total
rtb;8;25;;;;0;;;33
rpm;7;30;;;;8;42;5;92
rru;4;36;;;;8;4;3;55
oan;6;41;;;;8;;4;59
abq;20;38;;;;16;10;3;87
abs;20;39;;;;8;10;3;80
agr;5;35;;;;10;2;5;57
aua;10;30;;;;2;13;;55
;;;;;;;;;
total;80;274;0;0;0;60;81;23;518

alpha distribution du total[modifier | modifier le wikicode]

alpha8;;;;;;;435;;alpha8;;;;;;;83
atgi;9;tct;;tat;;atgf;7;;atgi;;tct;;tat;;atgf;23
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;13;tcc;8;tac;10;tgc;8;;ttc;;tcc;;tac;;tgc;
atc;1;acc;13;aac;14;agc;8;;atc;33;acc;0;aac;;agc;
ctc;11;ccc;8;cac;11;cgt;13;;ctc;;ccc;;cac;;cgt;
gtc;13;gcc;16;gac;17;ggc;22;;gtc;;gcc;;gac;0;ggc;
tta;8;tca;8;taa;;tga;1;;tta;;tca;0;taa;;tga;
ata;;aca;9;aaa;10;aga;8;;ata;;aca;;aaa;;aga;
cta;8;cca;9;caa;8;cga;;;cta;;cca;;caa;;cga;
gta;7;gca;2;gaa;12;gga;8;;gta;;gca;27;gaa;;gga;
ttg;7;tcg;7;tag;;tgg;10;;ttg;;tcg;;tag;;tgg;0
atgj;10;acg;8;aag;10;agg;6;;atgj;;acg;;aag;;agg;
ctg;15;ccg;10;cag;10;cgg;8;;ctg;;ccg;;cag;;cgg;
gtg;9;gcg;9;gag;9;ggg;7;;gtg;;gcg;;gag;;ggg;
alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total;;alpha;>1aa;1aa;-5s;+5s;-16s;+16s;total
total;161;274;0;0;0;0;435;;1-3aas;;;;23;;60;83

alpha distribution par type[modifier | modifier le wikicode]

alpha8;;;;;;;435;;alpha8;;;;;;;274;;alpha8;;;;;;;80;;alpha8;;;;;;;81;;alpha6;;;;;;;
atgi;9;tct;0;tat;0;atgf;7;;atgi;8;tct;;tat;;atgf;5;;atgi;1;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;2;;atgi;;tct;;tat;;atgf;23
att;0;act;0;aat;0;agt;0;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;0;cct;0;cat;0;cgc;0;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;13;tcc;8;tac;10;tgc;8;;ttc;8;tcc;8;tac;2;tgc;4;;ttc;1;tcc;;tac;8;tgc;4;;ttc;4;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;
atc;1;acc;13;aac;14;agc;8;;atc;;acc;5;aac;5;agc;8;;atc;1;acc;3;aac;7;agc;;;atc;;acc;5;aac;2;agc;;;atc;;acc;;aac;;agc;
ctc;11;ccc;8;cac;11;cgt;13;;ctc;9;ccc;8;cac;7;cgt;8;;ctc;;ccc;;cac;;cgt;;;ctc;2;ccc;;cac;4;cgt;5;;ctc;;ccc;;cac;;cgt;
gtc;13;gcc;16;gac;17;ggc;22;;gtc;8;gcc;5;gac;1;ggc;11;;gtc;2;gcc;5;gac;10;ggc;7;;gtc;3;gcc;6;gac;6;ggc;4;;gtc;;gcc;;gac;;ggc;
tta;8;tca;8;taa;0;tga;1;;tta;8;tca;8;taa;;tga;1;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;0;aca;9;aaa;10;aga;8;;ata;;aca;8;aaa;9;aga;8;;ata;;aca;1;aaa;1;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;
cta;8;cca;9;caa;8;cga;0;;cta;8;cca;8;caa;6;cga;;;cta;;cca;1;caa;2;cga;;;cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;
gta;7;gca;2;gaa;12;gga;8;;gta;4;gca;1;gaa;6;gga;;;gta;3;gca;1;gaa;2;gga;8;;gta;;gca;;gaa;4;gga;;;gta;;gca;;gaa;;gga;
ttg;7;tcg;7;tag;0;tgg;10;;ttg;7;tcg;7;tag;;tgg;10;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;10;acg;8;aag;10;agg;6;;atgj;7;acg;8;aag;4;agg;6;;atgj;1;acg;;aag;;agg;;;atgj;2;acg;;aag;6;agg;;;atgj;;acg;;aag;;agg;
ctg;15;ccg;10;cag;10;cgg;8;;ctg;6;ccg;3;cag;6;cgg;7;;ctg;4;ccg;1;cag;2;cgg;1;;ctg;5;ccg;6;cag;2;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;9;gcg;9;gag;9;ggg;7;;gtg;3;gcg;4;gag;5;ggg;6;;gtg;;gcg;2;gag;;ggg;1;;gtg;6;gcg;3;gag;4;ggg;;;gtg;;gcg;;gag;;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total;;alpha 6;>1aa;1aa;-5s;+5s;-16s;+16s;total
;;;;;;;;;;;*;;;;;;;;*;;;;;;;;;;;;;;;;;1-3aas;;;;23;;;

alpha par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;alpha8;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;90;14;38;;;;142;
16;moyen;103;15;16;;;60;134;
14;fort;81;51;27;;23;;182;
; ;274;80;81;;23;60;518;
10;g+cga;46;6;27;;;;79;
2;agg+cgg;13;1;;;;;14;
4;carre ccc;30;7;11;;;;48;
5;autres;1;;;;;;1;
;;90;14;38;;;;142;
;total tRNAs  ‰ ;;;;;;;;
;alpha8;1aa;>1aa;dup;+5s;1-3aas;autres;alpha  ‰;ref. ‰
21;faible;174;27;73;;;;274;26
16;moyen;199;29;31;;;116;259;324
14;fort;156;98;52;;44;;351;650
;;529;154;156;;44;116;518;729
10;g+cga;89;12;52;;;;153;10
2;agg+cgg;25;2;0;;;;27;
4;carre ccc;58;14;21;;;;93;16
5;autres;2;0;0;;;;2;
;;174;27;73;;;;274;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;alpha8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;207;32;87;326;26;33;18;47
16;moyen;237;34;37;308;324;38;19;20
14;fort;186;117;62;366;650;30;64;33
;;630;184;186;435;729;274;80;81
10;g+cga;106;14;62;182;10;51;;71
2;agg+cgg;30;2;0;32;;14;;
4;carre ccc;69;16;25;110;16;33;;29
5;autres;2;0;0;2;;1;;
;;207;32;87;326;;90;;38

alpha, estimation des -rRNAs[modifier | modifier le wikicode]

alpha;;;;;;;;;;;;;;;;;;;;;;;;;
70 génomes total avec rRNA;;;;alpha8;total;ttt;tgt;;100 génomes total avec rRNA;;;;alpha;total;ttt;tgt;;;;;;;;;
effectifs;sans +16s;;;70;525; ; ;;indices;;;;70;750;0;0;;alpha8;effectifs;;1aa+>1aa+dup;;;;435
atgi;;tct;;tat;;atgf;144;;atgi;;tct;;tat;;atgf;206;;atgi;9;tct;;tat;;atgf;7
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;13;tcc;8;tac;10;tgc;8
atc;189;acc;;aac;;agc;;;atc;270;acc;;aac;;agc;;;atc;1;acc;13;aac;14;agc;8
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;11;ccc;8;cac;11;cgt;13
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;;;gtc;13;gcc;16;gac;17;ggc;22
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;8;tca;8;taa;;tga;1
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;9;aaa;10;aga;8
cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;8;cca;9;caa;8;cga;
gta;;gca;191;gaa;;gga;;;gta;;gca;273;gaa;;gga;;;gta;7;gca;2;gaa;12;gga;8
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;7;tcg;7;tag;;tgg;10
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;10;acg;8;aag;10;agg;6
ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;1.4;;ctg;15;ccg;10;cag;10;cgg;8
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;9;gcg;9;gag;9;ggg;7
;;380;;144;;1;525;;;;543;;206;;1;750;;;;134;;159;;142;435
27.5.20 Tanger;;;;alpha;total;ttt;tgt;;30.5.20 Tanger;;;;alpha;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;100;16935;0.6;0.3;;indices;sans +16s;;;347;16935;0,6;0,3;;alpha8;indices;;1aa+>1aa+dup;;;;
atgi;106;tct;;tat;0.9;atgf;30;;atgi;106;tct;;tat;0.9;atgf;236;;atgi;113;tct;;tat;;atgf;88
att;;act;0.3;aat;;agt;;;att;;act;0.3;aat;;agt;;;att;;act;;aat;;agt;
ctt;1.2;cct;0.3;cat;;cgc;0.3;;ctt;1.2;cct;0.3;cat;;cgc;0.3;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;0.6;ggt;;;gtt;;gct;;gat;0.6;ggt;;;gtt;;gct;;gat;;ggt;
ttc;109;tcc;101;tac;104;tgc;105;;ttc;109;tcc;101;tac;104;tgc;105;;ttc;163;tcc;100;tac;125;tgc;100
atc;-1;acc;108;aac;111;agc;101;;atc;269;acc;108;aac;111;agc;101;;atc;13;acc;163;aac;175;agc;100
ctc;116;ccc;82;cac;102;cgt;112;;ctc;116;ccc;82;cac;102;cgt;112;;ctc;138;ccc;100;cac;138;cgt;163
gtc;105;gcc;97;gac;150;ggc;133;;gtc;105;gcc;97;gac;150;ggc;133;;gtc;163;gcc;200;gac;213;ggc;275
tta;94;tca;102;taa;1.2;tga;10;;tta;94;tca;102;taa;1.2;tga;10;;tta;100;tca;100;taa;;tga;13
ata;1.7;aca;107;aaa;106;aga;103;;ata;1.7;aca;107;aaa;106;aga;103;;ata;;aca;113;aaa;125;aga;100
cta;103;cca;104;caa;113;cga;9.2;;cta;103;cca;104;caa;113;cga;9.2;;cta;100;cca;113;caa;100;cga;
gta;105;gca;-2;gaa;141;gga;104;;gta;105;gca;271;gaa;141;gga;104;;gta;88;gca;25;gaa;150;gga;100
ttg;91;tcg;89;tag;0.3;tgg;102;;ttg;91;tcg;89;tag;0.3;tgg;102;;ttg;88;tcg;88;tag;;tgg;125
atgj;116;acg;91;aag;80;agg;75;;atgj;116;acg;91;aag;80;agg;75;;atgj;125;acg;100;aag;125;agg;75
ctg;90;ccg;71;cag;65;cgg;106;;ctg;90;ccg;71;cag;65;cgg;107;;ctg;188;ccg;125;cag;125;cgg;100
gtg;59;gcg;59;gag;54;ggg;70;;gtg;59;gcg;59;gag;54;ggg;70;;gtg;113;gcg;113;gag;113;ggg;88
;;1421;;1529;;1241;4191;;;;1964;;1735;;1242;4941;;;;1675;;1988;;1775;5438
rapports;;72;;88;;100;85;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;alpha8;indices;;1aa+>1aa+dup;;différence;;
atgi;100;tct;;tat;;atgf;13;;fiches;45.571;;;fréquences;;;;;atgi;6;tct;;tat;100;atgf;66
att;;act;100;aat;;agt;;;total des aas sans rRNA;3190;;;0/0;;;;;att;;act;100;aat;;agt;
ctt;100;cct;;cat;;cgc;;;avec;525;;;10;18;;;;ctt;100;cct;100;cat;;cgc;100
gtt;;gct;;gat;;ggt;;;genom;70;;;20;9;;;;gtt;;gct;;gat;100;ggt;
ttc;100;tcc;100;tac;100;tgc;100;;;;;;30;2;;;;ttc;33;tcc;1;tac;17;tgc;5
atc;0;acc;100;aac;100;agc;100;;alpha8;54.375;;;40;6;;;;atc;108;acc;34;aac;37;agc;1
ctc;100;ccc;100;cac;100;cgt;100;;sans;435;;;50;4;39;;;ctc;16;ccc;18;cac;26;cgt;31
gtc;100;gcc;100;gac;100;ggc;100;;avec;205;;;60;4;;;;gtc;35;gcc;52;gac;29;ggc;52
tta;100;tca;100;taa;;tga;100;;genom;8;;;70;1;;;;tta;6;tca;2;taa;100;tga;20
ata;100;aca;100;aaa;100;aga;100;;;;;;80;0;;;;ata;100;aca;5;aaa;15;aga;3
cta;100;cca;100;caa;100;cga;100;;L’estimation par alpha8;;;;90;0;;;;cta;3;cca;8;caa;12;cga;100
gta;100;gca;-1;gaa;100;gga;100;;est  19 % au dessus;;;;100;2;;;;gta;17;gca;107;gaa;6;gga;4
ttg;100;tcg;100;tag;;tgg;100;;des aas sans;;;;;2;;;;ttg;4;tcg;2;tag;100;tgg;18
atgj;100;acg;100;aag;100;agg;100;;70;;100;;;48;;;;atgj;7;acg;9;aag;36;agg;0
ctg;100;ccg;100;cag;100;cgg;99;;atc;189;269;;;;;;;ctg;52;ccg;43;cag;48;cgg;5
gtg;100;gcg;100;gag;100;ggg;100;;gca;191;271;;;;;;;gtg;48;gcg;48;gag;52;ggg;20
;;;;;;;;;;;;;;;;;;;;178;;330;;451;959

cvi[modifier | modifier le wikicode]

cvi opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Chro_viol_ATCC_12472/chroViol-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_005085.1;cvi;genome;;;
65%GC;30.6.19 Paris;16s  8;98;doubles;intercalaires
;Chromobacterium violaceum ATCC 12472;;;;
;421217..422762;;16s;@1;179
;422942..423018;;atc;;86
;423105..423180;;gca;;249
;423430..426324;;23s;;125
;426450..426564;;5s;;
;;;;;
;502182..503727;;16s;;79
;503807..503883;;atc;;12
;503896..503971;;gca;;250
;504222..507116;;23s;;122
;507239..507353;;5s;;
;;;;;
comp;682034..682118;;ttg;;
;;;;;
;759824..759908;;tac;;
;;;;;
comp;878775..878849;;agg;;
;;;;;
;955155..955230;;gcg;;
;;;;;
;975612..975696;;ctc;;
;;;;;
;1006822..1006897;;ttc;+;6
;1006904..1006979;;ttc;2 ttc;
;;;;;
;1058518..1058611;;agc;;6
;1058618..1058694;;cgt;;3
;1058698..1058772;;gaa;;
;;;;;
comp;1061741..1061815;;gaa;+;3
comp;1061819..1061895;;cgt;2 gaa;7
comp;1061903..1061977;;gaa;2cgt;5
comp;1061983..1062059;;cgt;;
;;;;;
;1154020..1155565;;16s;;179
;1155745..1155821;;atc;;86
;1155908..1155983;;gca;;250
;1156234..1159128;;23s;;122
;1159251..1159365;;5s;;
;;;;;
comp;1263556..1263645;;tcg;;
;;;;;
;1273710..1273786;;atgf;;
;;;;;
;1377435..1377510;;ggc;+;23
;1377534..1377609;;ggc;5 ggc;22
;1377632..1377707;;ggc;;24
;1377732..1377807;;ggc;;29
;1377837..1377912;;ggc;;45
;1377958..1378031;;tgc;;
;;;;;
;1387010..1387094;;tta;;
;;;;;
;1420085..1420161;;gtc;;
;;;;;
;1427771..1427847;;ccc;;
;;;;;
comp;1433244..1433319;;aac;+;32
comp;1433352..1433427;;aac;3 aac;31
comp;1433459..1433534;;aac;;
;;;;;
;1646821..1648366;;16s;;179
;1648546..1648622;;atc;;86
;1648709..1648784;;gca;;249
;1649034..1651928;;23s;;122
;1652051..1652165;;5s;;89
;1652255..1652369;;5s;;
;;;;;
;1746117..1746207;;tcc;+;53
;1746261..1746351;;tcc;2 tcc;
;;;;;
;1978844..1978919;;aac;;
;;;;;
comp;2094372..2094447;;cac;+;26
comp;2094474..2094549;;cac;3 cac;45
comp;2094595..2094670;;cac;;27
comp;2094698..2094774;;aga;;18
comp;2094793..2094869;;cca;;
;;;;;
comp;2511625..2511712;;tca;;
;;;;;
comp;2747299..2747375;;gac;;7
comp;2747383..2747458;;gta;;
;;;;;
;2853221..2853305;;cta;;
;;;;;
;3187082..3187157;;aca;;
;;;;;
;3257362..3257437;;gcc;;
;;;;;
;3262246..3262321;;gcc;+;8
;3262330..3262405;;gaa;2 gcc;11
;3262417..3262492;;gcc;;
;;;;;
comp;3371478..3371592;;5s;;122
comp;3371715..3374609;;23s;;250
comp;3374860..3374935;;gca;;12
comp;3374948..3375024;;atc;;79
comp;3375104..3376649;;16s;;
;;;;;
;3472822..3472897;;gta;+;12
;3472910..3472986;;gac;5 gta;26
;3473013..3473088;;gta;6 gac;12
;3473101..3473177;;gac;1gtg;26
;3473204..3473279;;gta;;12
;3473292..3473368;;gac;;26
;3473395..3473470;;gta;;12
;3473483..3473559;;gac;;27
;3473587..3473663;;gtg;;6
;3473670..3473746;;gac;;27
;3473774..3473850;;gtg;;6
;3473857..3473933;;gac;;
;;;;;
;3622292..3622365;;ggg;;
;;;;;
comp;3820120..3820234;;5s;;122
comp;3820357..3823251;;23s;;249
comp;3823501..3823576;;gca;;86
comp;3823663..3823739;;atc;;179
comp;3823919..3825464;;16s;;
;;;;;
;3828836..3828922;;ctg;+;51
;3828974..3829060;;ctg;4 ctg;33
;3829094..3829180;;ctg;;57
;3829238..3829324;;ctg;;
;;;;;
;3854547..3854622;;caa;@2;*557
;3855180..3855255;;acg;;61
;3855317..3855393;;ccg;+;78
;3855472..3855548;;ccg;2 ccg;
;;;;;
comp;4059834..4059912;;atgi;;
;;;;;
comp;4244591..4244705;;5s;;122
comp;4244828..4247722;;23s;;249
comp;4247972..4248047;;gca;;86
comp;4248134..4248210;;atc;;179
comp;4248390..4249935;;16s;;
;;;;;
comp;4325718..4325794;;atgf;;
;;;;;
comp;4389268..4389342;;caa;;
;;;;;
;4402077..4402153;;cgg;;
;;;;;
comp;4434130..4434244;;5s;;122
comp;4434367..4437261;;23s;;249
comp;4437511..4437586;;gca;;86
comp;4437673..4437749;;atc;;179
comp;4437929..4439474;;16s;;
;;;;;
;4474196..4474272;;atg;+;35
;4474308..4474384;;atg;2 atg;
;;;;;
comp;4529616..4529690;;acc;;
;;;;;
comp;4532053..4532128;;tgg;;
;;;;;
comp;4533370..4533444;;acc;;24
comp;4533469..4533542;;gga;;52
comp;4533595..4533679;;tac;;
;;;;;
comp;4586712..4586787;;aaa;+;38
comp;4586826..4586901;;aag;3 aaa;35
comp;4586937..4587012;;aaa;2 aag;28
comp;4587041..4587116;;aag;;37
comp;4587154..4587229;;aaa;;

cvi cumuls[modifier | modifier le wikicode]

cvi cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;8;1;0;-
;16 23 5s 0;0;20;16;2
;16 atc gca;8;40;20;
;16 23 5s a;0;60;6;
;max a;2;80;2;
;a doubles;0;100;0;6
;spéciaux;0;120;0;
;total aas;16;140;0;
sans ;opérons;37;160;0;
;1 aa;22;180;0;
;max a;12;200;0;
;a doubles;12;;1;
;total aas;82;;45;8
total aas;;98;;;
remarques;;2;;;
avec jaune;;;moyenne;;
;;;variance;;
sans jaune;;;moyenne;26;86
;;;variance;18;0

cvi blocs[modifier | modifier le wikicode]

cvi blocs;;;;;;
16s;179;1546;79;1546;179;1546
atc;86;;12;;86;
gca;249;;250;;250;
23s;125;2895;122;2895;122;2895
5s;;115;;115;;115
;;;;;;
;;;;;;
5s;122;115;122;115;122;115
23s;250;2895;249;2895;249;2895
gca;12;;86;;86;
atc;79;;179;;179;
16s;;1546;;1546;;1546
;;;;;;
16s;179;1546;;5s;122;115
atc;86;;;23s;249;2895
gca;249;;;gca;86;
23s;122;2895;;atc;179;
5s;89;115;;16s;;1546
5s;;115;;;;

cvi distribution[modifier | modifier le wikicode]

beta1;;;;;;;82;;beta1;;;;;;;22;;beta1;;;;;;;37;;beta1;;;;;;;23
atgi;1;tct;0;tat;0;atgf;2;;atgi;1;tct;;tat;;atgf;2;;atgi;;tct;;tat;;atgf;;;atgi;;tct;;tat;;atgf;
att;0;act;0;aat;0;agt;0;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;0;cct;0;cat;0;cgc;0;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;0;gct;0;gat;0;ggt;0;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;2;tgc;1;;ttc;;tcc;;tac;1;tgc;;;ttc;;tcc;;tac;1;tgc;1;;ttc;2;tcc;2;tac;;tgc;
atc;0;acc;1;aac;4;agc;1;;atc;;acc;1;aac;1;agc;;;atc;;acc;;aac;;agc;1;;atc;;acc;;aac;3;agc;
ctc;1;ccc;1;cac;3;cgt;3;;ctc;1;ccc;1;cac;;cgt;;;ctc;;ccc;;cac;;cgt;3;;ctc;;ccc;;cac;3;cgt;
gtc;1;gcc;3;gac;7;ggc;5;;gtc;1;gcc;1;gac;;ggc;;;gtc;;gcc;2;gac;7;ggc;;;gtc;;gcc;;gac;;ggc;5
tta;1;tca;1;taa;0;tga;0;;tta;1;tca;1;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;
ata;0;aca;1;aaa;3;aga;1;;ata;;aca;1;aaa;;aga;;;ata;;aca;;aaa;3;aga;1;;ata;;aca;;aaa;;aga;
cta;1;cca;1;caa;2;cga;0;;cta;1;cca;;caa;1;cga;;;cta;;cca;1;caa;1;cga;;;cta;;cca;;caa;;cga;
gta;6;gca;0;gaa;4;gga;1;;gta;;gca;;gaa;;gga;;;gta;6;gca;;gaa;4;gga;1;;gta;;gca;;gaa;;gga;
ttg;1;tcg;1;tag;0;tgg;1;;ttg;1;tcg;1;tag;;tgg;1;;ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;
atgj;2;acg;1;aag;2;agg;1;;atgj;;acg;;aag;;agg;1;;atgj;;acg;1;aag;2;agg;;;atgj;2;acg;;aag;;agg;
ctg;4;ccg;2;cag;0;cgg;1;;ctg;;ccg;;cag;;cgg;1;;ctg;;ccg;;cag;;cgg;;;ctg;4;ccg;2;cag;;cgg;
gtg;1;gcg;2;gag;0;ggg;1;;gtg;;gcg;1;gag;;ggg;1;;gtg;1;gcg;1;gag;;ggg;;;gtg;;gcg;;gag;;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;duplicata;1aa;-5s;+5s;-16s;+16s;total
;;;;;;;;;;;*;;;;;;;;*;;;;;;;;;;;;;;;

cvi intercalaires entre cds[modifier | modifier le wikicode]

cvi;4.2.21 Paris;;cvi 25.12.20;;;;;;;;;
cvi;intercalaires;;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>'''frequence5;intercal;<u>'''frequencez
;'''négatif;756;17.7;'''négatif ;-8;11;-1 à -102;'''4 751 080;-1;756;610;2
;'''zéro;15;0.4;;;;;'''intercals;0;15;620;1
;'''1 à 200;2842;66.4;'''0 à 200;74;55;;'''452 650;5;227;630;2
;'''201 à 370;455;10.6;'''201 à 370;266;47;;'''9.5%;10;169;640;1
;'''371 à 600;147;3.4;'''371 à 600;453;59;;;15;168;650;1
;'''601 à max;67;1.6;'''601 à 1309;795;172;;;20;110;660;4
;'''total 4282;<201;84.4;'''total 4281;104;142;-102 à 1309;;25;72;670;4
adresse;intercalx;intercal;<u>'''fréquence1;intercal;<u>'''fréquence6;cumul,t %;intercal;<u>'''fréquence-1;30;66;680;2
1407250;1977;-1;756;-70;6;;0;15;35;68;690;3
2476400;1309;0;15;-60;1;;-1;°118;40;65;700;5
667844;1253;1;°65;-50;4;;-2;3;45;75;710;2
448587;1220;2;47;-40;9;;-3;0;50;67;720;1
357760;1187;3;°52;-30;12;'''min à -1;-4;°397;55;84;730;5
707510;1165;4;36;-20;32;756;-5;0;60;94;740;2
139762;1148;5;27;-10;103;17.7%;-6;2;65;120;750;1
1309853;1098;6;21;0;604;;-7;12;70;126;760;2
2457295;1068;7;°24;10;396;;-8;°56;75;114;770;1
669869;1004;8;18;20;278;;-9;1;80;82;780;1
2288697;984;9;49;30;138;;-10;6;85;62;790;1
1828489;968;10;°57;40;133;'''1 à 100;-11;°35;90;53;800;4
3613803;905;11;44;50;142;1969;-12;1;95;81;810;1
2465473;902;12;32;60;178;46.0%;-13;12;100;66;820;2
2025387;900;13;°39;70;246;;-14;°21;105;60;830;0
869124;888;14;28;80;196;;-15;0;110;57;840;1
2030614;865;15;25;90;115;;-16;4;115;69;850;0
664864;858;16;°33;100;147;;-17;°19;120;48;860;1
2442265;838;17;19;110;117;;-18;0;125;58;870;1
561508;819;18;20;120;117;;-19;5;130;69;880;0
1345805;811;19;°23;130;127;;-20;°13;135;48;890;1
27453;809;20;15;140;92;;-21;1;140;44;900;1
3009727;799;21;°17;150;71;;-22;2;145;41;910;2
914899;796;22;15;160;81;;-23;°5;150;30;920;0
344593;793;23;8;170;72;'''1 à 200;-24;1;155;46;930;0
1783705;791;24;°21;180;63;2842;-25;3;160;35;940;0
1569417;787;25;11;190;67;66.4%;-26;°3;165;41;950;0
3000804;771;26;°15;200;66;;-27;0;170;31;960;0
34255;767;27;10;210;58;;-28;1;175;37;970;1
136535;759;28;°14;220;38;;-29;°3;180;26;980;0
2126902;751;29;15;230;42;;-30;0;185;39;990;1
1360178;742;30;12;240;37;;-31;4;190;28;1000;0
3310655;736;31;°18;250;22;'''0 à 200;-32;2;195;34;1010;1
2140607;733;32;12;260;29;2857;total;75;200;32;1020;0
;;33;°17;270;37;;reste;26;205;32;1030;0
;;34;11;280;31;;total;771;210;26;1040;0
;;35;10;290;28;;;;215;19;1050;0
;;36;12;300;22;;intercal;<u>'''frequencef;220;19;1060;0
;;37;°14;310;21;;600;4215;225;21;1070;1
;;38;10;320;20;;620;3;230;21;1080;0
;;39;13;330;11;;640;3;235;17;1090;0
;;40;°16;340;19;'''201 à 370;660;5;240;20;1100;1
;;reste;2566;350;11;455;680;6;245;11;1110;0
;;total;3857;360;11;10.6%;700;8;250;11;1120;0
;;;;370;18;;720;3;255;9;1130;0
;;;;380;10;;740;7;260;20;1140;0
;;;;390;10;;760;3;265;17;1150;1
'''adresses;'''intercaln;'''décalage;'''long;400;11;;780;2;270;20;1160;0
4014450;-102;comp;;410;11;;800;5;275;15;1170;1
1765439;-97;shift2;1671;420;9;;820;3;280;16;1180;0
1246857;-94;shift2;798;430;12;;840;1;285;17;1190;1
4426186;-80;comp;;440;14;;860;1;290;11;1200;0
3511064;-73;shift2;1;450;9;;880;1;295;14;reste;4
3199809;-71;shift2;494;460;5;;900;2;300;8;total;4282
3580355;-61;comp;;470;6;;920;2;305;14;;
4088183;-59;;;480;6;;940;;310;7;;
2599768;-57;;;490;5;;960;;315;14;;
1062106;-56;;;500;1;;980;1;320;6;;
3542032;-50;;;510;10;;1000;1;325;5;;
834886;-49;;;520;5;;1020;1;330;6;;
2603937;-44;;;530;4;;1040;;335;13;;
2822032;-44;;;540;2;'''371 à 600;1060;;340;6;;
4104968;-44;;;550;4;147;1080;1;345;6;;
283435;-43;;;560;3;3.4%;1100;1;350;5;;
226851;-41;;;570;5;;1120;;355;6;;
387678;-41;;;580;3;'''601 à max;1140;;360;5;;
1796583;-41;;;590;0;67;1160;1;365;10;;
4120154;-40;;;600;2;1.6%;;61;370;8;;
3951302;-38;;;reste;67;;reste;6;reste;214;;
4595659;-38;;;total;4282;;total;4282;total;4282;;

cvi autres intercalaires[modifier | modifier le wikicode]

;cvi;autres intercalaires;;adresses1;;cvi;autres intercalaires;;adresses2;;;cvi;autres intercalaires;;adresses3;
;;;;;;;;;;;;;;;;
deb;°CDS;242272;116;comp;;deb;°CDS;1427387;30;;;deb;°CDS;3471644;212;comp
;regulatory;243048;76;;;;&tRNA;1427771;204;;;;&tRNA;3472822;12;
fin;°CDS;243272;;;;fin;°CDS;1428052;;;;;&tRNA;3472910;26;
deb;°CDS;419401;506;comp;;deb;°CDS;1432303;98;comp;;;&tRNA;3473013;12;
;$rRNA;421224;182;;;;&tRNA;1433244;32;comp;;;&tRNA;3473101;26;
;&tRNA;422942;86;;;;&tRNA;1433352;31;comp;;;&tRNA;3473204;12;
;&tRNA;423105;253;;;;&tRNA;1433459;211;comp;;;&tRNA;3473292;26;
;$rRNA;423434;127;;;fin;°CDS;1433746;;;;;&tRNA;3473395;12;
;$rRNA;426450;137;;;deb;°CDS;1451057;323;comp;;;&tRNA;3473483;27;
fin;°CDS;426702;;comp;;;repeat_region;1452712;105;;;;&tRNA;3473587;6;
deb;°CDS;500524;447;;;fin;°CDS;1454130;;comp;;;&tRNA;3473670;27;
;$rRNA;502189;82;;;deb;°CDS;1458879;179;;;;&tRNA;3473774;6;
;&tRNA;503807;12;;;;repeat_region;1461308;144;;;;&tRNA;3473857;163;
;&tRNA;503896;254;;;fin;°CDS;1462645;;;;fin;°CDS;3474097;;
;$rRNA;504226;124;;;deb;°CDS;1644076;439;;;deb;°CDS;3621600;170;
;$rRNA;507239;280;;;;$rRNA;1646828;182;;;;&tRNA;3622292;55;
fin;°CDS;507634;;;;;&tRNA;1648546;86;;;fin;°CDS;3622421;;
deb;°CDS;521304;119;comp;;;&tRNA;1648709;253;;;deb;°CDS;3727029;40;comp
;regulatory;522458;124;;;;$rRNA;1649038;124;;;;regulatory;3728158;14;comp
fin;°CDS;522848;;;;;$rRNA;1652051;89;;;;regulatory;3728271;172;comp
deb;°CDS;526333;31;;;;$rRNA;1652255;154;;;fin;°CDS;3728534;;comp
;ncRNA;526676;12;;;fin;°CDS;1652524;;comp;;deb;°CDS;3818863;213;comp
fin;°CDS;526872;;;;deb;°CDS;1689363;107;comp;;;$rRNA;3820120;124;comp
deb;°CDS;578634;106;comp;;;regulatory;1690517;42;comp;;;$rRNA;3820359;253;comp
;ncRNA;581905;130;;;fin;°CDS;1690745;;comp;;;&tRNA;3823501;86;comp
fin;°CDS;582495;;;;deb;°CDS;1744930;59;;;;&tRNA;3823663;182;comp
deb;°CDS;680663;177;comp;;;&tRNA;1746117;53;;;;$rRNA;3823922;437;comp
;&tRNA;682034;58;comp;;;&tRNA;1746261;360;;;deb;°CDS;3825895;73;comp
fin;°CDS;682177;;comp;;fin;°CDS;1746712;;;;;&tRNA;3828836;51;
deb;°CDS;758940;152;comp;;deb;°CDS;1786722;25;;;;&tRNA;3828974;33;
;&tRNA;759824;57;;;;&tRNA;1786963;15;;;;&tRNA;3829094;57;
fin;°CDS;759966;;comp;;fin;°CDS;1787071;;;;;&tRNA;3829238;651;
deb;°CDS;877002;858;comp;;deb;°CDS;1899096;223;;;fin;°CDS;3829976;;comp
;&tRNA;878775;19;comp;;;repeat_region;1900978;157;;;deb;°CDS;3854191;770;comp
fin;°CDS;878869;;comp;;fin;°CDS;1902728;;comp;;;&tRNA;3855180;61;comp
deb;°CDS;952811;49;;;deb;°CDS;1975805;93;;;;&tRNA;3855317;78;comp
;&tRNA;955155;329;;;;&tRNA;1978844;66;;;;&tRNA;3855472;97;comp
fin;°CDS;955560;;;;fin;°CDS;1978986;;comp;;fin;°CDS;3855646;;
deb;°CDS;975236;19;;;deb;°CDS;2093021;230;;;deb;°CDS;4058859;201;comp
;&tRNA;975612;91;;;;&tRNA;2094372;26;;;;&tRNA;4059834;92;comp
fin;°CDS;975788;;;;;&tRNA;2094474;45;;;fin;°CDS;4060005;;comp
deb;°CDS;996781;89;comp;;;&tRNA;2094595;27;;;deb;°CDS;4244169;101;
;regulatory;998457;72;;;;&tRNA;2094698;18;;;;$rRNA;4244591;124;comp
fin;°CDS;998621;;;;;&tRNA;2094793;225;;;;$rRNA;4244830;253;comp
deb;°CDS;1006022;155;;;fin;°CDS;2095095;;comp;;;&tRNA;4247972;86;comp
;&tRNA;1006822;6;;;deb;°CDS;2186305;69;;;;&tRNA;4248134;182;comp
;&tRNA;1006904;51;;;;tmRNA;2186992;205;;;;$rRNA;4248393;450;comp
fin;°CDS;1007031;;;;fin;°CDS;2187562;;;;fin;°CDS;4250379;;
deb;°CDS;1057229;62;;;deb;°CDS;2192639;145;comp;;deb;°CDS;4324029;747;comp
;&tRNA;1058518;6;;;;regulatory;2193399;4;comp;;;&tRNA;4325718;151;comp
;&tRNA;1058618;3;;;;regulatory;2193502;65;comp;;fin;°CDS;4325946;;comp
;&tRNA;1058698;110;;;fin;°CDS;2193653;;comp;;deb;°CDS;4388195;89;comp
deb;°CDS;1058883;173;comp;;deb;°CDS;2337863;-1;;;;&tRNA;4389268;6;comp
;&tRNA;1061741;3;comp;;;ncRNA;2338135;0;;;fin;°CDS;4389349;;comp
;&tRNA;1061819;7;comp;;fin;°CDS;2338210;;;;deb;°CDS;4401196;137;comp
;&tRNA;1061903;5;comp;;deb;°CDS;2511015;130;comp;;;&tRNA;4402077;265;
;&tRNA;1061983;46;comp;;;&tRNA;2511625;46;comp;;fin;°CDS;4402419;;comp
fin;°CDS;1062106;;;;fin;°CDS;2511759;;comp;;deb;°CDS;4433423;206;
deb;°CDS;1153105;370;;;deb;°CDS;2560167;264;comp;;;$rRNA;4434130;124;comp
;$rRNA;1154027;182;;;;ncRNA;2560755;168;comp;;;$rRNA;4434369;253;comp
;&tRNA;1155745;86;;;fin;°CDS;2561022;;;;;&tRNA;4437511;86;comp
;&tRNA;1155908;254;;;deb;°CDS;2745389;71;comp;;;&tRNA;4437673;182;comp
;$rRNA;1156238;124;;;;&tRNA;2747299;7;comp;;;$rRNA;4437932;391;comp
;$rRNA;1159251;189;;;;&tRNA;2747383;48;comp;;fin;°CDS;4439859;;
fin;°CDS;1159555;;;;fin;°CDS;2747507;;comp;;deb;°CDS;4472951;87;
deb;°CDS;1262223;190;;;deb;°CDS;2852349;182;comp;;;&tRNA;4474196;35;
;&tRNA;1263556;120;comp;;;&tRNA;2853221;70;;;;&tRNA;4474308;125;
fin;°CDS;1263766;;comp;;fin;°CDS;2853376;;comp;;fin;°CDS;4474510;;
deb;°CDS;1272648;435;;;deb;°CDS;3186574;49;comp;;deb;°CDS;4529035;86;comp
;&tRNA;1273710;180;;;;&tRNA;3187082;411;;;;&tRNA;4529616;179;comp
fin;°CDS;1273967;;comp;;fin;°CDS;3187569;;;;fin;°CDS;4529870;;comp
deb;°CDS;1292860;191;;;deb;°CDS;3256344;205;comp;;deb;°CDS;4531632;64;comp
;repeat_region;1293342;324;;;;&tRNA;3257362;151;;;;&tRNA;4532053;10;comp
fin;°CDS;1295441;;;;fin;°CDS;3257589;;comp;;deb;°CDS;4532139;40;comp
deb;°CDS;1376752;101;;;deb;°CDS;3261178;303;comp;;;&tRNA;4533370;24;comp
;&tRNA;1377435;23;;;;&tRNA;3262246;8;;;;&tRNA;4533469;52;comp
;&tRNA;1377534;22;;;;&tRNA;3262330;11;;;;&tRNA;4533595;139;comp
;&tRNA;1377632;24;;;;&tRNA;3262417;106;;;fin;°CDS;4533819;;comp
;&tRNA;1377732;29;;;fin;°CDS;3262599;;comp;;deb;°CDS;4549877;87;comp
;&tRNA;1377837;45;;;deb;°CDS;3368966;415;comp;;;regulatory;4551002;131;
;&tRNA;1377958;425;;;;$rRNA;3371478;124;comp;;fin;°CDS;4551282;;
fin;°CDS;1378457;;comp;;;$rRNA;3371717;254;comp;;deb;°CDS;4586188;194;comp
deb;°CDS;1385508;707;comp;;;&tRNA;3374860;12;comp;;;&tRNA;4586712;38;comp
;&tRNA;1387010;183;;;;&tRNA;3374948;82;comp;;;&tRNA;4586826;35;comp
fin;°CDS;1387278;;;;;$rRNA;3375107;439;comp;;;&tRNA;4586937;28;comp
deb;°CDS;1418833;136;comp;;fin;°CDS;3377082;;comp;;;&tRNA;4587041;37;comp
;&tRNA;1420085;182;;;deb;°CDS;3447322;50;comp;;;&tRNA;4587154;130;comp
fin;°CDS;1420344;;;;;regulatory;3448389;124;comp;;fin;°CDS;4587360;;comp
;;;;;;fin;°CDS;3448608;;;;;;;;

cvi intercalaires tRNA[modifier | modifier le wikicode]

cvi intercalaires tRNA ;;;;;;;;;;
comp’;aa;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;;;;;;
;;;177;;58;;19;6;deb;
;;comp’;152;comp’;57;;25;10;<201;22
;;;858;;19;;30;15;total;27
;;;49;;329;;40;19;taux;81%
;;;19;;91;;49;46;;
;6;;155;;51;;59;48;fin;
;6  3;;62;comp’;110;;62;51;<201;20
;3 7 5;;173;comp’;46;;64;55;total;25
;;comp’;190;;120;;71;58;taux;80%
;;;435;comp’;180;;86;91;;
;;;191;;324;;87;92;total;
;23 22 24 29 45;;101;comp’;425;;89;120;<201;42
;;comp’;707;;183;;93;125;total;52
;;comp’;136;;182;;98;130;taux;81%
;;;30;;204;;101;139;;
;32 31;;98;comp’;211;;130;151;;
;53;;59;;360;;155;163;;
;;;25;;15;;170;179;;
;;;93;comp’;66;;173;182;;
;26 45 27 18;;230;comp’;225;;177;183;;
;;;130;;46;;191;204;;
;7;;71;;48;;194;324;;
;;comp’;182;comp’;70;;201;329;;
;;comp’;49;;411;;230;360;;
;;comp’;205;comp’;151;;435;411;;
;8  11;comp’;303;comp’;106;;747;;;
;12 26 12 26 12 26;comp’;212;;163;;858;;comp’;cumuls
;12 27 6 27 6;;;;;;49;46;deb;
;;;170;;55;;73;57;<201;7
;51 33 57;comp’;73;comp’;651;;136;66;total;12
;61 78;;770;comp’;97;;137;70;taux;58%
;;;201;;92;;152;97;;
;;;747;;151;;182;106;fin;
;;;89;;6;;190;110;<201;9
;;comp’;137;comp’;265;;205;151;total;14
;35;;87;;125;;212;180;taux;64%
;;;86;;179;;303;211;;
;;;64;;10;;707;225;total;
;24 52;;40;;139;;770;265;<201;16
;38 35 28 37;;194;;130;;-;425;total;26
;;;;;;;-;651;taux;62%
;;;;;;;;;;
continu + comp’;;;;;;;;;;
;deb;fin;total;;;;;;;
<201;29;29;58;;;;;;;
total;39;39;78;;;;;;;
taux;74%;74%;74%;;;;;;;

cvi par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;cvi;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;9;7;2;;;;18;
16;moyen;7;3;11;;;16;37;
14;fort;6;27;10;;;;43;
; ;22;37;23;;;16;98;
10;g+cga;3;5;2;;;;10;
2;agg+cgg;2;;;;;;2;
4;carre ccc;4;2;;;;;6;
5;autres;;;;;;;0;
;;9;7;2;;;;18;
;total tRNAs  ‰ ;;;;;;;;
;cvi;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;92;71;20;;;;184;26
16;moyen;71;31;112;;;163;378;324
14;fort;61;276;102;;;;439;650
; ;224;378;235;;;163;98;729
10;g+cgg;31;51;20;;;;102;10
2;agg+cga;20;;;;;;20;
4;carre ccc;41;20;;;;;61;16
5;autres;;;;;;;0;
;;92;71;20;;;;184;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;cvi;1aa;>1aa;dup;;ref. ‰;1aa;>1aa;dup
21;faible;110;85;24;220;26;41;19;9
16;moyen;85;37;134;256;324;32;8;48
14;fort;73;329;122;524;650;27;73;43
; ;268;451;280;82;729;22;37;23
10;g+cgg;37;61;24;122;10;;;
2;agg+cga;24;;;24;;;;
4;carre ccc;49;24;;73;16;;;
5;autres;;;;;;;;
;;110;85;24;220;;;;

beta, estimation des -rRNAs[modifier | modifier le wikicode]

44 génomes total avec rRNA;;;;beta;total;ttt;tgt;;100 génomes total avec rRNA;;;;beta;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;44;351; ; ;;indices;;;;44;798;0;0;;beta1;effectifs;;1aa+>1aa+dup;;;;82
atgi;;tct;;tat;;atgf;2;;atgi;;tct;;tat;;atgf;5;;atgi;1;tct;;tat;;atgf;2
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;10;tgc;;;ttc;;tcc;;tac;23;tgc;;;ttc;2;tcc;2;tac;2;tgc;1
atc;159;acc;10;aac;;agc;1;;atc;361;acc;23;aac;;agc;2;;atc;;acc;1;aac;4;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;1;cac;3;cgt;3
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;;;gtc;1;gcc;3;gac;7;ggc;5
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;3;aga;1
cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;2;cga;
gta;;gca;159;gaa;;gga;10;;gta;;gca;361;gaa;;gga;23;;gta;6;gca;;gaa;4;gga;1
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;1;tcg;1;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;2;acg;1;aag;2;agg;1
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;4;ccg;2;cag;;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;1;gcg;2;gag;;ggg;1
;;329;;22;;0;351;;;;748;;50;;0;798;;;;21;;43;;18;82
11.1.21 Paris;;;;beta;total;ttt;tgt;;11.1.21 Paris;;;;beta;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;268;15707;5.2;0;;indices;;;;268;15707;5.2;0;;beta1;indices;;1aa+>1aa+dup;;;;
atgi;99;tct;0.4;tat;;atgf;172;;atgi;99;tct;0.4;tat;;atgf;177;;atgi;100;tct;;tat;;atgf;200
att;1.1;act;0.7;aat;0.4;agt;0.4;;att;1.1;act;0.7;aat;0.4;agt;0.4;;att;;act;;aat;;agt;
ctt;2.2;cct;;cat;;cgc;0.7;;ctt;2.2;cct;;cat;;cgc;0.7;;ctt;;cct;;cat;;cgc;
gtt;0.7;gct;;gat;;ggt;;;gtt;0.7;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;108;tcc;101;tac;84;tgc;142;;ttc;108;tcc;101;tac;107;tgc;142;;ttc;200;tcc;200;tac;200;tgc;100
atc;6;acc;79;aac;184;agc;99;;atc;367;acc;102;aac;184;agc;101;;atc;;acc;100;aac;400;agc;100
ctc;143;ccc;100;cac;109;cgt;187;;ctc;143;ccc;100;cac;109;cgt;187;;ctc;100;ccc;100;cac;300;cgt;300
gtc;150;gcc;124;gac;246;ggc;224;;gtc;150;gcc;124;gac;246;ggc;224;;gtc;100;gcc;300;gac;700;ggc;500
tta;55;tca;99;taa;;tga;60;;tta;55;tca;99;taa;;tga;60;;tta;100;tca;100;taa;;tga;
ata;0.4;aca;114;aaa;121;aga;114;;ata;0.4;aca;114;aaa;121;aga;114;;ata;;aca;100;aaa;300;aga;100
cta;101;cca;137;caa;123;cga;0;;cta;101;cca;137;caa;123;cga;;;cta;100;cca;100;caa;200;cga;
gta;118;gca;12;gaa;202;gga;78;;gta;118;gca;373;gaa;202;gga;101;;gta;600;gca;;gaa;400;gga;100
ttg;102;tcg;111;tag;2.6;tgg;102;;ttg;102;tcg;111;tag;3;tgg;102;;ttg;100;tcg;100;tag;;tgg;100
atgj;107;acg;96;aag;103;agg;99;;atgj;107;acg;96;aag;103;agg;99;;atgj;200;acg;100;aag;200;agg;100
ctg;191;ccg;92;cag;0.7;cgg;107;;ctg;191;ccg;92;cag;0.7;cgg;107;;ctg;400;ccg;200;cag;;cgg;100
gtg;90;gcg;79;gag;0.4;ggg;82;;gtg;90;gcg;79;gag;0.4;ggg;82;;gtg;100;gcg;200;gag;;ggg;100
;;1517;;2099;;1440;5057;;;;2265;;2149;;1440;5854;;;;2100;;4300;;1800;8200
rapports;;67;;98;;100;86;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;beta1;indices;;1aa+>1aa+dup;;différence;;
atgi;100;tct;;tat;;atgf;97;;fiches;54.068;;;fréquences;;;;;atgi;1;tct;100;tat;;atgf;14
att;;act;100;aat;;agt;;;total des aas sans rRNA;2379;;;0/0;1;;;;att;100;act;100;aat;100;agt;100
ctt;100;cct;;cat;;cgc;;;avec;353;;;10;12;;;;ctt;100;cct;;cat;;cgc;100
gtt;;gct;;gat;;ggt;;;genom;44;;;20;4;;;;gtt;100;gct;;gat;;ggt;
ttc;100;tcc;100;tac;79;tgc;100;;;;;;30;4;;;;ttc;46;tcc;50;tac;58;tgc;30
atc;2;acc;78;aac;100;agc;98;;beta1;82;;;40;4;;;;atc;100;acc;21;aac;54;agc;1
ctc;100;ccc;100;cac;100;cgt;100;;sans;82;;;50;6;30;;;ctc;30;ccc;0;cac;64;cgt;38
gtc;100;gcc;100;gac;100;ggc;100;;avec;16;;;60;7;;;;gtc;33;gcc;59;gac;65;ggc;55
tta;100;tca;100;taa;;tga;100;;genom;1;;;70;3;;;;tta;45;tca;1;taa;;tga;100
ata;100;aca;100;aaa;100;aga;100;;;;;;80;0;;;;ata;100;aca;12;aaa;60;aga;12
cta;100;cca;100;caa;100;cga;;;L’estimation par beta ;;;;90;1;;;;cta;1;cca;27;caa;39;cga;
gta;100;gca;3;gaa;100;gga;77;;est  52% en dessous;;;;100;6;;;;gta;80;gca;100;gaa;50;gga;22
ttg;100;tcg;100;tag;;tgg;100;;des aas sans;;;;;0;;;;ttg;2;tcg;10;tag;;tgg;2
atgj;100;acg;100;aag;100;agg;100;;;;;;;48;;;;atgj;47;acg;4;aag;49;agg;1
ctg;100;ccg;100;cag;100;cgg;100;;;;;;;;;;;ctg;52;ccg;54;cag;100;cgg;7
gtg;100;gcg;100;gag;100;ggg;100;;;;;;;;;;;gtg;10;gcg;61;gag;100;ggg;18
;;;;;;;;;;;;;;;;;;;;328;;618;;335;1281

cvi remarques[modifier | modifier le wikicode]

cvi;;;;;98;;99
atgi;1;tct;;tat;;atgf;3
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;2;tgc;1
atc;8;acc;2;aac;4;agc;1
ctc;1;ccc;1;cac;3;cgt;3
gtc;1;gcc;3;gac;7;ggc;5
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;3;aga;1
cta;1;cca;1;caa;2;cga;
gta;5;gca;8;gaa;4;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;2;acg;1;aag;2;agg;1
ctg;4;ccg;2;cag;;cgg;1
gtg;2;gcg;1;gag;;ggg;1

ade[modifier | modifier le wikicode]

ade opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Anae_deha_2CP_C/anaeDeha_2CP_C-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_011891.1;ade;genome;;;
75%GC;30.6.19 Paris;16s  2;49;doubles;intercalaires
;Anaeromyxobacter dehalogenans 2CP-C;;;;
;8147..8220;;caa;;
;;;;;
;21040..21112;;ttc;;
;;;;;
comp;433303..433378;;ggg;;
;;;;;
comp;666509..666585;;gac;;6
comp;666592..666666;;gta;;
;;;;;
comp;693146..693229;;ctg;;
;;;;;
;851483..851555;;atg;;
;;;;;
comp;1057311..1057386;;gcg;;
;;;;;
comp;1306222..1306295;;ccc;;
;;;;;
;1442379..1442450;;tgc;;
;;;;;
;1495545..1497102;;16s;@1;187
;1497290..1497367;;atc;;22
;1497390..1497465;;gca;;194
;1497660..1500648;;23s;;152
;1500801..1500917;;5s;;
;;;;;
;1509186..1509259;;cag;;60
;1509320..1509394;;gag;;
;;;;;
;1691085..1691160;;gcc;;
;;;;;
;819377..1819453;;atg;;
;;;;;
;2235670..2235741;;gtc;;
;;;;;
comp;2314981..2315079;;tga;;
;;;;;
comp;2337031..2337104;;atg;;
;;;;;
;2376009..2376080;;gtg;;
;;;;;
comp;2429718..2429790;;acg;;
;;;;;
comp;2623942..2624017;;tgg;;
;;;;;
comp;2625463..2625535;;acc;;22
comp;2625558..2625633;;gga;;63
comp;2625697..2625779;;tac;;46
comp;2625826..2625898;;aca;;
;;;;;
;2653452..2653535;;ttg;;
;;;;;
;2680790..2680871;;ctc;;
;;;;;
comp;2747806..2747879;;agg;;
;;;;;
;3029047..3029122;;aac;;
;;;;;
comp;3076236..3076352;;5s;;152
comp;3076505..3079493;;23s;;194
comp;3079688..3079763;;gca;;22
comp;3079786..3079863;;atc;;187
comp;3080051..3081608;;16s;;
;;;;;
comp;3144286..3144357;;aaa;;
;;;;;
;3156732..3156804;;gaa;;
;;;;;
;3253990..3254063;;cgg;;
;;;;;
comp;3793996..3794069;;ccg;;
;;;;;
;3806164..3806249;;tta;;
;;;;;
comp;3915708..3915789;;cta;;
;;;;;
comp;3920245..3920317;;aag;@2;*248
comp;3920566..3920639;;aga;;*140
comp;3920780..3920854;;cac;;18
comp;3920873..3920946;;cga;;*134
comp;3921081..3921154;;cca;;
;;;;;
comp;4121675..4121749;;ggc;;
;;;;;
comp;4195371..4195460;;tcc;;*278
comp;4195739..4195829;;tcg;;
;;;;;
;4456675..4456764;;tca;;27
;4456792..4456883;;agc;;73
;4456957..4457033;;cgt;;

ade cumuls[modifier | modifier le wikicode]

cvi cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;2;1;0;
;16 23 5s 0;0;20;2;
;16 atc gca;2;40;2;2
;16 23 5s a;0;60;2;
;max a;2;80;2;
;a doubles;0;100;0;
;spéciaux;0;120;0;
;total aas;4;140;2;
sans ;opérons;33;160;0;
;1 aa;27;180;0;
;max a;5;200;0;
;a doubles;0;;2;
;total aas;45;;12;2
total aas;;49;;;
remarques;;2;;;
avec jaune;;;moyenne;93;
;;;variance;90;
sans jaune;;;moyenne;39;22
;;;variance;24;0

ade blocs[modifier | modifier le wikicode]

ade blocs;;;;;
16s;187;1558;5s;152;117
atc;22;;23s;194;2989
gca;194;;gca;22;
23s;152;2989;atc;187;
5s;;117;16s;;1558

ade distribution[modifier | modifier le wikicode]

delta1;;;;;;;49;;delta1;;;;;;;27;;delta1;;;;;;;18
atgi;1;tct;;tat;;atgf;1;;atgi;1;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;;tac;;tgc;1;;ttc;;tcc;1;tac;1;tgc;
atc;2;acc;1;aac;1;agc;1;;atc;;acc;;aac;1;agc;;;atc;;acc;1;aac;;agc;1
ctc;1;ccc;1;cac;1;cgt;1;;ctc;1;ccc;1;cac;;cgt;;;ctc;;ccc;;cac;1;cgt;1
gtc;1;gcc;1;gac;1;ggc;1;;gtc;1;gcc;1;gac;;ggc;1;;gtc;;gcc;;gac;1;ggc;
tta;1;tca;1;taa;;tga;1;;tta;1;tca;;taa;;tga;1;;tta;;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1;;ata;;aca;;aaa;1;aga;;;ata;;aca;1;aaa;;aga;1
cta;1;cca;1;caa;1;cga;1;;cta;1;cca;;caa;1;cga;;;cta;;cca;1;caa;;cga;1
gta;1;gca;2;gaa;1;gga;1;;gta;;gca;;gaa;1;gga;;;gta;1;gca;;gaa;;gga;1
ttg;1;tcg;1;tag;;tgg;1;;ttg;1;tcg;;tag;;tgg;1;;ttg;;tcg;1;tag;;tgg;
atgj;1;acg;1;aag;1;agg;1;;atgj;1;acg;1;aag;;agg;1;;atgj;;acg;;aag;1;agg;
ctg;1;ccg;1;cag;1;cgg;1;;ctg;1;ccg;1;cag;;cgg;1;;ctg;;ccg;;cag;1;cgg;
gtg;1;gcg;1;gag;1;ggg;1;;gtg;1;gcg;1;gag;;ggg;1;;gtg;;gcg;;gag;1;ggg;
total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total;;total;>1aa;1aa;-5s;+5s;-16s;+16s;total
;18;27;;;;4;49;;;;*;;;;;;;;*;;;;;;

ade intercalaires entre cds[modifier | modifier le wikicode]

ade;4.2.21 Paris;;ade 16.7.20;;;;;;;;;
ade;intercalaires;;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>'''frequence5;intercal;<u>'''frequencez
;'''négatif;815;18.3;'''négatif ;-8;15;-1 à -116;'''5 029 329;-1;815;610;5
;'''zéro;29;0.6;;;;;'''intercals;0;29;620;3
;'''1 à 200;2987;66.9;'''0 à 200;70;57;;'''42 8947;5;251;630;2
;'''201 à 370;464;10.4;'''201 à 370;260;44;;'''8.5%;10;224;640;0
;'''371 à 600;124;2.8;'''371 à 600;469;63;;;15;214;650;3
;'''601 à max;45;1.0;'''601 à 1160;771;157;;;20;141;660;1
;'''total 4464;<201;85.8;'''total 4461;93;127;-116 à 1160;;25;104;670;0
adresse;intercal;intercal;<u>'''frequence1;intercal;<u>'''fréquence6;cumul, %;intercal;<u>'''fréquence-1;30;89;680;1
4491815;1915;-1;815;-70;14;;0;29;35;91;690;1
3576176;1774;0;29;-60;8;;-1;°70;40;66;700;1
4068576;1388;1;45;-50;2;;-2;3;45;58;710;1
3337295;1160;2;68;-40;7;;-3;0;50;57;720;2
3373664;1119;3;°73;-30;12;'''min à -1;-4;°570;55;74;730;1
2044486;1080;4;39;-20;26;815;-5;0;60;82;740;2
4163005;1080;5;26;-10;69;18.3%;-6;2;65;92;750;2
1981544;1014;6;°34;0;706;;-7;7;70;86;760;0
427780;984;7;35;10;475;;-8;°25;75;87;770;0
540538;963;8;45;20;355;;-9;0;80;78;780;0
1223737;917;9;°65;30;193;;-10;3;85;70;790;1
1005799;900;10;45;40;157;'''1 à 100;-11;°21;90;77;800;1
4943119;860;11;36;50;115;2068;-12;1;95;66;810;1
4581242;849;12;°54;60;156;46.3%;-13;10;100;61;820;1
104609;834;13;49;70;178;;-14;°16;105;69;830;1
4846209;821;14;35;80;165;;-15;1;110;55;840;1
1084460;817;15;°40;90;147;;-16;4;115;65;850;1
2814006;807;16;36;100;127;;-17;°11;120;63;860;1
2386981;793;17;23;110;124;;-18;0;125;60;870;0
3422997;788;18;°35;120;128;;-19;2;130;56;880;0
494107;749;19;29;130;116;;-20;°4;135;64;890;0
3820597;741;20;18;140;109;;-21;0;140;45;900;1
4073584;732;21;19;150;90;;-22;2;145;50;910;0
1445527;731;22;°25;160;67;;-23;°8;150;40;920;1
3757399;730;23;24;170;75;'''1 à 200;-24;0;155;36;930;0
4117240;719;24;18;180;74;2987;-25;1;160;31;940;0
3533685;715;25;18;190;81;67%;-26;°6;165;34;950;0
3631148;704;26;°22;200;55;;-27;0;170;41;960;0
2060112;697;27;16;210;57;;-28;1;175;36;970;1
1026522;689;28;°27;220;48;;-29;°4;180;38;980;0
4180297;676;29;9;230;45;;-30;0;185;40;990;1
3200409;660;30;15;240;34;;-31;0;190;41;1000;0
1266186;649;31;15;250;39;;-32;°3;195;29;1010;0
4553826;643;32;15;260;47;;total;66;200;26;1020;1
4101937;641;33;22;270;30;'''0 à 200;reste;40;205;27;1030;0
;;34;°26;280;27;3016;;844;210;30;1040;0
;;35;13;290;20;;;;215;26;1050;0
;;36;13;300;20;;intercal;<u>'''frequencef;220;22;1060;0
;;37;17;310;21;;600;4419;225;28;1070;0
;;38;9;320;18;;620;8;230;17;1080;2
;;39;8;330;15;;640;2;235;13;1090;0
;;40;°19;340;11;'''201 à 370;660;4;240;21;1100;0
;;reste;2440;350;9;464;680;1;245;18;1110;0
;;total;4044;360;17;10.4%;700;2;250;21;1120;1
;;;;370;6;;720;3;255;23;1130;0
adresse;intercaln;décalage;long;380;9;;740;3;260;24;1140;0
3295433;-116;comp;;390;5;;760;2;265;17;1150;0
4579158;-110;comp;;400;6;;780;;270;13;1160;1
1556750;-109;shift2;738;410;10;;800;2;275;16;1170;0
4555636;-109;comp;;420;4;;820;2;280;11;1180;0
4916430;-107;comp;;430;2;;840;2;285;13;1190;0
3210093;-106;shift2;1146;440;11;;860;2;290;7;1200;0
3997874;-104;comp;;450;5;;880;;295;10;reste;3
2946107;-101;comp;;460;8;;900;1;300;10;total;4464
3213081;-100;shift2;279;470;8;;920;1;305;10;;
1033174;-98;comp;;480;6;;940;;310;11;;
4178347;-86;comp;;490;4;;960;;315;13;;
1150010;-82;comp;;500;4;;980;1;320;5;;
526736;-79;comp;;510;8;;1000;1;325;9;;
1558055;-74;comp;;520;4;;1020;1;330;6;;
178866;-68;shift2;797;530;4;;1040;;335;6;;
4625265;-68;shift2;869;540;7;'''371 à 600;1060;;340;5;;
1268795;-67;;;550;3;124;1080;2;345;6;;
1590849;-67;;;560;6;2.8%;1100;;350;3;;
1222168;-65;;;570;3;;1120;1;355;11;;
3832496;-65;;;580;1;'''601 à max;1140;;360;6;;
23880;-61;;;590;3;45;1160;1;365;5;;
157893;-61;;;600;3;1.0%;;42;370;1;;
4881610;-59;;;reste;45;;reste;3;;169;;
3182922;-55;;;total;4464;;total;4464;;4464;;

ade autres intercalaires[modifier | modifier le wikicode]

deb;°CDS;7060;91;;;deb;°CDS;1818424;110;;;deb;°CDS;3143759;230;comp
;&tRNA;8147;44;;;;&tRNA;1819377;53;;;;&tRNA;3144286;306;comp
fin;°CDS;8265;;;;fin;°CDS;1819507;;;;fin;°CDS;3144664;;comp
deb;°CDS;20441;158;;;deb;°CDS;1968293;141;;;deb;°CDS;3155946;78;
;&tRNA;21040;220;;;;regulatory;1969289;108;;;;&tRNA;3156732;694;
fin;°CDS;21333;;comp;;fin;°CDS;1969480;;;;fin;°CDS;3157499;;
deb;°CDS;432722;119;comp;;deb;°CDS;2235017;38;;;deb;°CDS;3253083;193;comp
;&tRNA;433303;79;comp;;;&tRNA;2235670;77;;;;&tRNA;3253990;130;
fin;°CDS;433458;;comp;;fin;°CDS;2235819;;;;fin;°CDS;3254194;;
deb;°CDS;664814;456;comp;;deb;°CDS;2313926;38;;;deb;°CDS;3372825;107;
;&tRNA;666509;6;comp;;;&tRNA;2314981;92;comp;;;tmRNA;3373094;219;
;&tRNA;666592;157;comp;;fin;°CDS;2315172;;comp;;fin;°CDS;3373664;;
fin;°CDS;666824;;;;deb;°CDS;2335260;406;comp;;deb;°CDS;3793550;226;
deb;°CDS;691951;157;comp;;;&tRNA;2337031;222;comp;;;&tRNA;3793996;386;comp
;&tRNA;693146;333;comp;;fin;°CDS;2337327;;;;fin;°CDS;3794456;;comp
fin;°CDS;693563;;;;deb;°CDS;2375620;53;;;deb;°CDS;3805030;111;
deb;°CDS;849021;53;;;;&tRNA;2376009;437;;;;&tRNA;3806164;127;
;&tRNA;851483;36;;;fin;°CDS;2376518;;;;fin;°CDS;3806377;;comp
fin;°CDS;851592;;;;deb;°CDS;2429105;190;;;deb;°CDS;3914337;81;comp
deb;°CDS;883315;64;;;;&tRNA;2429718;111;comp;;;&tRNA;3915708;63;comp
;repeat_region;883709;98;;;fin;°CDS;2429902;;;;fin;°CDS;3915853;;
fin;°CDS;886703;;comp;;deb;°CDS;2623487;62;comp;;deb;°CDS;3919322;179;comp
deb;°CDS;887392;77;comp;;;&tRNA;2623942;15;comp;;;&tRNA;3920245;248;comp
;repeat_region;888746;95;;;fin;°CDS;2624033;;comp;;;&tRNA;3920566;142;comp
fin;°CDS;892587;;;;deb;°CDS;2624207;65;comp;;;&tRNA;3920782;18;comp
deb;°CDS;1055941;68;;;;&tRNA;2625463;22;comp;;;&tRNA;3920873;134;comp
;&tRNA;1057311;105;comp;;;&tRNA;2625558;63;comp;;;&tRNA;3921081;76;comp
fin;°CDS;1057492;;;;;&tRNA;2625697;46;comp;;fin;°CDS;3921231;;comp
deb;°CDS;1305647;350;comp;;;&tRNA;2625826;105;comp;;deb;°CDS;4031625;149;
;&tRNA;1306222;105;comp;;fin;°CDS;2626004;;comp;;;regulatory;4032113;67;
fin;°CDS;1306401;;comp;;deb;°CDS;2652965;124;comp;;fin;°CDS;4032337;;
deb;°CDS;1311419;33;comp;;;&tRNA;2653452;100;;;deb;°CDS;4120462;34;
;ncRNA;1312049;302;comp;;fin;°CDS;2653636;;;;;&tRNA;4121675;246;comp
fin;°CDS;1312542;;;;deb;°CDS;2680375;91;;;fin;°CDS;4121996;;
deb;°CDS;1441648;14;;;;&tRNA;2680790;110;;;deb;°CDS;4164508;430;
;&tRNA;1442379;111;;;fin;°CDS;2680982;;comp;;;ncRNA;4166687;43;comp
fin;°CDS;1442562;;;;deb;°CDS;2747439;94;;;fin;°CDS;4167140;;comp
deb;°CDS;1492304;691;;;;&tRNA;2747806;106;comp;;deb;°CDS;4193348;55;comp
;$rRNA;1495545;187;;;fin;°CDS;2747986;;comp;;;ncRNA;4195209;68;comp
;&tRNA;1497290;22;;;deb;°CDS;3027884;161;comp;;;&tRNA;4195371;278;comp
;&tRNA;1497390;194;;;;&tRNA;3029047;184;;;;&tRNA;4195739;50;comp
;$rRNA;1497660;152;;;fin;°CDS;3029307;;;;fin;°CDS;4195880;;comp
;$rRNA;1500801;75;;;deb;°CDS;3075187;167;comp;;deb;°CDS;4454313;715;comp
fin;°CDS;1500993;;comp;;;$rRNA;3076236;152;comp;;;&tRNA;4456675;27;
deb;°CDS;1508769;3;;;;$rRNA;3076505;194;comp;;;&tRNA;4456792;73;
;&tRNA;1509186;60;;;;&tRNA;3079688;22;comp;;;&tRNA;4456957;492;
;&tRNA;1509320;130;;;;&tRNA;3079786;187;comp;;fin;°CDS;4457526;;
fin;°CDS;1509525;;comp;;;$rRNA;3080051;590;comp;;;;;;
deb;°CDS;1690794;9;;;fin;°CDS;3082199;;comp;;;;;;
;&tRNA;1691085;96;;;;;;;;;;;;;
fin;°CDS;1691254;;comp;;;;;;;;;;;;

ade intercalaires tRNA[modifier | modifier le wikicode]

ade intercalaires tRNA;;;;;;;;;;
comp’;aa;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;;;;;;
;;;91;;44;;3;15;deb;
;;;158;comp’;220;;9;36;<201;20
;;;119;;79;;14;43;total;25
;6;;456;comp’;156;;38;44;taux;80%
;;;157;comp’;353;;38;50;;
;;;53;;36;;53;53;fin;
;;comp’;68;comp’;105;;53;76;<201;16
;;;350;;105;;62;77;total;22
;;;14;;111;;65;79;taux;73%
;60;;3;comp’;130;;78;100;;
;;;9;comp’;96;;81;105;total;
;;;110;;53;;91;105;<201;36
;;;38;;77;;91;106;total;47
;;;38;comp’;92;;107;111;taux;77%
;;;406;comp’;222;;110;130;;
;;;53;;437;;111;184;;
;;comp’;190;comp’;111;;119;219;;
;;;62;;15;;157;306;;
;22 63 46;;65;;105;;158;386;;
;;comp’;124;;100;;179;437;;
;;;91;comp’;110;;230;492;;
;;comp’;94;;106;;350;694;;
;;comp’;161;;184;;406;-;;
;;;230;;306;;430;-;;
;;;78;;694;;456;-;comp’;cumuls
;;comp’;193;;130;;34;63;deb;
;;;107;;219;;68;92;<201;7
;;comp’;226;;386;;94;96;total;9
;;;111;comp’;127;;124;105;taux;78%
;;;81;comp’;63;;161;110;fin;
;248 142 18 134;;179;;76;;190;111;<201;9
;;comp’;34;comp’;246;;193;127;total;13
;;;430;;43;;226;130;taux;69%
;278;;;;50;;715;156;;
;27 73;comp’;715;;492;;-;220;total;
;;;;;;;-;222;<201;16
;;;;;;;-;246;total;22
;;;;;;;-;353;taux;73%
;;;;;;;;;;
;;;;;;;;;;
;deb;fin;total;;;;;;;
<201;29;25;54;;;;;;;
total;34;35;69;;;;;;;
taux;85%;71%;78%;;;;;;;

ade par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;ade;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;12;5;;;;;17;
16;moyen;9;6;;;;4;19;
14;fort;6;7;;;;;13;
; ;27;18;;;;4;49;
10;g+cga;5;5;;;;;10;
2;agg+cgg;2;;;;;;2;
4;carre ccc;4;;;;;;4;
5;autres;1;;;;;;1;
;;12;5;;;;;17;
;total tRNAs  ‰ ;;;;;;;;
;;1aa;>1aa;dup;+5s;1-3aas;autres;total;ref. ‰
21;faible;245;102;;;;;347;26
16;moyen;184;122;;;;82;388;324
14;fort;122;143;;;;;265;650
; ;551;367;;;;82;49;729
10;g+cgg;102;102;;;;;204;10
2;agg+cga;41;;;;;;41;
4;carre ccc;82;;;;;;82;16
5;autres;20;;;;;;20;
;;245;102;;;;;347;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;ade;1aa;>1aa;dup;;ref. ‰;1aa;>1aa;dup
21;faible;267;111;;378;26;44;28;
16;moyen;200;133;;333;324;33;33;
14;fort;133;156;;289;650;22;39;
; ;600;400;;45;729;27;18;
10;g+cgg;111;111;;222;10;42;;
2;agg+cga;44;;;44;;17;;
4;carre ccc;89;;;89;16;33;;
5;autres;22;;;22;;8;;
;;267;111;;378;;12;;

delta, estimation des -rRNAs[modifier | modifier le wikicode]

delta;;;;;;;;;;;;;;;;;;;;;;;;;
19 génomes total avec rRNA;;;;delta;total;ttt;tgt;;100 génomes total avec rRNA;;;;delta;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;19;90; ; ;;indices;;;;19;474;0;0;;delta1;effectifs;;1aa+>1aa+dup;;;à faire;45
atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;5;;atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;1;tcc;1;tac;1;tgc;1
atc;45;acc;;aac;;agc;;;atc;237;acc;;aac;;agc;;;atc;;acc;1;aac;1;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;1;cac;1;cgt;1
gtc;;gcc;;gac;;ggc;;;gtc;;gcc;;gac;;ggc;;;gtc;1;gcc;1;gac;1;ggc;1
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;1;tca;1;taa;;tga;1
ata;;aca;;aaa;;aga;;;ata;;aca;;aaa;;aga;;;ata;;aca;1;aaa;1;aga;1
cta;;cca;;caa;;cga;;;cta;;cca;;caa;;cga;;;cta;1;cca;1;caa;1;cga;1
gta;;gca;44;gaa;;gga;;;gta;;gca;232;gaa;;gga;;;gta;1;gca;;gaa;1;gga;1
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;1;tcg;1;tag;;tgg;1
atgj;;acg;;aag;;agg;;;atgj;;acg;;aag;;agg;;;atgj;1;acg;1;aag;1;agg;1
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;1;ccg;1;cag;1;cgg;1
gtg;;gcg;;gag;;ggg;;;gtg;;gcg;;gag;;ggg;;;gtg;1;gcg;1;gag;1;ggg;1
;;;;;;;;;;;;;;;;;;;;14;;14;;17;45
11.1.21 Paris;;;;delta;total;ttt;tgt;;11.1.21 Paris;;;;delta;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;65;3550;1.4;0;;indices;;;;65;3550;1.4;0;;delta1;indices;;1aa+>1aa+dup;;;;4500
atgi;97;tct;;tat;;atgf;144;;atgi;97;tct;;tat;;atgf;149;;atgi;100;tct;;tat;;atgf;100
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;1.5;cct;;cat;;cgc;9.0;;ctt;1.5;cct;;cat;;cgc;9.0;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;122;tcc;109;tac;118;tgc;108;;ttc;122;tcc;109;tac;118;tgc;108;;ttc;100;tcc;100;tac;100;tgc;100
atc;6;acc;118;aac;122;agc;105;;atc;243;acc;118;aac;122;agc;105;;atc;;acc;100;aac;100;agc;100
ctc;129;ccc;106;cac;111;cgt;134;;ctc;129;ccc;106;cac;111;cgt;134;;ctc;100;ccc;100;cac;100;cgt;100
gtc;100;gcc;131;gac;165;ggc;175;;gtc;100;gcc;131;gac;165;ggc;175;;gtc;100;gcc;100;gac;100;ggc;100
tta;108;tca;108;taa;;tga;86;;tta;108;tca;108;taa;3.1;tga;86;;tta;100;tca;100;taa;;tga;100
ata;0.0;aca;102;aaa;118;aga;106;;ata;;aca;102;aaa;118;aga;106;;ata;;aca;100;aaa;100;aga;100
cta;108;cca;105;caa;111;cga;65;;cta;108;cca;105;caa;111;cga;65;;cta;100;cca;100;caa;100;cga;100
gta;115;gca;2;gaa;180;gga;105;;gta;115;gca;234;gaa;180;gga;105;;gta;100;gca;;gaa;100;gga;100
ttg;126;tcg;106;tag;1.5;tgg;111;;ttg;126;tcg;106;tag;1.5;tgg;111;;ttg;100;tcg;100;tag;;tgg;100
atgj;112;acg;98;aag;85;agg;100;;atgj;112;acg;98;aag;85;agg;100;;atgj;100;acg;100;aag;100;agg;100
ctg;122;ccg;98;cag;88;cgg;92;;ctg;122;ccg;98;cag;88;cgg;92;;ctg;100;ccg;100;cag;100;cgg;100
gtg;83;gcg;78;gag;40;ggg;94;;gtg;83;gcg;78;gag;40;ggg;94;;gtg;100;gcg;100;gag;100;ggg;100
;;1558;;1816;;1581;4954;;;;2026;;1821;;1581;5428;;;;1400;;1400;;1700;4500
rapports;;77;;100;;100;91;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;delta1;indices;;1aa+>1aa+dup;;différence;;
atgi;100;tct;;tat;;atgf;96;;fiches;57.737;;;fréquences;;;;;atgi;3;tct;;tat;;atgf;30
att;;act;;aat;;agt;;;total des aas sans rRNA;1097;;;0/0;1;;;;att;;act;;aat;;agt;
ctt;100;cct;;cat;;cgc;;;avec;89;;;10;22;;;;ctt;100;cct;;cat;;cgc;100
gtt;;gct;;gat;;ggt;;;genom;19;;;20;12;;;;gtt;;gct;;gat;;ggt;
ttc;100;tcc;100;tac;100;tgc;100;;;;;;30;5;;;;ttc;18;tcc;8;tac;15;tgc;7
atc;3;acc;100;aac;100;agc;100;;delta1;45;;;40;3;;;;atc;100;acc;15;aac;18;agc;5
ctc;100;ccc;100;cac;100;cgt;100;;sans;45;;;50;2;;;;ctc;22;ccc;6;cac;10;cgt;25
gtc;100;gcc;100;gac;100;ggc;100;;avec;4;;;60;1;;;;gtc;0;gcc;24;gac;39;ggc;43
tta;100;tca;100;taa;;tga;100;;genom;1;;;70;0;;;;tta;7;tca;7;taa;;tga;14
ata;;aca;100;aaa;100;aga;100;;;;;;80;0;;;;ata;;aca;2;aaa;15;aga;6
cta;100;cca;100;caa;100;cga;100;;L’estimation par delta;;;;90;0;;;;cta;7;cca;5;caa;10;cga;35
gta;100;gca;1;gaa;100;gga;100;;est  22% en dessous;;;;100;3;;;;gta;13;gca;100;gaa;44;gga;5
ttg;100;tcg;100;tag;;tgg;100;;des aas sans;;;;;0;;;;ttg;21;tcg;6;tag;;tgg;10
atgj;100;acg;100;aag;100;agg;100;;;;;;;49;;;;atgj;11;acg;2;aag;15;agg;0
ctg;100;ccg;100;cag;100;cgg;100;;;;;;;;;;;ctg;18;ccg;2;cag;12;cgg;8
gtg;100;gcg;100;gag;100;ggg;100;;;;;;;;;;;gtg;17;gcg;22;gag;60;ggg;6
;;;;;;;;;;;;;;;;;;;;136;;284;;250;670

ade remarques[modifier | modifier le wikicode]

ade;;;;;;;49
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;2;acc;1;aac;1;agc;1
ctc;1;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;1
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;2;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;1;ccg;1;cag;1;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

epsilon[modifier | modifier le wikicode]

Arcobacter nitrofigilis DSM 7299[modifier | modifier le wikicode]

ant opérons[modifier | modifier le wikicode]

  • Lien tableau: ant opérons
  • notes: * devant un nombre pour les jaunes et dans une cellule pour limiter la protéine dans calc.
http://gtrnadb.ucsc.edu/genomes/bacteria/Arco_nitr_DSM_7299/arcoNitr_DSM7299-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_014166.1;ant;génome;;;;;;;;;;
28.4%GC;12.1.21 Paris;16s 4;55;;;;;;;cds dirigé;;
Arcobacter nitrofigilis DSM 7299;;;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéine;
;167574..168434;;cds;;66;66;;;287;66;4-hydroxybenzoate polyprenyltransferase;*
;168501..168577;;cga;@1;447;*447;;;;;;
;169025..169261;;cds;;;;;;79;;DNA-binding protein;*
;;;;;;;;;;;;
;237275..237622;;cds;;305;305;;;116;*305;nucleotide pyrophosphohydrolase;*
;237928..239444;;16s;;111;;;111;;;;
;239556..239632;;atc;;19;;19;;;;;
;239652..239727;;gca;;301;;;301;;;;
;240029..242945;;23s;;202;;;;;;;
;243148..243263;;5s;;354;354;;;;;;
comp;243618..244301;;cds;;;;;;228;;bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE;*
;;;;;;;;;;;;
comp;302333..303160;;cds;;155;155;;;276;;AraC family transcriptional regulator;*
;303316..303393;;cca;;10;;10;;;;;
;303404..303480;;cac;;16;;16;;;;;
;303497..303573;;aga;;61;;61;;;;;
;303635..303719;;cta;;96;;96;;;;;
;303816..303892;;atgf;;70;70;;;;70;;
;303963..304103;;cds;;;;;;47;;hp;
;;;;;;;;;;;;
;316375..317343;;cds;;110;110;;;323;;glycine betaine/L-proline ABC transporter substrate-binding protein ProX";*
;317454..317530;;atgf;;109;109;;;;109;;
;317640..318416;;cds;;;;;;259;;helix-turn-helix domain-containing protein;*
;;;;;;;;;;;;
;373519..375741;;cds;;120;120;;;*741;;PAS domain-containing protein;*
;375862..375937;;ttc;;5;;5;;;;;
;375943..376027;;tac;;65;65;;;;65;;
;376093..376725;;cds;;;;;;211;;hp;
;;;;;;;;;;;;
;597419..598486;;cds;;47;47;;;356;47;class II fructose-bisphosphate aldolase;*
;598534..598618;;ttg;;208;208;;;;;;
;598827..600107;;cds;;;;;;427;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
comp;751446..752990;;cds;@2;73;73;;;515;;cache domain-containing protein;*
comp;753064..753140;;gac;+;16;;16;;;;;
comp;753157..753232;;gta;2 gac gta gaa;3;;3;;;;;
comp;753236..753310;;gaa;2 aaa;31;;31;;;;;
comp;753342..753417;;aaa;;8;;8;;;;;
comp;753426..753502;;gac;;22;;22;;;;;
comp;753525..753600;;gta;;3;;3;;;;;
comp;753604..753678;;gaa;;42;;42;;;;;
comp;753721..753796;;aaa;;40;40;;;;40;;
comp;753837..754343;;cds;;;;;;169;;CinA family protein;*
;;;;;;;;;;;;
comp;833388..833978;;cds;;142;142;;;197;;LemA family protein;*
comp;834121..834204;;ctc;;93;93;;;;93;;
comp;834298..836409;;cds;;;;;;*704;;methyl-accepting chemotaxis protein;*
;;;;;;;;;;;;
;1445917..1449822;;cds;;93;93;;;*1302;93;hemolysin-type calcium-binding region;*
;1449916..1449991;;gaa;;270;270;;;;;;
;1450262..1450510;;cds;;;;;;83;;hp;
;;;;;;;;;;;;
;1615201..1615542;;cds;;29;29;;;114;29;hp;
;1615572..1615647;;gtc;;99;99;;;;;;
;1615747..1616595;;cds;;;;;;283;;universal stress protein;*
;;;;;;;;;;;;
;1703617..1703835;;cds;;1;1;;;73;1;hp;
comp;1703837..1703913;;atgf;;12;;12;;;;;
comp;1703926..1704000;;caa;;117;117;;;;;;
;1704118..1705149;;cds;;;;;;344;;bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II;*
;;;;;;;;;;;;
comp;2221719..2222525;;cds;+;242;242;;;269;;hp;
comp;2222768..2222842;;aac;2 aac;33;;33;;;;;
comp;2222876..2222950;;aac;;72;72;;;;72;;
comp;2223023..2223931;;cds;@3;;;;;303;;radical SAM protein;*
;;;;;;;;;;;;
comp;2282678..2283442;;cds;;349;349;;;255;;oxidoreductase;*
comp;2283792..2283880;;tcc;;81;;81;;;;;
comp;2283962..2284038;;gga;;39;;39;;;;;
comp;2284078..2284154;;atgi;;15;;15;;;;;
comp;2284170..2284259;;agc;;102;102;;;;102;;
comp;2284362..2285048;;cds;;;;;;229;;orotidine-5'-phosphate decarboxylase;*
;;;;;;;;;;;;
;2323802..2324866;;cds;@4;12;12;;;355;12;methyltransferase domain-containing protein;*
comp;2324879..2324954;;acc;;167;;;167;;;;
comp;2325122..2325237;;5s;;202;;;;;;;
comp;2325440..2328356;;23s;;300;;;300;;;;
comp;2328657..2328732;;gca;;19;;19;;;;;
comp;2328752..2328828;;atc;;111;;;111;;;;
comp;2328940..2330456;;16s;;378;378;;;;;;
comp;2330835..2331530;;cds;;;;;;232;;5'-methylthioadenosine/adenosylhomocysteine nucleosidase;*
;;;;;;;;;;;;
comp;2581821..2582840;;cds;;192;192;;;340;;UDP-glucose 4-epimerase GalE;*
comp;2583033..2583108;;tgc;;45;;45;;;;;
comp;2583154..2583242;;tca;;16;;16;;;;;
comp;2583259..2583345;;tta;;143;143;;;;*143;;
;2583489..2585177;;cds;;;;;;563;;dihydroxy-acid dehydratase;*
;;;;;;;;;;;;
comp;2637277..2637459;;cds;;81;81;;;61;;preprotein translocase subunit SecE;*
comp;2637541..2637616;;tgg;;31;31;;;;31;;
comp;2637648..2637815;;cds;;;;;;56;;50S ribosomal protein L33;*
;;;;;;;;;;;;
comp;2637824..2639032;;cds;;240;240;;;403;;elongation factor Tu;*
comp;2639273..2639349;;gga;;8;;8;;;;;
comp;2639358..2639442;;tac;;69;;69;;;;;
comp;2639512..2639588;;aca;;21;;21;;;;;
comp;2639610..2639685;;ttc;;41;41;;;;41;;
comp;2639727..2640881;;cds;;;;;;385;;UDP-N-acetylmuramoyl-L-alanine—D-glutamate ligase;*
;;;;;;;;;;;;
;2656033..2656263;;cds;;231;231;;;77;*231;transcriptional antiterminator Rof;*
comp;2656495..2656610;;5s;;223;;;;;;;
comp;2656834..2659750;;23s;;301;;;301;;;;
comp;2660052..2660127;;gca;;19;;19;;;;;
comp;2660147..2660223;;atc;;111;;;111;;;;
comp;2660335..2661851;;16s;;292;292;;;;;;
comp;2662144..2662782;;cds;;;;;;213;;hp;
;;;;;;;;;;;;
;2693436..2695451;;cds;;95;95;;;*672;;dynamin family protein;*
;2695547..2695621;;caa;;16;;16;;;;;
;2695638..2695724;;tta;;7;;7;;;;;
;2695732..2695808;;gga;;14;;14;;;;;
;2695823..2695898;;aaa;;16;;16;;;;;
;2695915..2695991;;atgf;;14;;14;;;;;
;2696006..2696082;;atgj;;12;;12;;;;;
;2696095..2696171;;aca;;30;;30;;;;;
;2696202..2696290;;tca;;90;90;;;;90;;
;2696381..2696893;;cds;;;;;;171;;hp;
;;;;;;;;;;;;
;3082950..3083174;;cds;;143;143;;;75;*143;CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone;*
comp;3083318..3083393;;acc;;173;;;173;;;;
comp;3083567..3083682;;5s;;202;;;;;;;
comp;3083885..3086801;;23s;;273;;;273;;;;
comp;3087075..3087150;;gca;;19;;19;;;;;
comp;3087170..3087246;;atc;;111;;;111;;;;
comp;3087358..3088874;;16s;;462;*462;;;;;;
;3089337..3090032;;cds;;;;;;232;;Bax inhibitor-1/YccA family protein;*

ant cumuls[modifier | modifier le wikicode]

ant cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;4;1;0;;1;1;1;1;100;8
;16 23 5s 0;;20;21;;50;6;20;1;200;5
;16 atc gca;4;40;6;;100;11;40;3;300;12
;16 23 5s a;;60;2;;150;8;60;2;400;7
;max a;3;80;2;;200;2;80;4;500;2
;a doubles;;100;2;;250;4;100;3;600;2
;autres;;120;;4;300;2;120;2;700;*1
;total aas;10;140;;0;350;2;140;0;800;*2
sans ;opérons;16;160;;0;400;2;160;*2;900;0
;1 aa;7;180;;2;450;*1;180;0;1000;0
;max a;8;200;;0;500;*1;200;0;1100;0
;a doubles;2;;;4;;0;;*2;;*1
;total aas;45;;33;10;;40;;20;;40
total aas;;55;;;;;;;;;
remarques;;;;;;;;;;;
avec jaune;;;moyenne;25;196;;155;;89;;301
;;;variance;22;88;;121;;73;;240
sans jaune;;;moyenne;;;;139;;60;;239
;;;variance;;;;102;;33;;132

ant blocs[modifier | modifier le wikicode]

Blocs 16s ant;;;;;;;;
cds;143;12;;cds;231;;cds;305
acc;173;167;;5s;223;;16s;111
5s;202;202;;23s;301;;atc;19
23s;273;300;;gca;19;;gca;301
gca;19;19;;atc;111;;23s;202
atc;111;111;;16s;292;;5s;354
16s;462;378;;cds;;;cds;
cds;;;;;;;;

ant remarques[modifier | modifier le wikicode]

ant distribution[modifier | modifier le wikicode]

  • Lien tableau: ant distribution
  • Notes: atgf gaa ont chacun un 1aa le reste >1aa. aac est un double.
distribution;ant;;;;;;
atgi;1;tct;;tat;;atgf;4
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1
atc;4;acc;2;aac;2;agc;1
ctc;1;ccc;;cac;1;cgt;
gtc;1;gcc;;gac;2;ggc;
tta;2;tca;2;taa;;tga;
ata;;aca;2;aaa;3;aga;1
cta;1;cca;2;caa;1;cga;1
gta;2;gca;4;gaa;3;gga;3
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;
arch;>1aa;1aa;-5s;+5s;-16s;+16s;total
total;38;7;;2;;8;55
;;;;;;;
;;;;;;;
distribution;ant;;;;;;
atgi;1;tct;;tat;;atgf;4
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1
atc;4;acc;2;aac;2;agc;1
ctc;1;ccc;;cac;1;cgt;
gtc;1;gcc;;gac;2;ggc;
tta;2;tca;2;taa;;tga;
ata;;aca;2;aaa;3;aga;1
cta;1;cca;2;caa;1;cga;1
gta;2;gca;4;gaa;3;gga;3
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;
;inter;;max;;min;;total
;24;;28;;3;;55

ant intercalaires entre cds[modifier | modifier le wikicode]

ant;5.2.21 Paris;;ant 24.9.20;;;;;;;
ant;intercalaires;;%;intercalaires;moyenne;ecartype;plage;ADN;intercal;<u>'''frequence5
;'''négatif;762;24.6;'''négatif ;-8;9;-1 à -79;'''3 192 235;-1;762
;'''zéro;65;2.1;;;;;'''intercals;0;65
;'''1 à 200;2060;66.6;'''0 à 200;56;54;;'''192 251;5;313
;'''201 à 370;150;4.8;'''201 à 370;258;43;;'''6.0%;10;248
;'''371 à 600;33;1.1;'''371 à 600;470;68;;;15;182
;'''601 à max;25;0.8;'''601 à 1028;769;128;;;20;100
;'''total 3095;<201;93.3;'''total 3094;60;105;-79 à 1028;;25;58
adresse;intercalx;intercal;<u>'''frequence1;intercal;<u>'''fréquence6;Cumul, %;intercal;<u>'''fréquence-1;30;51
184238;1181;-1;762;-70;2;;0;65;35;36
2384649;1028;0;65;-60;1;;-1;°164;40;34
710835;984;1;°120;-50;4;;-2;0;45;33
982825;947;2;70;-40;3;;-3;0;50;45
3045330;924;3;59;-30;14;'''min à -1;-4;°261;55;47
1534263;916;4;31;-20;49;762;-5;2;60;44
2391806;863;5;°33;-10;137;24.6%;-6;7;65;60
269108;850;6;26;0;617;;-7;12;70;42
1454453;848;7;21;10;561;;-8;°103;75;54
1174364;789;8;50;20;282;;-9;3;80;49
1115863;783;9;°94;30;109;;-10;8;85;56
2054584;776;10;57;40;70;'''1 à 100;-11;°49;90;56
2920637;773;11;48;50;78;1586;-12;4;95;31
1754154;772;12;°52;60;91;51.2%;-13;9;100;47
997474;739;13;39;70;102;;-14;°35;105;38
1906747;712;14;22;80;103;;-15;3;110;34
1172194;702;15;°21;90;112;;-16;1;115;45
606029;672;16;21;100;78;;-17;°26;120;31
1071807;649;17;15;110;72;;-18;0;125;35
1204569;642;18;°26;120;76;;-19;2;130;27
792914;628;19;26;130;62;;-20;°20;135;33
2100174;625;20;12;140;57;;-21;1;140;24
949485;617;21;°22;150;48;;-22;0;145;24
2733159;613;22;11;160;53;;-23;°9;150;24
2042643;612;23;11;170;20;'''1 à 200;-24;1;155;21
2270147;596;24;6;180;30;2060;-25;2;160;32
3006396;587;25;8;190;30;66.6%;-26;°6;165;16
2176130;583;26;°12;200;26;;-27;2;170;4
27717;575;27;8;210;20;;-28;0;175;15
1024897;562;28;6;220;18;;-29;°8;180;15
715253;551;29;°16;230;13;;-30;0;185;15
2128182;532;30;9;240;16;;-31;1;190;15
1829788;526;31;°11;250;9;;-32;°6;195;14
1763296;520;32;2;260;13;'''0 à 200;;810;200;12
;;33;°10;270;9;2125;reste;17;205;11
;;34;6;280;9;;total;827;210;9
;;35;7;290;5;;;;215;10
;;36;6;300;12;;'''intercal;<u>'''frequencef;220;8
;;37;7;310;5;;600;3070;225;5
;;38;6;320;3;;620;3;230;8
;;39;°9;330;7;;640;2;235;6
;;40;6;340;4;'''201 à 370;660;2;240;10
;;;1246;350;2;150;680;1;245;6
;;;2669;360;3;4.8%;700;;250;3
;;;;370;2;;720;2;255;7
;;;;380;1;;740;1;260;6
'''adresse;'''intercaln;'''décalage;'''long;390;4;;760;;265;5
3067823;-79;comp;;400;2;;780;3;270;4
2531271;-71;shift2;1430;410;3;;800;2;275;5
1382616;-65;shift2;248;420;1;;820;;280;4
1058996;-59;shift2;389;430;0;;840;;285;3
2237436;-56;shift2;872;440;0;;860;2;290;2
641645;-55;shift2;861;450;3;;880;1;295;5
1374304;-53;shift2;1223;460;4;;900;;300;7
3090072;-49;;;470;0;;920;1;305;1
542837;-43;;;480;1;;940;1;310;4
2236436;-41;;;490;1;;960;1;315;3
907463;-38;;;500;1;;980;;320;0
984116;-38;;;510;2;;1000;1;325;3
1476725;-38;;;520;2;;1020;;330;4
1904926;-38;;;530;1;;1040;1;335;3
1716281;-35;;;540;1;'''371 à 600;;24;340;1
2233985;-35;;;550;0;33;;;345;0
3184884;-35;;;560;1;1.1%;;;350;2
531215;-32;;;570;1;;;;355;2
642505;-32;;;580;1;'''601 à max;;;360;1
1843228;-32;;;590;2;25;;;365;1
2546649;-32;;;600;1;0.8%;;;370;1
2808157;-32;;;reste;25;;reste;1;reste;58
3127986;-32;;;total;3095;;total;3095;total;3095

ant autres intercalaires[modifier | modifier le wikicode]

ant;autres intercalaires;;adresses1;;;ant;autres intercalaires;;adresses2;;;ant;autres intercalaires;;adresses3;
deb;°CDS;167574;66;;;deb;°CDS;1445917;93;;;deb;°CDS;2637277;81;comp
;&tRNA;168501;447;;;;&tRNA;1449916;270;;;;&tRNA;2637541;31;comp
fin;°CDS;169025;;;;fin;°CDS;1450262;;;;fin;°CDS;2637648;;comp
deb;°CDS;237275;305;;;deb;°CDS;1615201;29;;;deb;°CDS;2637824;240;comp
;$rRNA;237928;111;;;;&tRNA;1615572;99;;;;&tRNA;2639273;8;comp
;&tRNA;239556;19;;;fin;°CDS;1615747;;;;;&tRNA;2639358;69;comp
;&tRNA;239652;301;;;deb;°CDS;1703617;1;;;;&tRNA;2639512;21;comp
;$rRNA;240029;202;;;;&tRNA;1703837;12;comp;;;&tRNA;2639610;41;comp
;$rRNA;243148;354;;;;&tRNA;1703926;117;comp;;fin;°CDS;2639727;;comp
fin;°CDS;243618;;comp;;fin;°CDS;1704118;;;;deb;°CDS;2656033;231;
deb;°CDS;302333;155;comp;;deb;°CDS;1907982;-5;;;;$rRNA;2656495;223;comp
;&tRNA;303316;10;;;;ncRNA;1908268;28;comp;;;$rRNA;2656834;301;comp
;&tRNA;303404;16;;;fin;°CDS;1908619;;comp;;;&tRNA;2660052;19;comp
;&tRNA;303497;61;;;deb;°CDS;2221719;242;comp;;;&tRNA;2660147;111;comp
;&tRNA;303635;96;;;;&tRNA;2222768;33;comp;;;$rRNA;2660335;292;comp
;&tRNA;303816;70;;;;&tRNA;2222876;72;comp;;fin;°CDS;2662144;;comp
fin;°CDS;303963;;;;fin;°CDS;2223023;;comp;;deb;°CDS;2693436;95;
deb;°CDS;316375;110;;;deb;°CDS;2282678;349;comp;;;&tRNA;2695547;16;
;&tRNA;317454;109;;;;&tRNA;2283792;81;comp;;;&tRNA;2695638;7;
fin;°CDS;317640;;;;;&tRNA;2283962;39;comp;;;&tRNA;2695732;14;
deb;°CDS;373519;120;;;;&tRNA;2284078;15;comp;;;&tRNA;2695823;16;
;&tRNA;375862;5;;;;&tRNA;2284170;102;comp;;;&tRNA;2695915;14;
;&tRNA;375943;65;;;fin;°CDS;2284362;;comp;;;&tRNA;2696006;12;
fin;°CDS;376093;;;;deb;°CDS;2323802;12;;;;&tRNA;2696095;30;
deb;°CDS;597419;47;;;;&tRNA;2324879;167;comp;;;&tRNA;2696202;90;
;&tRNA;598534;208;;;;$rRNA;2325122;202;comp;;fin;°CDS;2696381;;
fin;°CDS;598827;;;;;$rRNA;2325440;300;comp;;deb;°CDS;2739487;88;comp
deb;°CDS;751446;73;comp;;;&tRNA;2328657;19;comp;;;Regulatory;2740208;48;comp
;&tRNA;753064;16;comp;;;&tRNA;2328752;111;comp;;fin;°CDS;2740399;;comp
;&tRNA;753157;3;comp;;;$rRNA;2328940;378;comp;;deb;°CDS;2825449;163;
;&tRNA;753236;31;comp;;fin;°CDS;2330835;;comp;;;repeat_region;2825927;233;
;&tRNA;753342;8;comp;;deb;°CDS;2425110;353;;;fin;°CDS;2827303;;
;&tRNA;753426;22;comp;;;tmRNA;2427398;181;comp;;deb;°CDS;3082950;143;
;&tRNA;753525;3;comp;;fin;°CDS;2427974;;comp;;;&tRNA;3083318;173;comp
;&tRNA;753604;42;comp;;deb;°CDS;2581821;192;comp;;;$rRNA;3083567;202;comp
;&tRNA;753721;40;comp;;;&tRNA;2583033;45;comp;;;$rRNA;3083885;273;comp
fin;°CDS;753837;;comp;;;&tRNA;2583154;16;comp;;;&tRNA;3087075;19;comp
deb;°CDS;833388;142;comp;;;&tRNA;2583259;143;comp;;;&tRNA;3087170;111;comp
;&tRNA;834121;93;comp;;fin;°CDS;2583489;;;;;$rRNA;3087358;462;comp
fin;°CDS;834298;;comp;;;;;;;;fin;°CDS;3089337;;

ant intercalaires tRNA[modifier | modifier le wikicode]

ant ;intercalaires tRNA;;;;;;;;;
comp’;aa;comp’;deb;comp’;fin;;deb;fin;continu;cumuls
;;;;;;;;;;
;;;66;;447;;29;31;'''deb;
;10 16 61 96;comp’;155;;70;;47;40;<201;11
;;;110;;109;;66;41;total;14
;5;;120;;65;;73;65;taux;79%
;;;47;;208;;81;70;'''fin;
;16 3 31 8 22 3 42;;73;;40;;93;73;<201;12
;;;142;;93;;95;90;total;15
;;;93;;270;;110;93;taux;80%
;;;29;;99;;120;99;'''total;
;12;comp’;1;;117;;142;102;<201;23
;33;;242;;73;;192;109;total;29
;81 39 15;;349;;102;;240;117;taux;79%
;;comp’;12;;;;242;208;;
;45 16;;192;comp’;143;;349;270;;
;;;81;;31;;'''-;447;'''comp’;'''cumuls
;8 69 21;;240;;41;;1;143;'''deb;100%
;16 7 14 16 14 12 30;;95;;90;;12;-;'''fin;100%
;;comp’;143;;;;143;-;'''total;100%
;;;;;;;155;-;;
;;;;;;;;;;
comp’+continu;;;;;;;;;;
;deb;fin;total;;;;;;;
<201;15;13;28;;;;;;;
total;18;16;34;;;;;;;
%;83%;81%;82%;;;;;;;

ant par rapport au groupe de référence[modifier | modifier le wikicode]

tRNAs;;blocs tRNAs;;;blocs rRNAs;;;;
;ant;1aa;>1aa;dup;+5s;1-3aas;autres;total;
21;faible;3;;;;;;3;
16;moyen;2;12;;;2;8;24;
14;fort;2;24;2;;;;28;
; ;7;36;2;0;2;8;55;
10;g+cga;1;;;;;;1;
2;agg+cgg;;;;;;;0;
4;carre ccc;2;;;;;;2;
5;autres;;;;;;;0;
;;3;0;0;0;0;0;3;
;total tRNAs  ‰ ;;;;;;;;
;alpha8;1aa;>1aa;dup;+5s;1-3aas;autres;alpha  ‰;ref. ‰
21;faible;55;;;;;;55;26
16;moyen;36;218;0;;36;145;436;324
14;fort;36;436;36;;;;509;650
;;127;655;36;0;36;145;55;729
10;g+cga;18;;;;;;18;10
2;agg+cgg;;;;;;;;
4;carre ccc;36;;;;;;36;16
5;autres;;;;;;;;
;;55;0;0;0;0;0;55;
;blocs tRNAs ‰ ;;;;;;total colonne %;;
;alpha8;1aa;>1aa;dup;total;ref. ‰;1aa;>1aa;dup
21;faible;67;;;67;26;;0;
16;moyen;44;267;;311;324;;33;
14;fort;44;533;44;622;650;;67;
;;156;800;44;45;729;;36;
10;g+cga;22;;;22;10;;;
2;agg+cgg;;;;;;;;
4;carre ccc;44;;;44;16;;;
5;autres;;;;;;;;
;;67;;;67;;;;

epsilon, estimation des -rRNAs[modifier | modifier le wikicode]

epsilon;;;;;;;;;;;;;;;;;;;;;;;;;
40 génomes total avec rRNA;;;;epsilon;total;ttt;tgt;;100 génomes total avec rRNA;;;;epsilon;total;ttt;tgt;;;;;;;;;
effectifs;avec +16s;;;40;187; ; ;;indices;;;;40;468;0;0;;epsi1;effectifs;;1aa+>1aa+dup;;;;45
atgi;;tct;;tat;;atgf;1;;atgi;;tct;;tat;;atgf;3;;atgi;1;tct;;tat;;atgf;4
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;1;;ctt;;cct;;cat;;cgc;3;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;;tcc;;tac;;tgc;;;ttc;;tcc;;tac;;tgc;;;ttc;2;tcc;1;tac;2;tgc;1
atc;80;acc;3;aac;3;agc;;;atc;200;acc;8;aac;8;agc;;;atc;;acc;;aac;2;agc;1
ctc;;ccc;;cac;;cgt;;;ctc;;ccc;;cac;;cgt;;;ctc;1;ccc;;cac;1;cgt;
gtc;;gcc;;gac;2;ggc;;;gtc;;gcc;;gac;5;ggc;;;gtc;1;gcc;;gac;2;ggc;
tta;;tca;;taa;;tga;;;tta;;tca;;taa;;tga;;;tta;2;tca;2;taa;;tga;
ata;;aca;;aaa;3;aga;;;ata;;aca;;aaa;8;aga;;;ata;;aca;2;aaa;3;aga;1
cta;;cca;1;caa;;cga;;;cta;;cca;3;caa;;cga;;;cta;1;cca;2;caa;1;cga;1
gta;2;gca;89;gaa;;gga;;;gta;5;gca;223;gaa;;gga;;;gta;2;gca;;gaa;3;gga;3
ttg;;tcg;;tag;;tgg;;;ttg;;tcg;;tag;;tgg;;;ttg;1;tcg;;tag;;tgg;1
atgj;;acg;;aag;1;agg;;;atgj;;acg;;aag;3;agg;;;atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;;;ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;1;ggg;;;gtg;;gcg;;gag;3;ggg;;;gtg;;gcg;;gag;;ggg;
;;172;;13;;2;187;;;;430;;33;;5;468;;;;14;;28;;3;45
11.1.21 Paris;;;;epsilon;total;ttt;tgt;;11.1.21 Paris;;;;epsilon;total;ttt;tgt;;;;;;;;;
estimation 1aa+>1aa+dup;;;;161;6531;0;0;;indices;;;;161;6531;0;0;;epsi1;indices;;1aa+>1aa+dup;;;;4500
atgi;99;tct;;tat;0.6;atgf;104;;atgi;99;tct;;tat;0.6;atgf;106;;atgi;100;tct;;tat;;atgf;400
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;95;;ctt;;cct;;cat;;cgc;97;;ctt;;cct;;cat;;cgc;
gtt;1.2;gct;;gat;;ggt;;;gtt;1.2;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;107;tcc;97;tac;103;tgc;101;;ttc;107;tcc;97;tac;103;tgc;101;;ttc;200;tcc;100;tac;200;tgc;100
atc;-9;acc;92;aac;105;agc;101;;atc;191;acc;99;aac;112;agc;101;;atc;;acc;;aac;200;agc;100
ctc;101;ccc;55;cac;100;cgt;0;;ctc;101;ccc;55;cac;100;cgt;0;;ctc;100;ccc;;cac;100;cgt;
gtc;98;gcc;95;gac;134;ggc;140;;gtc;98;gcc;95;gac;139;ggc;140;;gtc;100;gcc;;gac;200;ggc;
tta;104;tca;101;taa;;tga;60;;tta;104;tca;101;taa;;tga;60;;tta;200;tca;200;taa;;tga;
ata;0.0;aca;108;aaa;143;aga;124;;ata;;aca;108;aaa;150;aga;124;;ata;;aca;200;aaa;300;aga;100
cta;101;cca;99;caa;109;cga;100;;cta;101;cca;101;caa;109;cga;100;;cta;100;cca;200;caa;100;cga;100
gta;134;gca;-24;gaa;173;gga;111;;gta;139;gca;199;gaa;173;gga;111;;gta;200;gca;;gaa;300;gga;300
ttg;101;tcg;0.6;tag;0.6;tgg;100;;ttg;101;tcg;0.6;tag;0.6;tgg;100;;ttg;100;tcg;;tag;;tgg;100
atgj;98;acg;1.9;aag;6.5;agg;96;;atgj;98;acg;1.9;aag;9.0;agg;96;;atgj;100;acg;;aag;;agg;
ctg;1.2;ccg;0.6;cag;0.6;cgg;1.2;;ctg;1.2;ccg;0.6;cag;0.6;cgg;1.2;;ctg;;ccg;;cag;;cgg;
gtg;0;gcg;0;gag;23;ggg;1.9;;gtg;;gcg;;gag;25;ggg;1.9;;gtg;;gcg;;gag;;ggg;
;;1287;;1663;;641;3591;;;;1717;;1695;;646;4058;;;;1400;;2800;;300;4500
rapports;;75;;98;;99;88;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;Les écarts;;en %;;;;;
rapports;;;;;;;;;;;;;;;;;;epsi1;indices;;1aa+>1aa+dup;;différence;;
atgi;100;tct;;tat;;atgf;98;;fiches;39.7;;;fréquences;;;;;atgi;1;tct;;tat;;atgf;74
att;;act;;aat;;agt;;;total des aas sans rRNA;1588;;;0/0;4;cgt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;97;;avec;188;;;10;13;;;;ctt;;cct;;cat;;cgc;100
gtt;;gct;;gat;;ggt;;;genom;40;;;20;1;;;;gtt;;gct;;gat;;ggt;
ttc;100;tcc;100;tac;100;tgc;100;;;;;;30;0;;;;ttc;47;tcc;3;tac;49;tgc;1
atc;-5;acc;92;aac;93;agc;100;;epsi1;45;;;40;2;;;;atc;100;acc;100;aac;48;agc;1
ctc;100;ccc;100;cac;100;cgt;;;sans;45;;;50;7;23;;;ctc;1;ccc;100;cac;0;cgt;
gtc;100;gcc;100;gac;96;ggc;100;;avec;10;;;60;2;;;;gtc;2;gcc;100;gac;33;ggc;100
tta;100;tca;100;taa;;tga;100;;genom;1;;;70;1;;;;tta;48;tca;50;taa;;tga;100
ata;;aca;100;aaa;95;aga;100;;;;;;80;1;;;;ata;;aca;46;aaa;53;aga;19
cta;100;cca;98;caa;100;cga;100;;L’estimation par epsilon;;;;90;0;;;;cta;1;cca;51;caa;8;cga;0
gta;96;gca;-12;gaa;100;gga;100;;est  13% au dessu;;;;100;18;;;;gta;33;gca;100;gaa;42;gga;63
ttg;100;tcg;100;tag;;tgg;100;;des aas sans;;;;;0;;;;ttg;1;tcg;100;tag;;tgg;0
atgj;100;acg;100;aag;72;agg;100;;;;;;;49;;;;atgj;2;acg;100;aag;100;agg;100
ctg;100;ccg;100;cag;100;cgg;100;;;;;;;;;;;ctg;100;ccg;100;cag;100;cgg;100
gtg;;gcg;;gag;90;ggg;100;;;;;;;;;;;gtg;;gcg;;gag;100;ggg;100
;;75;;98;;99;88;;;;;;;;;;;;;127;;546;;3;676

pub[modifier | modifier le wikicode]

pub opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Cand_Pela_ubique_HTCC1062/candPela_UBIQUE_HTCC1062-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_007205.1;ant;génome;;;;;;;;;;
29.2%GC;30.1.21 Paris;16s 1;31;;;;;;;cds dirigé;;
Pelagibacter ubique;;;;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd;protéine;
;41060..41653;;cds;;20;20;;;198;;ABC transporter substrate-binding protein;*
comp;41674..41750;;atgi;;66;;66;;;;;
comp;41817..41891;;gtc;;8;8;;;;8;;
comp;41900..43723;;cds;;;;;;*608;;RNA polymerase sigma factor RpoD;*
;;;;;;;;;;;;
comp;114873..116147;;cds;;3;3;;;425;3;CCA tRNA nucleotidyltransferase;*
comp;116151..116224;;caa;;32;32;;;;;;
comp;116257..117102;;cds;;;;;;282;;4-diphosphocytidyl-2C-methyl-D-erythritol kinase;*
;;;;;;;;;;;;
comp;319204..319548;;cds;;22;22;;;115;22;4a-hydroxytetrahydrobiopterin dehydratase;*
comp;319571..319645;;ggc;;97;97;;;;;;
;319743..320384;;cds;;;;;;214;;LON peptidase substrate-binding domain-containing protein;*
;;;;;;;;;;;;
comp;407852..408448;;cds;;68;68;;;199;;DedA family protein;*
;408517..408601;;ttg;;7;7;;;;7;;
;408609..410315;;cds;;;;;;*569;;AMP-binding protein;*
;;;;;;;;;;;;
comp;414886..415407;;cds;;26;26;;;174;26;PaaI family thioesterase;*
comp;415434..415510;;cgt;;75;75;;;;;;
;415586..416773;;cds;;;;;;396;;acetyl-CoA C-acetyltransferase;*
;;;;;;;;;;;;
;438405..440213;;cds;;2;2;;;*603;2;elongation factor 4;*
;440216..440305;;tcc;;5;5;;;;5;;
comp;440311..441081;;cds;;;;;;257;;FkbM family methyltransferase;*
;;;;;;;;;;;;
;461643..462362;;cds;;2;2;;;240;2;VTT domain-containing protein;*
comp;462365..462438;;acc;;101;101;;;;;;
;462540..462737;;cds;;;;;;66;;hp;*
;;;;;;;;;;;;
;466335..466550;;cds;;5;5;;;72;5;translation initiation factor IF-1;*
;466556..466631;;ttc;;88;88;;;;;;
;466720..466932;;cds;;235;235;;;71;;cold-shock protein;*
;467168..467242;;cac;;5;5;;;;5;;
;467248..468645;;cds;;;;;;466;;histidine--tRNA ligase;*
;;;;;;;;;;;;
comp;509729..511027;;cds;;330;*330;;;433;*330;peptidoglycan DD-metalloendopeptidase family protein;*
;511358..512832;;16s;@1;98;;;;;;;
;512931..513007;;atc;;9;;;9;;;;
;513017..513092;;gca;;149;;;;;;;
;513242..515995;;23s;;446;*446;;;;;;
;516442..516975;;cds;;46625;;;;178;;WbuC family cupin fold metalloprotein;*
;;;;;;;;;;;;
;563601..564479;;cds;;52;52;;;293;;NAD-dependent epimerase/dehydratase family protein;*
;564532..564646;;5s;;13;13;;;;13;;
;564660..564785;;cds;;;;;;42;;type B 50S ribosomal protein L36;*
;;;;;;;;;;;;
;567715..568413;;cds;;18;18;;;233;;transaldolase;*
comp;568432..568508;;atgf;;6;6;;;;6;;
comp;568515..568709;;cds;;;;;;65;;30S ribosomal protein S21;*
;;;;;;;;;;;;
comp;593396..594376;;cds;;23;23;;;327;;RluA family pseudouridine synthase;*
;594400..594476;;cga;@2;16;16;;;;16;;
comp;594493..595425;;cds;;;;;;311;;threonylcarbamoyl-AMP synthase;*
;;;;;;;;;;;;
comp;842772..843023;;cds;;101;101;;;84;;DUF1289 domain-containing protein;*
;843125..843209;;cta;;16;16;;;;16;;
;843226..844659;;cds;;;;;;478;;trigger factor;*
;;;;;;;;;;;;
;846722..849106;;cds;;49;49;;;*795;49;endopeptidase La;*
;849156..849231;;gta;;13;;13;;;;;
;849245..849321;;gac;;88;88;;;;;;
;849410..849778;;cds;;;;;;123;;NADH-quinone oxidoreductase subunit A;*
;;;;;;;;;;;;
;934654..936063;;cds;;31;31;;;470;31;potassium transporter Trk;*
;936095..936171;;aga;;170;170;;;;;;
;936342..937382;;cds;;;;;;347;;amino acid ABC transporter substrate-binding protein;*
;;;;;;;;;;;;
;941232..942389;;cds;;19;19;;;386;19;hp;*
comp;942409..942484;;aac;;52;;52;;;;;
comp;942537..942610;;tgc;;128;128;;;;;;
;942739..945366;;cds;;;;;;*876;;valine--tRNA ligase;*
;;;;;;;;;;;;
;970015..971127;;cds;;200;200;;;371;;tRNA guanosine(34) transglycosylase Tgt;*
;971328..971403;;aaa;;20;20;;;;20;;
comp;971424..972251;;cds;;;;;;276;;M48 family metallopeptidase;*
;;;;;;;;;;;;
;975062..975328;;cds;;0;0;;;89;0;succinate dehydrogenase assembly factor 2;*
comp;975329..975418;;tca;;92;92;;;;;;
;975511..976392;;cds;;;;;;294;;EamA family transporter RarD;*
;;;;;;;;;;;;
comp;985615..986127;;cds;;93;93;;;171;;zinc-ribbon domain-containing protein;*
;986221..986297;;cca;;4;4;;;;4;;
;986302..986583;;cds;;;;;;94;;ETC complex I subunit;*
;;;;;;;;;;;;
;988522..990216;;cds;;50;50;;;*565;;single-stranded-DNA-specific exonuclease RecJ;*
;990267..990341;;gaa;;23;23;;;;23;;
;990365..990598;;cds;;;;;;78;;GIY-YIG nuclease family protein;*
;;;;;;;;;;;;
;1029539..1031752;;cds;;0;0;;;*738;0;lytic transglycosylase domain-containing protein;*
comp;1031753..1031844;;agc;;68;68;;;;;;
;1031913..1033166;;cds;;;;;;418;;sarcosine oxidase subunit beta family protein;*
;;;;;;;;;;;;
comp;1085222..1085413;;cds;;19;19;;;64;;preprotein translocase subunit SecE;*
comp;1085433..1085508;;tgg;;7;7;;;;7;;
comp;1085516..1086706;;cds;;47;47;;;397;47;elongation factor Tu;*
comp;1086754..1086827;;gga;;46;;46;;;;;
comp;1086874..1086959;;tac;;131;131;;;;;;
;1087091..1087834;;cds;;33;33;;;248;33;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;1087868..1087943;;aca;;4;4;;;;4;;
comp;1087948..1088727;;cds;;4;4;;;260;4;NAD kinase;*
comp;1088732..1088816;;tta;;79;79;;;;;;
comp;1088896..1089312;;cds;;;;;;139;;Gamma-glutamylcyclotransferase;*
;;;;;;;;;;;;
;1165696..1166454;;cds;;141;141;;;253;;pilin;*
comp;1166596..1166672;;atgj;;64;64;;;;64;;
comp;1166737..1166964;;cds;;;;;;76;;hp;*

pub cumuls[modifier | modifier le wikicode]

pub cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;1;1;;;1;2;1;2;100;11
;16 atcgca 23;1;20;1;1;50;31;20;18;200;8
;16 atc23s5s;;40;;;100;11;40;5;300;11
;16gca23s5s;;60;2;;150;5;60;2;400;7
;max a;2;80;1;;200;2;80;1;500;6
;a doubles;;100;;;250;1;100;;600;2
;autres;;120;;;300;;120;;700;2
;total aas;2;140;;;350;1;140;;800;2
sans ;opérons;25;160;;;400;;160;;900;1
;1 aa;21;180;;;450;1;180;;1000;
;max a;2;200;;;500;;200;;1100;
;a doubles;0;;;;;;;1;;
;total aas;29;;4;1;;54;;29;;50
total aas;;31;;;;;;;;;
remarques;;;;;;;;;;;
avec jaune;;;moyenne;44;9;;63;;27;;299
;;;variance;22;0;;85;;61;;203
sans jaune;;;moyenne;;;;50;;16;;237
;;;variance;;;;55;;16;;134

pub blocs[modifier | modifier le wikicode]

Blocs 16s pub;;;;
cds;330;433;peptidoglycan DD-metalloendopeptidase family protein;*
16s;98;1475;;
atc;9;77;;
gca;149;76;;
23s;446;2754;;
cds;46625;178;WbuC family cupin fold metalloprotein;*
;;;;
cds;52;293;NAD-dependent epimerase/dehydratase family protein;*
5s;13;115;;
cds;;42;type B 50S ribosomal protein L36;*

pub distribution[modifier | modifier le wikicode]

distribution;pub;;;;;;31
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;1;acc;1;aac;1;agc;1
ctc;;ccc;;cac;1;cgt;1
gtc;1;gcc;;gac;1;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;
arch;>1aa;1aa;-5s;+5s;-16s;+16s;total
total;8;21;;;;2;31
;;1aa;1;11;9;;
;;>1aa;1;2;5;;
distribution;scc;;min;inter;max;;29
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;;acc;1;aac;1;agc;1
ctc;;ccc;;cac;1;cgt;1
gtc;1;gcc;;gac;1;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;;gaa;1;gga;1
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;
;inter;;max;;min;;total
;13;;14;;2;;29

pub intercalaires entre cds[modifier | modifier le wikicode]

28.1.21 paris;24.1.21;1380;pilM ;Pseudo : incomplete, partial in the middle of a contig, missing N-terminus;;;;;;
pub;intercalaires;total;%;intercalaires;;;plage;ADN;intercal;<u>'''frequence5
;'''négatif;473;36.2;'''négatif ;-8;9;-65 à -1;'''1 308 759;-1;473
;'''zéro;71;5.4;;;;;'''intercals;0;71
;'''1 à 200;736;56.3;'''0 à 200;37;45;;'''39 179;5;228
;'''201 à 370;19;1.5;'''201 à 370;260;47;;'''3.0%;10;67
;'''371 à 600;7;0.5;'''371 à 600;475;70;;;15;35
;'''601 à max;1;0.1;'''601 à 1028;-;;;;20;31
;'''total 1307;<201;97.9;'''total 1306;26;61;-65 à 596;;25;29
adresse;intercalx;intercal;<u>'''frequence1;intercal;<u>'''fréquence6;cumul, %;intercal;<u>'''fréquence-1;30;16
73227;1380;-1;473;-70;0;;0;71;35;26
999551;596;0;71;-60;1;;-1;°152;40;23
1162229;549;1;56;-50;2;;-2;3;45;33
537246;464;2;°69;-40;6;'''-65 à -1;-3;0;50;16
1119848;445;3;43;-30;8;473;-4;°123;55;23
1180952;435;4;30;-20;29;36%;-5;2;60;25
193367;434;5;°30;-10;79;;-6;2;65;15
398173;403;6;15;0;419;;-7;3;70;13
408609;356;7;15;10;295;;-8;°56;75;17
762333;335;8;°15;20;66;;-9;7;80;12
1122717;318;9;14;30;45;'''1 à 100;-10;2;85;10
338267;317;10;8;40;49;651;-11;°35;90;14
997872;304;11;°8;50;49;49.8%;-12;4;95;7
334628;284;12;7;60;48;;-13;3;100;9
675167;279;13;6;70;28;;-14;°20;105;8
1135181;268;14;°12;80;29;;-15;0;110;4
627169;255;15;2;90;24;;-16;2;115;9
1118568;248;16;5;100;16;;-17;°10;120;8
79392;239;17;6;110;12;'''1 à 200;-18;2;125;7
807867;230;18;°8;120;17;736;-19;1;130;6
58997;223;19;4;130;13;56.3%;-20;°13;135;5
1152723;221;20;8;140;10;;-21;0;140;5
761553;219;21;°9;150;6;;-22;1;145;1
782276;217;22;5;160;7;;-23;°6;150;5
612190;216;23;3;170;5;;-24;3;155;2
351261;209;24;°8;180;5;;-25;1;160;5
838936;201;25;4;190;7;'''0 à 200;-26;°3;165;3
744621;200;26;3;200;5;807;-27;0;170;2
166432;195;27;°4;210;2;;-28;1;175;4
625822;195;28;4;220;3;;-29;1;180;1
164576;191;29;3;230;3;;-30;1;185;6
217060;191;30;2;240;1;;-31;1;190;1
1163621;188;31;3;250;1;;-32;1;195;4
798049;185;32;°8;260;1;;;530;200;1
422106;184;33;5;270;1;;reste;14;205;1
288782;182;34;2;280;1;'''201 à 370;total;544;210;1
560488;182;35;°8;290;1;19;;;215;0
262705;181;36;7;300;0;1.5%;;;220;3
469675;181;37;5;310;1;;;;225;2
832239;177;38;2;320;2;;;;230;1
939877;174;39;°6;330;0;;;;235;0
;;40;3;340;1;;;;240;1
;;reste;308;350;0;;;;245;0
;;total;1122;360;1;;;;250;1
;;;;370;0;;;;255;1
;;;;380;0;;;;260;0
;;;;390;0;;;;265;0
;;;;400;0;;;;270;1
;;;;410;1;;;;275;0
;;;;420;0;;;;280;1
'''adresse;'''intercaln;'''décalage;'''long;430;0;;;;285;1
817687;-65;shift2;2521;440;2;;;;290;0
410672;-59;shift2;856;450;1;;;;295;0
1196013;-56;shift2;445;460;0;;;;300;0
474189;-47;shift2;1222;470;1;;;;305;1
682918;-47;shift2;1435;480;0;;;;310;0
1025350;-44;shift2;544;490;0;;;;315;0
1197066;-43;comp;;500;0;'''371 à 600;;;320;2
584040;-41;shift2;934;510;0;7;;;325;0
707855;-41;shift2;319;520;0;0.5%;;;330;0
802906;-38;;;530;0;;;;335;1
1038898;-38;;;540;0;;;;340;0
279711;-35;;;550;1;;;;345;0
1027659;-35;;;560;0;;;;350;0
928018;-34;;;570;0;;;;355;0
803426;-32;;;580;0;;;;360;1
1176246;-31;;;590;0;'''max;;;365;0
429007;-30;;;600;1;1380;;;370;0
992704;-29;;;reste;1;;;;reste;8
1233832;-28;;;total;1307;;;;total;1307

pub autres intercalaires[modifier | modifier le wikicode]

pub;autres intercalaires;;adresses1;;;pub;autres intercalaires;;adresses2;;;pub;autres intercalaires;;adresses3;
deb;°CDS;9267;4;comp;;deb;°CDS;509729;330;comp;;deb;°CDS;970015;200;
;tmRNA;10219;-2;;;;$rRNA;511358;98;;;;&tRNA;971328;20;
fin;°CDS;10519;;comp;;;&tRNA;512931;9;;;fin;°CDS;971424;;comp
deb;°CDS;38328;255;comp;;;&tRNA;513017;149;;;deb;°CDS;975062;0;
;ncRNA;39051;42;comp;;;$rRNA;513242;446;;;;&tRNA;975329;92;comp
fin;°CDS;39448;;comp;;fin;°CDS;516442;;;;fin;°CDS;975511;;
deb;°CDS;41060;20;;;deb;°CDS;563601;52;;;deb;°CDS;985615;93;comp
;&tRNA;41674;66;comp;;;$rRNA;564532;13;;;;&tRNA;986221;4;
;&tRNA;41817;8;comp;;fin;°CDS;564660;;;;fin;°CDS;986302;;
fin;°CDS;41900;;comp;;deb;°CDS;567715;18;;;deb;°CDS;988522;50;
deb;°CDS;114873;3;comp;;;&tRNA;568432;6;comp;;;&tRNA;990267;23;
;&tRNA;116151;32;comp;;fin;°CDS;568515;;comp;;fin;°CDS;990365;;
fin;°CDS;116257;;comp;;deb;°CDS;593396;23;comp;;deb;°CDS;1005217;139;comp
deb;°CDS;319204;22;comp;;;&tRNA;594400;16;;;;regulatory;1005818;4;
;&tRNA;319571;97;comp;;fin;°CDS;594493;;comp;;fin;°CDS;1005891;;
fin;°CDS;319743;;;;deb;°CDS;648881;24;;;deb;°CDS;1029539;0;
deb;°CDS;407852;68;comp;;;regulatory;649787;77;;;;&tRNA;1031753;68;comp
;&tRNA;408517;7;;;fin;°CDS;649954;;;;fin;°CDS;1031913;;
fin;°CDS;408609;;;;deb;°CDS;731869;9;comp;;deb;°CDS;1085222;19;comp
deb;°CDS;414886;26;comp;;;regulatory;732787;88;comp;;;&tRNA;1085433;7;comp
;&tRNA;415434;75;comp;;fin;°CDS;732939;;comp;;deb;°CDS;1085516;47;comp
fin;°CDS;415586;;;;deb;°CDS;785951;32;;;;&tRNA;1086754;46;comp
deb;°CDS;438405;2;;;;regulatory;786499;-13;;;;&tRNA;1086874;131;comp
;&tRNA;440216;5;;;fin;°CDS;786575;;;;deb;°CDS;1087091;33;
fin;°CDS;440311;;comp;;deb;°CDS;842772;101;comp;;;&tRNA;1087868;4;
deb;°CDS;461643;2;;;;&tRNA;843125;16;;;deb;°CDS;1087948;4;comp
;&tRNA;462365;101;comp;;fin;°CDS;843226;;;;;&tRNA;1088732;79;comp
fin;°CDS;462540;;;;deb;°CDS;846722;49;;;fin;°CDS;1088896;;comp
deb;°CDS;466335;5;;;;&tRNA;849156;13;;;deb;°CDS;1125607;4;comp
;&tRNA;466556;88;;;;&tRNA;849245;88;;;;regulatory;1126163;3;comp
deb;°CDS;466720;235;;;fin;°CDS;849410;;;;deb;°CDS;1126231;66;comp
;&tRNA;467168;5;;;deb;°CDS;934654;31;;;;regulatory;1127359;295;comp
fin;°CDS;467248;;;;;&tRNA;936095;170;;;fin;°CDS;1127719;;comp
deb;°CDS;496262;70;comp;;fin;°CDS;936342;;;;deb;°CDS;1165696;141;
;regulatory;498528;91;comp;;deb;°CDS;941232;19;;;;&tRNA;1166596;64;comp
fin;°CDS;498707;;;;;&tRNA;942409;52;comp;;fin;°CDS;1166737;;comp
;;;;;;;&tRNA;942537;128;comp;;;;;;
;;;;;;fin;°CDS;942739;;;;;;;;

pub intercalaires tRNA[modifier | modifier le wikicode]

pub;intercalaires tRNA;;;;;;;;;
;entre aas;;cds aa deb;;cds aa fin ;;deb;fin;;
;;;;;;;;;;
;66;comp’;20;;8;;2;4;deb;
;9;;3;;32;;3;5;<201;13
;13;;22;comp’;97;;4;6;total;14
comp’;52;comp’;68;;7;;5;7;taux;93%
;46;;26;comp’;75;;19;7;fin;
;;;2;comp’;5;;22;8;<201;14
;;comp’;2;comp’;101;;26;16;total;14
;;;5;;88;;31;23;taux;100%
;;;235;;5;;33;32;total;
;;comp’;18;;6;;47;64;<201;27
;;comp’;23;comp’;16;;49;79;total;28
;;comp’;101;;16;;50;88;taux;96%
;;;49;;88;;200;88;;
;;;31;;170;;235;170;comp’;cumuls
;;comp’;19;comp’;128;;0;4;;
;;;200;comp’;20;;0;5;deb;11
;;comp’;0;comp’;92;;2;16;<201;100%
;;comp’;93;;4;;18;20;;
;;;50;;23;;19;68;fin;11
;;comp’;0;comp’;68;;20;75;<201;100%
;;;19;;7;;23;92;;
;;;47;comp’;131;;68;97;total;
;;;33;comp’;4;;93;101;<201;22
;;;4;;79;;101;128;total;22
;;comp’;141;;64;;141;131;taux;100%
;;;;;;;;;;
;;;;;;;;;;
;;;;;;;;;;
;;;deb;fin;total;;;;;
;;<201;24;25;49;;;;;
;;total;25;25;50;;;;;
;;taux;96%;100%;98%;;;;;

actino[modifier | modifier le wikicode]