Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Atableur
Image logo représentative de la faculté
Annexe 10
Recherche : Les clusters de gènes tRNA et rRNA chez les procaryotes
Précédent :archeo
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Annexe : Atableur
Les clusters de gènes tRNA et rRNA chez les procaryotes/Annexe/Atableur
 », n'a pu être restituée correctement ci-dessus.



bacilli[modifier | modifier le wikicode]

Bacillus subtilis[modifier | modifier le wikicode]

bsu[modifier | modifier le wikicode]

  • Lien tableau: bsu
Bacillus subtilis subsp. subtilis str. 168;;;;
43.6%GC;7.3.19 Paris;86;doubles;intercal
;;;;
;9810..11364;16s;@2;99
;11464..11540;atc;;11
;11552..11627;gca;;81
;11709..14636;23s;;55
;14692..14810;5s;;
;;;;
; 22292..22384;tca;;
;;;;
;30279..31832;16s;;99
;31932..32008;atc;;11
;32020..32095;gca;;81
;32177..35103;23s;;133
;35237..35355;5s;;
;;;;
;70181..70257;atg;;9
;70267..70338;gaa;;
;;;;
;90536..92089;16s;@1;164
;92254..95181;23s;;55
;95237..95354;5s;;20
;95375..95450;gta;;4
;95455..95530;aca;;36
;95567..95642;aaa;;6
;95649..95731;cta;;40
;95772..95846;ggc;;14
;95861..95946;tta;;9
;95956..96032;cgt;;27
;96060..96136;cca;;9
;96146..96221;gca;;170
;96392..97945;16s;;164
;98110..101037;23s;;55
;101093..101211;5s;;
;;;;
;160893..162445;16s;;164
;162610..165535;23s;;55
;165591..165707;5s;;46
;165754..165825;aac;;4
;165830..165902;acc;;56
;165959..166033;ggc;;30
;166064..166140;cgt;;27
;166168..166244;cca;;8
;166253..166328;gca;;171
;166500..168053;16s;;164
;168218..171141;23s;;55
;171197..171314;5s;;183
;171498..173049;16s;;164
;173214..176141;23s;;55
;176197..176315;5s;;
;;;;
;194205..194279;gaa;;3
;194283..194358;gta;;4
;194363..194435;aca;;22
;194458..194542;tac;;4
;194547..194621;caa;;
;;;;
;528704..528778;aac;;4
;528783..528873;agc;;29
;528903..528974;gaa;;11
;528986..529060;caa;;26
;529087..529162;aaa;;11
;529174..529255;cta;;80
;529336..529422;ctc;;
;;;;
;635110..635186;cgt;;13
;635200..635273;gga;;159
;635433..636987;16s;;167
;637155..640082;23s;;55
;640138..640254;5s;;13
;640268..640344;atgf;;60
;640405..640481;gac;;
;;;;
;946696..948250;16s;;167
;948418..951345;23s;;111
;951457..951572;5s;;9
;951582..951656;aac;;5
;951662..951753;tcc;;34
;951788..951859;gaa;;9
;951869..951944;gta;;9
;951954..952030;atgf;;11
;952042..952118;gac;;12
;952131..952206;ttc;;5
;952212..952284;aca;;22
;952307..952391;tac;;5
;952397..952470;tgg;;24
;952495..952570;cac;;9
;952580..952651;caa;;49
;952701..952775;ggc;;5
;952781..952851;tgc;;7
;952859..952947;tta;@3;265
;953213..953294;ttg;;
;;;;
;967065..967138;gga;;
;;;;
;1262789..1262861;gtc;;
;;;;
comp;2003276..2003348;agg;;
;;;;
;2563889..2563959;caa;;
;;;;
comp;2899816..2899889;aga;;
;;;;
comp;3171879..3171950;gaa;;25
comp;3171976..3172066;agc;;3
comp;3172070..3172144;aac;;10
comp;3172155..3172231;atc;;15
comp;3172247..3172320;gga;;10
comp;3172331..3172406;cac;;17
comp;3172424..3172499;ttc;;12
comp;3172512..3172588;gac;;11
comp;3172600..3172676;atgf;;17
comp;3172694..3172786;tca;;6
comp;3172793..3172869;atgi;;2
comp;3172872..3172948;atgj;;19
comp;3172968..3173040;gca;;5
comp;3173046..3173122;cca;;15
comp;3173138..3173214;cgt;;9
comp;3173224..3173309;tta;;14
comp;3173324..3173398;ggc;;5
comp;3173404..3173490;ctg;;10
comp;3173501..3173576;aaa;;37
comp;3173614..3173689;aca;;32
comp;3173722..3173797;gta;;20
comp;3173818..3173935;5s;;55
comp;3173991..3176918;23s;;167
comp;3177086..3178640;16s;;
;;;;
comp;3194455..3194527;gcc;;
;;;;
comp;3545889..3545964;cgg;;
;;;;
comp;4154787..4154859;ttc;;35
comp;4154895..4154971;gac;;81
comp;4155053..4155124;gaa;;9
comp;4155134..4155209;aaa;;

bsu blocs[modifier | modifier le wikicode]

bsu blocs;;;;;;;;;
Types;;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2;II3
16s;167;167;164;164;;16s;164;164;164
23s;111;55;55;55;;23s;55;55;55
5s;9;20;46;20;;5s;;;
;5;32;4;4;;;;;
;aac;gta;aac;gta;;;;;
;**15aas;**20aas;**5aas;** 8aas;;;;;
III;;;;;;IV;;;
16s;99;99;;;;cgt;13;;
atc;11;11;;;;gga;159;;
gca;81;81;;;;16s;167;;
23s;55;133;;;;23s;55;;
5s;;;;;;5s;13;;
;;;;;;atgf;60;;
;;;;;;gac;;;
Groupes;;;;;;;;;
;16s;164;;;;16s;164;;
I3;23s;55;;;I4;23s;55;;
;5s;46;;;;5s;20;;
;aac;4;;;;gta;4;;
;**4aas;8;;;;** 7aas;9;;
;gca;171;;;;gca;170;;
II1;16s;164;;;II3;16s;164;;
;23s;55;;;;23s;55;;
II2;5s;183;;;;5s;;;
;16s;164;;;;;;;
;23s;55;;;;;;;
;5s;;;;;;;;

bsu lmo[modifier | modifier le wikicode]

bsu-lmo  comparaison;;10.11.19 Tanger;;;comparaisons internes bsu, lmo;;;;
bsu;intercal;lmo;intercal;diff;bsu;intercal;bsu;intercal;diff
gaa;25;gaa;5;-20;16s;167;16s;167;
agc;3;agc;34;31;23s;55;23s;111;
aac;10;aac;6;-4;5s;20;5s;9;
atc;15;atc;25;10;gta;32;aac;5;
gga;10;gga;23;13;aca;37;tcc;34;
cac;17;cac;28;11;aaa;10;gaa;9;
ttc;12;ttc;4;-8;ctg;5;gta;9;
gac;11;gac;4;-7;ggc;14;atgf;11;0
atgf;17;atgf;42;25;tta;9;gac;12;0
tca;6;tca;22;16;cgt;15;ttc;5;
atgi;2;atgi;11;9;cca;5;aca;22;
atgj;19;atgj;42;23;gca;19;tac;5;
gca;5;gca;22;17;atgj;2;tgg;24;
cca;15;cca;10;-5;atgi;6;cac;9;
cgt;9;cgt;9;0;tca;17;caa;49;
tta;14;tta;14;0;atgf;11;ggc;5;
ggc;5;ggc;15;10;gac;12;tgc;7;
ctg;10;cta;5;-5;ttc;17;tta;265;
aaa;37;aaa;41;4;cac;10;ttg;;
aca;32;aca;8;-24;gga;15;;;
gta;20;gta;13;;atc;10;16s;164;
5s;55;5s;81;;aac;3;23s;55;
23s;167;23s;244;;agc;25;5s;20;
16s;;16s;;;gaa;;gta;4;-28
;;;;;;;aca;36;-1
16s;167;16s;127;;;;aaa;6;-4
23s;111;atc;46;;;;cta;40;35
5s;9;gca;172;;;;ggc;14;0
aac;5;23s;80;;;;tta;9;0
tcc;34;5s;14;;;;cgt;27;12
gaa;9;aac;6;1;;;cca;9;4
gta;9;tcc;33;-1;;;gca;170;
atgf;11;gaa;56;47;;;;;
gac;12;gta;21;12;lmo;intercal;lmo;intercal;diff
ttc;5;atgf;6;-5;16s;244;16s;127;
aca;22;gac;4;-8;23s;81;atc;46;
tac;5;ttc;20;;5s;13;gca;172;
tgg;24;tac;7;2;gta;8;23s;80;
cac;9;tgg;15;-9;aca;41;5s;14;
caa;49;cac;29;20;aaa;5;aac;6;
ggc;5;caa;5;-44;cta;15;tcc;33;
tgc;7;ggc;19;14;ggc;14;gaa;56;
tta;265;tgc;45;;tta;9;gta;21;
ttg;;ttg;;;cgt;10;atgf;6;2
;;;;;cca;22;gac;4;0
16s;164;16s;244;;gca;42;ttc;20;
23s;55;23s;80;;atgj;11;tac;7;
5s;20;5s;13;;atgi;22;tgg;15;
gta;4;gta;8;4;tca;42;cac;29;
aca;36;aca;41;5;atgf;4;caa;5;
aaa;6;aaa;5;-1;gac;4;ggc;19;
cta;40;cta;14;-26;ttc;28;tgc;45;
ggc;14;ggc;21;7;cac;23;ttg;;
tta;9;tta;12;3;gga;25;;;
cgt;27;cgt;10;-17;atc;6;16s;244;
cca;9;cca;19;10;aac;34;23s;80;
gca;170;gca;341;;agc;5;5s;13;
;;;;;gaa;;gta;8;0
;;;;;;;aca;41;0
;;;;;;;aaa;5;0
;;;;;;;cta;14;-1
;;;;;;;ggc;21;7
;;;;;;;tta;12;3
;;;;;;;cgt;10;0
;;;;;;;cca;19;-3
;;;;;;;gca;341;
;;;;;;;;;
bsu;intercal;lmo;intercal;diff;entre génomes;;;intra génome;
gaa;3;gaa;157;;gamme;fréquence;;gamme;fréquence
gta;4;acg;9;;-15;5;;-7;1
aca;22;tac;11;;-14;;;-6;
tac;4;caa;6;;-13;;;-5;
caa;;aaa;;;-12;;;-4;1
;;;;;-11;;;-3;1
aga;;aga;;;-10;;;-2;
;;;;;-9;1;;-1;2
cgg;;cgg;;;-8;2;;0;9
;;;;;-7;1;;1;
gga;;gga;;;-6;;;2;1
;;;;;-5;3;;3;1
gtc;;gtc;;;-4;1;;4;1
;;;;;-3;;;5;
agg;;cgt;;;-2;;;6;
;;;;;-1;2;;7;1
caa;;ctc;;;0;2;;;2
;;;;;1;1;;total;20
gcc;;tcg;;;2;1;; -2+2;11
;;;;;3;1;;;
tca;;;;;4;2;;;
;;;;;5;1;;;
atg;9;aac;3;;6;;;;
gaa;;agc;;;7;1;;;
;;;;;8;;;;
;;gaa;27;;9;1;;;
;;gac;;;10;3;;;
;;;;;11;1;;;
cgt;13;16s;127;;12;1;;;
gga;159;atc;46;;13;1;;;
16s;167;gca;172;;14;1;;;
23s;55;23s;80;;15;;;;
5s;13;5s;14;;;7;;;
atgf;60;aac;24;;total;39;;;
gac;;acc;;; -2+2;6;;;

Listeria monocytogenes[modifier | modifier le wikicode]

lmo[modifier | modifier le wikicode]

  • Lien tableau: lmo
Listeria monocytogenes EGD-e;;;;
37.9%GC;7.3.19 Paris;67;doubles;intercal
;82705..82777;aag;;
;237466..239020;16s;@1;244
;239265..242195;23s;;80
;242276..242385;5s;;13
;242399..242471;gta;;8
;242480..242555;aca;;41
;242597..242669;aaa;;5
;242675..242756;cta;;14
;242771..242842;ggc;;21
;242864..242949;tta;;12
;242962..243035;cgt;;10
;243046..243119;cca;;19
;243139..243214;gca;;341
;243556..245041;16s;;244
;245286..248216;23s;;80
;248297..248406;5s;;
;;;;
;677464..677553;tcg;;
;;;;
;936656..936728;aac;;3
;936732..936819;agc;;
;;;;
;940017..940088;gaa;;27
;940116..940188;gac;;
;;;;
;970867..970937;gga;;
;;;;
;1266675..1266748;aga;;
;;;;
comp;1740916..1740987;gaa;;5
comp;1740993..1741083;agc;;34
comp;1741118..1741190;aac;;6
comp;1741197..1741270;atc;;25
comp;1741296..1741366;gga;;23
comp;1741390..1741462;cac;;28
comp;1741491..1741563;ttc;;4
comp;1741568..1741643;gac;;4
comp;1741648..1741721;atgf;;42
comp;1741764..1741853;tca;;22
comp;1741876..1741949;atgi;;11
comp;1741961..1742034;atgj;;42
comp;1742077..1742149;gca;;22
comp;1742172..1742245;cca;;10
comp;1742256..1742329;cgt;;9
comp;1742339..1742424;tta;;14
comp;1742439..1742513;ggc;;15
comp;1742529..1742610;cta;;5
comp;1742616..1742688;aaa;;41
comp;1742730..1742805;aca;;8
comp;1742814..1742886;gta;;13
comp;1742900..1743009;5s;;81
comp;1743091..1746021;23s;;244
comp;1746266..1747811;16s;;
;;;;
;1776112..1776183;cgt;;
;;;;
comp;1848821..1848930;5s;;81
comp;1849012..1851942;23s;;244
comp;1852187..1853732;16s;;
;;;;
;2162187..2162273;ctc;;
;;;;
;2215375..2215446;gaa;;157
;2215604..2215677;acg;;9
;2215687..2215770;tac;;11
;2215782..2215856;caa;;6
;2215863..2215935;aaa;;
;;;;
comp;2436493..2436576;ttg;;45
comp;2436622..2436695;tgc;;19
comp;2436715..2436786;ggc;;5
comp;2436792..2436863;caa;;29
comp;2436893..2436965;cac;;15
comp;2436981..2437054;tgg;;7
comp;2437062..2437145;tac;;20
comp;2437166..2437238;ttc;;4
comp;2437243..2437318;gac;;6
comp;2437325..2437398;atgf;;21
comp;2437420..2437495;gta;;56
comp;2437552..2437623;gaa;;33
comp;2437657..2437745;tcc;;6
comp;2437752..2437827;aac;;14
comp;2437842..2437951;5s;;80
comp;2438032..2440962;23s;;172
comp;2441135..2441210;gca;;46
comp;2441257..2441330;atc;;127
comp;2441458..2443003;16s;@2;
;;;;
comp;2540230..2540301;cgg;;
;;;;
comp;2672664..2672736;acc;;24
comp;2672761..2672836;aac;;14
comp;2672851..2672960;5s;;80
comp;2673041..2675971;23s;;172
comp;2676144..2676219;gca;;46
comp;2676266..2676339;atc;;127
comp;2676467..2678012;16s;;
;;;;
;2930362..2930434;gtc;;

lmo bocs[modifier | modifier le wikicode]

lmo blocs;;;;;;;;
Types;;;;;;;;
I;I1;I2;I3;I4;;II;II1;II2
16s;;244;;244;;16s;244;244
23s;;81;;80;;23s;80;81
5s;;13;;13;;5s;;
;;8;;8;;;;
;;gta;;gta;;;;
;;**20aas;;**8aas;;;;
III;;;;;;IV;;
16s;127;127;;;;;;
atc;46;46;;;;;;
gca;172;172;;;;;;
23s;80;80;;;;;;
5s;14;14;;;;;;
;6;24;;;;;;
;aac;aac;;;;;;
;**13aas;acc;;;;;;
Groupes;;;;;;;;
;;;;;;16s;244;
;;;;;I4;23s;80;
;;;;;;5s;13;
;;;;;;gta;8;
;;;;;;**7aas;19;
;;;;;;gca;341;
;;;;;;16s;244;
;;;;;II1;23s;80;
;;;;;;5s;;

lam[modifier | modifier le wikicode]

  • Lien tableau: lam
;Lactobacillus amylovorus strain 30SC;;;
38%GC;30.6.19 Paris;63;doubles;intercal
;447399..448972;16s;@1;125
;449098..449172;atc;;52
;449225..449297;gca;;115
;449413..452324;23s;;68
;452393..452509;5s;;4
;452514..452586;gta;;2
;452589..452661;aaa;;13
;452675..452756;cta;;23
;452780..452852;aca;;10
;452863..452934;ggc;;11
;452946..453031;tta;;8
;453040..453113;cgt;;5
;453119..453192;cca;;29
;453222..453295;atg;;12
;453308..453381;atgi;;27
;453409..453482;atgf;;3
;453486..453559;gac;;6
;453566..453638;ttc;;19
;453658..453728;gga;;5
;453734..453808;atc;;2
;453811..453900;agc;;
;;;;
;57091..58664;16s;;125
;58790..58864;atc;;52
;58917..58989;gca;;115
;59105..62016;23s;;68
;62085..62201;5s;;13
;62215..62287;aac;;
;;;;
;469566..471139;16s;@2;9
;471149..471334;cds1; hp 186;-3
;471332..474243;23s;;68
;474312..474428;5s;;13
;474442..474514;aac;;
;;;;
comp;1709284..1709374;tcc;;10
comp;1709385..1709457;aac;;13
comp;1709471..1709587;5s;;68
comp;1709656..1712567;23s;;-3
comp;1712565..1712750;cds2;hp 186;9
comp;1712760..1714333;16s;;
;;;;
comp;79386..79458;aag;;
;;;;
comp;79913..79985;aag;;
;;;;
;193922..193994;acc;;
;;;;
comp;210866..210939;ggg;;
;;;;
;287678..287752;ggc;+;111
;287864..287938;ggc;3 ggc;109
;288048..288122;ggc;;35
;288158..288231;ccg;;
;;;;
;457611..457682;gaa;;35
;457718..457804;tca;;9
;457814..457887;atgf;;3
;457891..457964;gac;;6
;457971..458046;ttc;;4
;458051..458132;tac;;4
;458137..458207;tgg;;12
;458220..458295;cac;;4
;458300..458371;caa;;23
;458395..458465;tgc;;40
;458506..458590;ttg;;
;;;;
;474442..474514;aac;;
;;;;
;507688..507760;acg;;
;;;;
;526886..526957;caa;;
;;;;
;551550..551631;tac;;34
;551666..551737;caa;;
;;;;
;567329..567416;ctt;;
;;;;
;583327..583413;tca;;6
;583420..583493;gac;;7
;583501..583576;cac;;4
;583581..583653;gta;;
;;;;
;642034..642106;agg;;
;;;;
comp;729370..729441;cgg;;
;;;;
;784793..784864;gag;;
;;;;
;917887..917975;tcg;;
;;;;
;1456724..1456800;aga;;
;;;;
;1681218..1681301;ctg;;
;;;;
comp;1707998..1708070;gta;;5
comp;1708076..1708147;gaa;;
;;;;
;1987190..1987263;cgt;;8
;1987272..1987345;cca;;

lam blocs[modifier | modifier le wikicode]

lam blocs;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds1;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;4;117;aac;;
gta;;;;;
;;;;;
16s;125;1574;16s;9;1574
atc;52;;cds2;-3;62
gca;115;;23s;68;2912
23s;68;2912;5s;13;117
5s;13;117;aac;;
aac;;;;;

ppm[modifier | modifier le wikicode]

opérons[modifier | modifier le wikicode]

ppm chromosome[modifier | modifier le wikicode]
45.5%GC;26.7.19 Paris;16s 13;110;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Paenibacillus polymyxa SC2;;;;;;;;;;
;10545..11633;;CDS;;327;327;;;363;
;11961..13519;;16s;;280;;;;;
;13800..16728;;23s;;143;;;;;
;16872..16988;;5s;;232;232;;;;232
;17221..17640;;CDS;;93 855;;;;140;
;;;;;;;;;;
comp;111496..112530;;CDS;;616;;;;345;
;113147..114705;;16s;;207;;;;;
;114913..117843;;23s;;76;;;;;
;117920..118036;;5s;;343;343;;;;
;118380..119837;;CDS;;3 348;;;;486;
;;;;;;;;;;
;123186..124469;;CDS;;90;90;;;428;90
;124560..124648;;tca;;145;145;;;;
;124794..125135;;CDS;;55 592;;;;114;
;;;;;;;;;;
;180728..181003;;CDS;;412;;;;92;
;181416..182974;;16s;;108;;;;;
;183083..183199;;5s;@1;39;;;;;
;183239..183315;;atc;;20;;;20;;
;183336..183411;;gca;;128;;;;;
;183540..186468;;23s;;130;;;;;
;186599..186690;;agc;;28;;;28;;
;186719..186795;;atgj;;10;;;10;;
;186806..186881;;gta;;4;;;4;;
;186886..186961;;aca;;19;;;19;;
;186981..187057;;gac;;77;;;77;;
;187135..187210;;ttc;;6;;;6;;
;187217..187302;;tac;;7;;;7;;
;187310..187385;;aaa;;154;154;;;;154
;187540..188682;;CDS;;24 062;;;;381;
;;;;;;;;;;
comp;212745..213341;;CDS;;211;211;;;199;211
comp;213553..213624;;cgg;;259;259;;;;
;213884..214921;;CDS;;238 832;;;;346;
;;;;;;;;;;
;453754..455364;;CDS;;392;;;;537;
;455757..457315;;16s;;207;;;;;
;457523..460453;;23s;;76;;;;;
;460530..460646;;5s;;34;;;;;
;460681..460757;;atc;;22;;;22;;
;460780..460855;;gca;;4;;;4;;
;460860..460935;;aac;;34;;;34;;
;460970..461043;;atgj;;3;;;3;;
;461047..461138;;agc;;31;;;31;;
;461170..461241;;gaa;;6;;;6;;
;461248..461323;;gta;;10;;;10;;
;461334..461407;;atgf;;25;;;25;;
;461433..461509;;gac;;50;;;50;;
;461560..461635;;ttc;;22;;;22;;
;461658..461733;;aca;;5;;;5;;
;461739..461824;;tac;;16;;;16;;
;461841..461913;;cac;;18;;;18;;
;461932..462006;;caa;;4;;;4;;
;462011..462086;;aaa;;15;;;15;;
;462102..462189;;ctg;;6;;;6;;
;462196..462270;;ggc;;10;;;10;;
;462281..462351;;tgc;;26;;;26;;
;462378..462454;;cgt;;22;;;22;;
;462477..462550;;cca;;9;;;9;;
;462560..462630;;gga;;204;204;;;;204
comp;462835..463938;;CDS;;1 537;;;;368;
;;;;;;;;;;
;465476..466216;;CDS;;524;;;;247;
;466741..468299;;16s;;207;;;;;
;468507..471434;;23s;;76;;;;;
;471511..471627;;5s;;629;;;;;
;472257..473588;;CDS;;103 459;;;;444;
;;;;;;;;;;
;577048..577794;;CDS;;1 116;;;;249;
;578911..580469;;16s;;207;;;;;
;580677..583607;;23s;;76;;;;;
;583684..583800;;5s;;82;;;;;
;583883..583958;;gca;;4;;;4;;
;583963..584038;;aac;;3;;;3;;
;584042..584133;;tcc;;19;;;19;;
;584153..584224;;gaa;;9;;;9;;
;584234..584309;;gta;;29;;;29;;
;584339..584412;;atgf;;25;;;25;;
;584438..584514;;gac;;13;;;13;;
;584528..584603;;aca;;4;;;4;;
;584608..584693;;tac;;102;;;102;;
;584796..584870;;caa;;4;;;4;;
;584875..584950;;aaa;;12;;;12;;
;584963..585043;;cta;;10;;;10;;
;585054..585128;;ggc;;5;;;5;;
;585134..585210;;cgt;;12;;;12;;
;585223..585302;;ttg;;7;;;7;;
;585310..585386;;cca;;7;;;7;;
;585394..585464;;gga;;1 133;;;;;
;586598..587560;;CDS;;22 016;;;;321;
;;;;;;;;;;
;609577..609924;;CDS;;73;73;;;116;73
;609998..610069;;acg;;1 613;;;;;
comp;611683..612030;;CDS;;140 810;;;;116;
;;;;;;;;;;
;752841..754124;;CDS;;611;;;;428;
;754736..756294;;16s;;208;;;;;
;756503..759431;;23s;;75;;;;;
;759507..759623;;5s;;183;183;;;;183
comp;759807..760232;;CDS;;173 078;;;;142;
;;;;;;;;;;
;933311..934681;;CDS;;449;;;;457;
;935131..936689;;16s;;221;;;;;
;936911..939839;;23s;;76;;;;;
;939916..940032;;5s;;216;216;;;;216
;940249..941241;;CDS;;521 183;;;;331;
;;;;;;;;;;
;1462425..1462937;;CDS;;44;44;;;171;44
;1462982..1463057;;aac;;1;;1;;;
;1463059..1463147;;agc;;122;122;;;;
comp;1463270..1464145;;CDS;;74;;;;292;
;;;;;;;;;;
comp;1464220..1464981;;CDS;;246;246;;;254;
;1465228..1465299;;gaa;;86;;86;;;
;1465386..1465461;;aaa;;15;;15;;;
;1465477..1465562;;ctc;;162;162;;;;162
;1465725..1466180;;CDS;;1 667;;;;152;
;;;;;;;;;;
comp;1467848..1468585;;CDS;;262;262;;;246;
;1468848..1468930;;ctc;;148;148;;;;148
comp;1469079..1469564;;CDS;;112 990;;;;162;
;;;;;;;;;;
;1582555..1583361;;CDS;;490;;;;269;
;1583852..1583925;;ccc;;244;244;;;;
comp;1584170..1585441;;CDS;;32 099;;;;424;
;;;;;;;;;;
;1617541..1619682;;CDS;;107;107;;;714;107
;1619790..1619860;;gga;;265;265;;;;
;1620126..1621163;;CDS;;254 529;;;;346;
;;;;;;;;;;
;1875693..1876160;;CDS;;129;129;;;156;129
;1876290..1876365;;gcc;;11;;11;;;
;1876377..1876449;;aag;;520;;;;;
comp;1876970..1877974;;CDS;;55 215;;;;335;
;;;;;;;;;;
comp;1933190..1933630;;CDS;;381;;;;147;
;1934012..1934096;;ctg;;91;91;;;;91
comp;1934188..1934718;;CDS;;74 847;;;;177;
;;;;;;;;;;
comp;2009566..2010102;;CDS;;222;222;;;179;
;2010325..2010409;;ctg;;213;213;;;;
;2010623..2011135;;CDS;;432 608;;;;171;
;;;;;;;;;;
;2443744..2448333;;CDS;;540;;;;1530;
;2448874..2450432;;16s;;400;;;;;
;2450833..2453761;;23s;;143;;;;;
;2453905..2454021;;5s;;236;236;;;;236
comp;2454258..2455367;;CDS;;186 804;;;;370;
;;;;;;;;;;
;2642172..2643329;;CDS;;426;;;;386;
;2643756..2645314;;16s;;343;;;;;
;2645658..2648586;;23s;;144;;;;;
;2648731..2648847;;5s;;156;156;;;;156
;2649004..2649228;;CDS;;884 577;;;;75;
;;;;;;;;;;
comp;3533806..3534249;;CDS;;139;139;;;148;139
;3534389..3534460;;gtc;;279;279;;;;
comp;3534740..3535069;;CDS;;103 837;;;;110;
;;;;;;;;;;
;3638907..3639338;;CDS;;728;;;;144;
comp;3640067..3640152;;tta;;249;249;;;;249
;3640402..3640560;;CDS;;28 092;;;;53;
;;;;;;;;;;
;3668653..3669450;;CDS;;247;247;;;266;
comp;3669698..3669766;;atg;;267;267;;;;
comp;3670034..3670234;;CDS;;54 456;;;;67;
;;;;;;;;;;
;3724691..3725086;;CDS;;122;122;;;132;122
comp;3725209..3725282;;atgi;;435;;;;;
comp;3725718..3726359;;CDS;;612 148;;;;214;
;;;;;;;;;;
comp;4338508..4339209;;CDS;;107;107;;;234;107
comp;4339317..4339390;;cca;;7;;;7;;
comp;4339398..4339477;;ttg;;12;;;12;;
comp;4339490..4339566;;cgt;;5;;;5;;
comp;4339572..4339646;;ggc;;35;;;35;;
comp;4339682..4339757;;aaa;;28;;;28;;
comp;4339786..4339862;;gac;;26;;;26;;
comp;4339889..4339965;;atgf;;30;;;30;;
comp;4339996..4340071;;gta;;9;;;9;;
comp;4340081..4340152;;gaa;;17;;;17;;
comp;4340170..4340261;;tcc;;3;;;3;;
comp;4340265..4340340;;aac;;18;;;;;
comp;4340359..4340475;;5s;;76;;;;;
comp;4340552..4343482;;23s;;400;;;;;
comp;4343883..4345441;;16s;;493;;;;;
comp;4345935..4347563;;CDS;;46 596;;;;543;
;;;;;;;;;;
comp;4394160..4395092;;CDS;;238;238;;;311;
;4395331..4395404;;aga;;214;214;;;;
;4395619..4396383;;CDS;;49 894;;;;255;
;;;;;;;;;;
;4446278..4447621;;CDS;;207;207;;;448;
comp;4447829..4447902;;aga;;174;174;;;;
;4448077..4448370;;CDS;;256 556;;;;98;
;;;;;;;;;;
;4704927..4705187;;CDS;;361;;;;87;
comp;4705549..4705627;;ttg;;11;;11;;;
comp;4705639..4705713;;tgc;;11;;11;;;
comp;4705725..4705796;;ggc;;6;;6;;;
comp;4705803..4705877;;caa;;9;;9;;;
comp;4705887..4705959;;cac;;17;;17;;;
comp;4705977..4706050;;tgg;;7;;7;;;
comp;4706058..4706143;;tac;;4;;4;;;
comp;4706148..4706223;;aca;;22;;22;;;
comp;4706246..4706318;;ttc;;35;;35;;;
comp;4706354..4706430;;gac;;15;;15;;;
comp;4706446..4706522;;atgf;;25;;25;;;
comp;4706548..4706623;;gta;;58;;58;;;
comp;4706682..4706753;;gaa;;17;;17;;;
comp;4706771..4706862;;tcc;;3;;3;;;
comp;4706866..4706941;;aac;;326;326;;;;
comp;4707268..4707597;;CDS;;279 544;;;;110;
;;;;;;;;;;
comp;4987142..4989934;;CDS;;726;;;;931;
comp;4990661..4990731;;gga;;9;;;9;;
comp;4990741..4990814;;cca;;22;;;22;;
comp;4990837..4990913;;cgt;;5;;;5;;
comp;4990919..4990993;;ggc;;10;;;10;;
comp;4991004..4991084;;cta;;11;;;11;;
comp;4991096..4991171;;aaa;;4;;;4;;
comp;4991176..4991250;;caa;;55;;;55;;
comp;4991306..4991381;;gta;;11;;;11;;
comp;4991393..4991464;;gaa;;11;;;11;;
comp;4991476..4991548;;acc;;3;;;3;;
comp;4991552..4991627;;aac;;18;;;;;
comp;4991646..4991762;;5s;;76;;;;;
comp;4991839..4994768;;23s;;129;;;;;
comp;4994898..4994973;;gca;;20;;;20;;
comp;4994994..4995070;;atc;;38;;;;;
comp;4995109..4995225;;5s;;93;;;;;
comp;4995319..4996877;;16s;;367;;;;;
comp;4997245..4997475;;CDS;;60 140;;;;77;
;;;;;;;;;;
comp;5057616..5058803;;CDS;;163;163;;;396;163
comp;5058967..5059083;;5s;;76;;;;;
comp;5059160..5062089;;23s;;185;;;;;
comp;5062275..5062350;;gca;;89;;;;;
comp;5062440..5063998;;16s;;380;;;;;
comp;5064379..5066394;;CDS;;647 899;;;;672;
;;;;;;;;;;
;5714294..5714611;;CDS;;206;206;;;106;
comp;5714818..5714908;;tcg;;77;77;;;;77
comp;5714986..5715210;;CDS;;;;;;75;
ppm plasmide[modifier | modifier le wikicode]
  • Plasmide
plasmide;pSC2;37.6%GC;51;;;;;;;
;;;;;;CDS;aa;avec aa;aas;CDS dirigé
;3920..4174;;CDS;;536;536;;;85;
;4711..4803;;agc;+;5;;5;;;
;4809..4883;;tgc;3 aac;63;;63;;;
;4947..5021;;gaa;2 atc;7;;7;;;
;5029..5105;;ctt;2 caa;6;;6;;;
;5112..5186;;cca;2 cca;101;;101;;;
;5288..5361;;tgg;2 cga;4;;4;;;
;5366..5444;;tac;2 gaa;4;;4;;;
;5449..5522;;caa;2 tac;6;;6;;;
;5529..5605;;cac;3 tgg;5;;5;;;
;5611..5686;;gac;;125;;125;;;
;5812..5887;;gga;;10;;10;;;
;5898..5973;;aac;@1;4;;4;;;
;5978..6066;;tac;ctt;9;;9;;;
;6076..6153;;ata;ata;4;;4;;;
;6158..6231;;caa;;4;;4;;;
;6236..6311;;atgi;;5;;5;;;
;6317..6392;;aac;;4;;4;;;
;6397..6470;;tgg;;131;;131;;;
;6602..6678;;gaa;;5;;5;;;
;6684..6757;;ggc;;55;;55;;;
;6813..6885;;ttc;;22;;22;;;
;6908..6983;;cga;;4;;4;;;
;6988..7065;;cca;;5;;5;;;
;7071..7155;;ttg;;5;;5;;;
;7161..7235;;atc;;5;;5;;;
;7241..7317;;atgf;;5;;5;;;
;7323..7398;;gca;;109;;109;;;
;7508..7584;;cga;;3;;3;;;
;7588..7668;;cta;;13;;13;;;
;7682..7758;;atc;;8;;8;;;
;7767..7841;;aac;;4;;4;;;
;7846..7919;;tgg;;33;33;;;;33
;7953..8324;;CDS;@4;-24;-24;;;124;
;8301..8378;;gac;;8;;8;;;
;8387..8473;;tac;;86;;86;;;
;8560..8632;;aaa;;14;;14;;;
;8647..8720;;gga;;4;;4;;;
;8725..8800;;ttc;;7;;7;;;
;8808..8882;;acg;@2;100;100;;;;
comp;8983..9600;;CDS;acg;89;89;;;206;
;9690..9771;;tta;;3;;3;;;
;9775..9849;;aca;;35;35;;;;35
comp;9885..10169;;CDS;;150;;;;95;
;;;;;;;;;;
comp;10320..10622;;CDS;;116;116;;;101;
;10739..10813;;aca;;18;18;;;;18
comp;10832..11146;;CDS;;216;;;;105;
;;;;;;;;;;
comp;11363..11599;;CDS;;94;94;;;79;94
;11694..11768;;aga;;103;103;;;;
;11872..12312;;CDS;;195;;;;147;
;;;;;;;;;;
comp;12508..12756;;CDS;;293;293;;;83;
;13050..13126;;atc;;72;72;;;;72
;13199..14083;;CDS;;226;226;;;295;
;;;;;;;;;;
;14310..14385;;tcg;+;8;;8;;;
;14394..14481;;tcc;2 tcg;7;;7;;;
;14489..14563;;ctt;@3;3;;3;;;
;14567..14654;;tcg;tcg;5;;5;;;
;14660..14751;;tca;ctt;119;119;;;;119
;14871..15080;;CDS;;212044;;;;70;
;;;;;;;;;;
comp;227125..227388;;CDS;;444;444;;;88;
comp;227833..227903;;gga;;248;248;;;;248
comp;228152..228391;;CDS;;1401;;;;80;
;;;;;;;;;;
comp;229793..229999;;CDS;;24;24;;;69;24
comp;230024..230108;;tca;;289;289;;;;
comp;230398..230640;;CDS;;231;;;;81;
;;;;;;;;;;
comp;230872..231393;;CDS;;161;161;;;174;161
comp;231555..231640;;tta;;977;977;;;;
;232618..233067;;CDS;;277050;;;;150;
;510118..1;;;;;;;;;
ppm plasmide MAJ[modifier | modifier le wikicode]
plasmide;;Paenibacillus polymyxa SC2 MAJ;;;plasmide;;Paenibacillus polymyxa SC2;;;
23.10.19 Tanger;;;;;;26.7.19 Paris;;;;
;;49 aas;doubles;intercalaires;;;;51 aas;doubles;intercalaires
3920..4174;;cds hp;;;;3920..4174;;CDS;;536
4711..4803;;agc;+;;;4711..4803;;agc;+;5
4809..4883;;tgc;3 aac;;;4809..4883;;tgc;3 aac;63
4947..5021;;gaa;2 atc;;;4947..5021;;gaa;2 atc;7
5029..5105;;ctt;2 cca;;;5029..5105;;ctt;2 caa;6
5112..5186;;cca;2 cga;;;5112..5186;;cca;2 cca;101
5288..5361;;tgg;2 gaa;;;5288..5361;;tgg;2 cga;4
5366..5441;;tat;3 tgg;7;;5366..5444;;tac;2 gaa;4
5449..5522;;caa;;;;5449..5522;;caa;2 tac;6
5529..5605;;cac;;;;5529..5605;;cac;3 tgg;5
5611..5686;;gac;;;;5611..5686;;gac;;125
5812..5887;;gga;;;;5812..5887;;gga;;10
5898..5973;;aac;@1;;;5898..5973;;aac;@1;4
5978..6066;;tac;ctt;;;5978..6066;;tac;ctt;9
6076..6153;;ata;ata;82;;6076..6153;;ata;ata;4
;;****;tat;;;6158..6231;;caa;;4
6236..6311;;atgi;;;;6236..6311;;atgi;;5
6317..6392;;aac;;;;6317..6392;;aac;;4
6397..6470;;tgg;;;;6397..6470;;tgg;;131
6602..6678;;gaa;;;;6602..6678;;gaa;;5
6684..6757;;ggc;;;;6684..6757;;ggc;;55
6813..6885;;ttc;;;;6813..6885;;ttc;;22
6908..6980;;cga;;7;;6908..6983;;cga;;4
6988..7065;;cca;;;;6988..7065;;cca;;5
7071..7155;;ttg;;;;7071..7155;;ttg;;5
7161..7235;;atc;;4;;7161..7235;;atc;;5
7240..7317;;atgf;;;;7241..7317;;atgf;;5
7323..7398;;gca;;;;7323..7398;;gca;;109
7508..7584;;cga;;;;7508..7584;;cga;;3
7588..7668;;cta;;;;7588..7668;;cta;;13
7682..7758;;atc;;;;7682..7758;;atc;;8
7767..7841;;aac;;;;7767..7841;;aac;;4
7846..7919;;tgg;;;;7846..7919;;tgg;;33
7953..8324;;cds hp;;;;7953..8324;;CDS;@4;-24
8301..8378;;gac;;;;8301..8378;;gac;;8
8387..8473;;tac;;;;8387..8473;;tac;;86
8560..8632;;aaa;;;;8560..8632;;aaa;;14
8647..8720;;gga;;;;8647..8720;;gga;;4
8725..8800;;ttc;;;;8725..8800;;ttc;;7
8808..8882;;acg;@2;;;8808..8882;;acg;@2;100
8983..9600;;cds hp;acg;;comp;8983..9600;;CDS;acg;89
9690..9771;;tta;;;;9690..9771;;tta;;3
9775..9849;;aca;;;;9775..9849;;aca;;35
9885..10169;;cds hp;;;comp;9885..10169;;CDS;;150
;;;;;;;;;;
10320..10622;;cds hp;;;comp;10320..10622;;CDS;;116
10739..10813;;aca;;;;10739..10813;;aca;;18
10832..11146;;cds hp;;;comp;10832..11146;;CDS;;216
;;;;;;;;;;
11363..11599;;cds hp;;;comp;11363..11599;;CDS;;94
11694..11765;;aga;;85;;11694..11768;;aga;;103
11851..12312;;cds rev-trans;;;;11872..12312;;CDS;;195
;;;;;;;;;;
12508..12756;;cds trans-rg;;442;comp;12508..12756;;CDS;;293
****;;****;;;;13050..13126;;atc;;72
13199..14083;;cds hp;;;;13199..14083;;CDS;;226
;;;;;;;;;;
14310..14385;;tcg;+;;;14310..14385;;tcg;+;8
14394..14481;;tcc;2 tcg;;;14394..14481;;tcc;2 tcg;7
14489..14560;;ctt;@3;6;;14489..14563;;ctt;@3;3
14567..14654;;tcg;tcg;;;14567..14654;;tcg;tcg;5
14660..14751;;tca;ctt;;;14660..14751;;tca;ctt;119
14871..15080;;cds hp;;;;14871..15080;;CDS;;212044
;;;;;;;;;;
227125..227388;;cds hp;;;comp;227125..227388;;CDS;;444
227833..227903;;gga;;;comp;227833..227903;;gga;;248
228152..228391;;cds hp;;;comp;228152..228391;;CDS;;1401
;;;;;;;;;;
229793..229999;;cds hp;;;comp;229793..229999;;CDS;;24
230024..230108;;tca;;783;comp;230024..230108;;tca;;289
****;;****;;;comp;230398..230640;;CDS;;231
;;;;;;;;;;
230872..231393;;;cds hp;;comp;230872..231393;;CDS;;161
231558..231640;;tta;;;comp;231555..231640;;tta;;977
232618..233067;;cds hp;;;;232618..233067;;CDS;;277050
510118..1;;;;;;510118..1;;;;

ppm cumuls[modifier | modifier le wikicode]

Paenibacillus polymyxa SC2;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;13;1;1;0;1;0;100;8;5;40;0
;16 23 5s 0;7;20;12;46;50;1;200;20;17;60;1
;16 5 atc gca;2;40;3;15;100;4;300;10;6;80;2
;16 23 5s a;3;60;1;2;150;8;400;13;9;100;2
;max a;21;80;0;1;200;6;500;7;4;120;2
;a doubles;0;100;1;0;250;15;600;2;0;140;3
;16 gca 23 5s ;1;120;0;1;300;5;700;1;0;160;3
;total aas;73;140;0;0;350;3;800;1;1;180;2
sans ;opérons;19;160;0;0;400;5;900;0;0;200;1
;1 aa;15;180;0;0;450;4;1000;1;0;220;3
;max a;15;200;0;0;500;2;1100;0;0;240;2
;a doubles;0;;0;0;;11;;1;0;;1
;total aas;37;;18;65;;64;;64;42;;22
total aas;;110;moyenne;20;17;;193;;292;229;;150
remarques;;1;variance;21;17;;73;;234;123;;58
jaune;;;;;;;sans;;;sans;;
  • Plasmide
Paenibacillus polymyxa SC2;;;;;;;;;;;;
plasmide;;;;;;;;;;;;
;Opérons;;Fréquences intercalaires;;;;;Fréquences cds;;;;
;;effectifs;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsa;cdsj;gammes;cdsd
avec rRNA;opérons;0;1;0;;1;1;60;0;;40;4
;16 23 5s 0;;20;33;;50;4;80;4;;60;0
;16 5 atc gca;;40;1;;100;4;100;5;;80;1
;16 23 5s a;;60;1;;150;3;120;2;;100;1
;max a;;80;1;;200;1;140;1;;120;1
;a doubles;;100;1;;250;2;160;2;;140;0
;16 gca 23 5s ;;120;2;;300;2;180;1;;160;0
;total aas;;140;2;;350;0;200;0;;180;1
sans ;opérons;10;160;0;;400;0;220;1;;200;0
;1 aa;6;180;0;;450;1;240;0;;220;0
;max a;32;200;0;;500;0;260;0;;240;0
;a doubles;2;;0;;;2;;1;;;1
;total aas;51;;41;;;20;;17;;;9
total aas;;51;moyenne;6;;;126;;102;;;89
remarques;;3;variance;3;;;92;;32;;;77
;jaune;;;sans;;;sans;;sans;;;

ppm blocs[modifier | modifier le wikicode]

ppm blocs;;;;;;;
tRNAs;21;17;11;;;;
16s;207;207;400;;;;
23s;76;76;76;;;;
5s;34;82;18;;;;
;;;;;;;
tRNAs;13;_;_;10;;;
16s;93;_;16s;108;;16s;89
5s;38;;5s;39;;gca;185
atc;20;;atc;20;;23s;76
gca;129;;gca;128;;5s;
23s;76;;23s;130;;;
5s;18;;;;;;
;;;;;;;
16s;280;207;207;208;221;400;343
23s;143;76;76;75;76;143;144
5s;;;;;;;
;;;;;;;
5s;constant;39 aas;117 pbs;;;;

pmq[modifier | modifier le wikicode]

pmq opérons[modifier | modifier le wikicode]

58.3%GC;24.7.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paenibacillus mucilaginosus 3016;;;;;;;;;
;9206..10276;CDS;;322;322;;;357;
;10599..12139;16s;;269;;;;;
;12409..15343;23s;;95;;;;;
;15439..15555;5s;;178;178;;;;178
;15734..17190;CDS;;3061;;;;486;
;;;;;;;;;
;20252..21532;CDS;;47;47;;;427;47
;21580..21666;tca;;140;140;;;;
;21807..22157;CDS hp;@1;17;;;;117;
;22175..22357;CDS hp;;23;;;;*61;
;22381..22524;CDS hp;;86;;;;*48;
comp;22611..22796;CDS hp;;138;;;;*62;
comp;22935..25265;CDS replicase;;156;;;;*777;
;;;;;;;;;
;25422..26165;CDS;;220;220;;;248;
comp;26386..26460;cgg;;183;183;;;;183
;26644..27168;CDS;;151287;;;;175;
;;;;;;;;;
;178456..179454;CDS;;298;298;;;333;
;179753..181299;16s;;254;;;;;
;181554..184488;23s;;168;;;;;
;184657..184773;5s;;15;;;;;
;184789..184876;agc;;29;;;29;;
;184906..184982;atgj;;39;;;39;;
;185022..185097;gta;;15;;;15;;
;185113..185189;atgf;;14;;;14;;
;185204..185280;gac;;48;;;48;;
;185329..185404;ttc;;5;;;5;;
;185410..185485;aca;;9;;;9;;
;185495..185579;tac;;15;;;15;;
;185595..185670;aaa;;183;183;;;;183
comp;185854..187104;CDS;;30460;;;;417;
;;;;;;;;;
comp;217565..218146;CDS;;129;129;;;194;129
comp;218276..218350;cgg;;261;261;;;;
;218612..219643;CDS;;34238;;;;344;
;;;;;;;;;
;253882..254526;CDS;;677;*677;;;215;
;255204..256745;16s;;268;;;;;
;257014..259948;23s;;95;;;;;
;260044..260160;5s;;55;;;;;
;260216..260292;atc;;19;;;19;;
;260312..260387;gca;+;16;;;16;;
;260404..260475;gaa;2 gca;9;;;9;;
;260485..260569;tac;;20;;;20;;
;260590..260665;aac;;3;;;3;;
;260669..260744;gta;;19;;;19;;
;260764..260840;gac;;20;;;20;;
;260861..260933;ttc;;15;;;15;;
;260949..261021;aaa;;10;;;10;;
;261032..261118;ctg;;3;;;3;;
;261122..261196;ggc;;12;;;12;;
;261209..261280;tgc;;15;;;15;;
;261296..261369;cgt;;5;;;5;;
;261375..261448;cca;;158;;;*158;;
;261607..261682;gca;;4;;;4;;
;261687..261759;acc;;5;;;5;;
;261765..261854;tcg;;19;;;19;;
;261874..261961;agc;;17;;;17;;
;261979..262054;gtc;;5;;;5;;
;262060..262134;acg;;39;;;39;;
;262174..262262;tcc;;41;;;41;;
;262304..262386;ctc;;283;283;;;;*283
;262670..263515;CDS;;314679;;;;282;
;;;;;;;;;
;578195..579055;CDS;;324;324;;;287;
;579380..580921;16s;;258;;;;;
;581180..584114;23s;;166;;;;;
;584281..584397;5s;;31;;;;;
;584429..584505;aac;;6;;;6;;
;584512..584600;tcc;;38;;;38;;
;584639..584710;gaa;;11;;;11;;
;584722..584797;gta;;17;;;17;;
;584815..584891;atgf;;15;;;15;;
;584907..584983;gac;;67;;;67;;
;585051..585125;acg;;11;;;11;;
;585137..585212;cac;;10;;;10;;
;585223..585297;caa;;5;;;5;;
;585303..585378;aaa;;17;;;17;;
;585396..585470;ggc;+;40;;;40;;
;585511..585585;ggc;2 ggc;24;;;24;;
;585610..585692;ttg;;5;;;5;;
;585698..585774;cca;;19;;;19;;
;585794..585867;gga;;1;;;1;;
;585869..585942;aga;;187;187;;;;187
;586130..586885;CDS;;85587;;;;252;
;;;;;;;;;
;672473..672949;CDS;;18;18;;;159;18
;672968..673043;aac;;7;;7;;;
;673051..673138;agc;@2;297;;297;;;
;673436..673507;gaa;;9;;9;;;
;673517..673599;ctc;;180;180;;;;
;673780..674199;CDS;;182;;;;140;
;;;;;;;;;
;674382..675278;CDS;;159;159;;;299;
;675438..675520;ctc;;64;64;;;;64
;675585..675833;CDS;;18450;;;;83;
;;;;;;;;;
;694284..695636;CDS;;797;*797;;;451;
;696434..697974;16s;;261;;;;;
;698236..701170;23s;;94;;;;;
;701265..701381;5s;;43;;;;;
;701425..701498;atc;;11;;;11;;
;701510..701584;gaa;;5;;;5;;
;701590..701665;gtc;;5;;;5;;
;701671..701747;atgf;;4;;;4;;
;701752..701825;tgg;;9;;;9;;
;701835..701909;caa;;8;;;8;;
;701918..701990;aaa;;18;;;18;;
;702009..702095;ctg;;4;;;4;;
;702100..702174;ggc;;11;;;11;;
;702186..702259;cgt;;12;;;12;;
;702272..702348;cca;;577;*577;;;;*577
;702926..703120;CDS;;370320;;;;65;
;;;;;;;;;
;1073441..1074214;CDS;;373;373;;;258;
;1074588..1076136;16s;;260;;;;;
;1076397..1079331;23s;;168;;;;;
;1079500..1079616;5s;;9;;;;;
;1079626..1079701;aac;;6;;;6;;
;1079708..1079796;tcc;;38;;;38;;
;1079835..1079906;gaa;;11;;;11;;
;1079918..1079993;gta;;17;;;17;;
;1080011..1080087;atgf;;13;;;13;;
;1080101..1080177;gac;;49;;;49;;
;1080227..1080302;ttc;;4;;;4;;
;1080307..1080382;aca;;13;;;13;;
;1080396..1080481;tac;;8;;;8;;
;1080490..1080560;tgg;;13;;;13;;
;1080574..1080649;cac;;26;;;26;;
;1080676..1080747;caa;;9;;;9;;
;1080757..1080831;ggc;;12;;;12;;
;1080844..1080917;tgc;;10;;;10;;
;1080928..1081016;tta;;20;;;20;;
;1081037..1081113;cgt;;3;;;3;;
;1081117..1081199;ttg;;147;147;;;;147
;1081347..1081973;CDS;;128630;;;;209;
;;;;;;;;;
;1210604..1213519;CDS;;354;354;;;972;
;1213874..1213949;gca;;16;;16;;;
;1213966..1214037;gaa;;12;;12;;;
;1214050..1214125;gta;;16;;16;;;
;1214142..1214218;gac;;17;;17;;;
;1214236..1214311;cac;;9;;9;;;
;1214321..1214395;caa;;9;;9;;;
;1214405..1214477;aaa;;8;;8;;;
;1214486..1214572;ctg;;3;;3;;;
;1214576..1214647;ggc;;169;169;;;;169
comp;1214817..1215602;CDS;;378784;;;;262;
;;;;;;;;;
;1594387..1594665;CDS;;537;*537;;;93;
;1595203..1596743;16s;;252;;;;;
;1596996..1599930;23s;;94;;;;;
;1600025..1600141;5s;;43;;;;;
;1600185..1600261;atc;;19;;;19;;
;1600281..1600356;gca;;17;;;17;;
;1600374..1600445;gaa;;8;;;8;;
;1600454..1600529;gta;+;5;;;5;;
;1600535..1600610;aca;2 gta;10;;;10;;
;1600621..1600705;tac;;18;;;18;;
;1600724..1600799;aac;;4;;;4;;
;1600804..1600879;gta;;21;;;21;;
;1600901..1600977;atgf;;12;;;12;;
;1600990..1601066;gac;;34;;;34;;
;1601101..1601176;cac;;13;;;13;;
;1601190..1601264;caa;;8;;;8;;
;1601273..1601345;aaa;;17;;;17;;
;1601363..1601448;ctc;;13;;;13;;
;1601462..1601548;ctg;;5;;;5;;
;1601554..1601628;ggc;;14;;;14;;
;1601643..1601713;tgc;;10;;;10;;
;1601724..1601797;cgt;;5;;;5;;
;1601803..1601876;cca;;105;105;;;;105
;1601982..1602245;CDS;;232535;;;;88;
;;;;;;;;;
;1834781..1835260;CDS;;106;106;;;160;106
;1835367..1835439;gcc;;137;137;;;;
comp;1835577..1835978;CDS;;371114;;;;134;
;;;;;;;;;
comp;2207093..2208091;CDS;;192;192;;;333;192
;2208284..2208367;ctg;+;49;;49;;;
;2208417..2208500;ctg;2 ctg;315;315;;;;
;2208816..2209952;CDS;;1246561;;;;379;
;;;;;;;;;
;3456514..3456786;CDS;;256;256;;;91;
;3457043..3457119;ccc;;142;142;;;;142
;3457262..3457483;CDS;;1547757;;;;74;
;;;;;;;;;
comp;5005241..5005426;CDS;;127;127;;;62;127
comp;5005554..5005636;ctc;;40;;40;;;
comp;5005677..5005765;tcc;;13;;13;;;
comp;5005779..5005852;atg;;19;;19;;;
comp;5005872..5005958;tcg;;167;167;;;;
;5006126..5006220;ncRNA;;1377035;;;;32;
;;;;;;;;;
comp;6383256..6384173;CDS;;228;228;;;306;
;6384402..6384477;gtc;;69;69;;;;69
comp;6384547..6385458;CDS;;5453;;;;304;
;;;;;;;;;
comp;6390912..6391130;CDS;;142;142;;;73;142
comp;6391273..6391358;tta;;7;;7;;;
comp;6391366..6391442;atgi;;19;;19;;;
comp;6391462..6391538;atgf;;370;370;;;;
comp;6391909..6392460;CDS;;962046;;;;184;
;;;;;;;;;
;7354507..7354737;CDS;;342;342;;;77;*342
comp;7355080..7355162;ctc;;28;;;28;;
comp;7355191..7355279;tcc;;12;;;12;;
comp;7355292..7355368;atgf;;14;;;14;;
comp;7355383..7355459;atgj;;14;;;14;;
comp;7355474..7355561;agc;;8;;;8;;
comp;7355570..7355659;tcg;;4;;;4;;
comp;7355664..7355736;acc;;4;;;4;;
comp;7355741..7355816;gca;;119;;;;;
;7355936..7356030;ncRNA;@3;36;;;;;
comp;7356067..7356140;cca;;6;;;6;;
comp;7356147..7356220;cgt;;104;;;*104;;
comp;7356325..7356396;ggc;;7;;;7;;
comp;7356404..7356490;ctg;;9;;;9;;
comp;7356500..7356572;aaa;;9;;;9;;
comp;7356582..7356656;caa;;9;;;9;;
comp;7356666..7356741;cac;;17;;;17;;
comp;7356759..7356835;gac;;12;;;12;;
comp;7356848..7356923;gta;;4;;;4;;
comp;7356928..7357003;aac;;15;;;15;;
comp;7357019..7357103;tac;;8;;;8;;
comp;7357112..7357187;aca;;5;;;5;;
comp;7357193..7357264;gaa;;15;;;15;;
comp;7357280..7357355;gcc;;9;;;9;;
comp;7357365..7357438;atc;;54;;;;;
comp;7357493..7357609;5s;;112;;;;;
comp;7357722..7360655;23s;;258;;;;;
comp;7360914..7362454;16s;;403;*403;;;;
;7362858..7363397;CDS;;254752;;;;180;
;;;;;;;;;
;7618150..7618842;CDS;;280;280;;;231;*280
comp;7619123..7619193;ggg;;335;335;;;;
;7619529..7620461;CDS;;46171;;;;311;
;;;;;;;;;
comp;7666633..7668069;CDS;;104;104;;;479;104
comp;7668174..7668244;ggg;;5;;;5;;
comp;7668250..7668326;cca;;106;;;*106;;
comp;7668433..7668506;cgt;;11;;;11;;
comp;7668518..7668592;ggc;;5;;;5;;
comp;7668598..7668684;ctg;;13;;;13;;
comp;7668698..7668783;ctc;;16;;;16;;
comp;7668800..7668872;aaa;;10;;;10;;
comp;7668883..7668967;tac;;28;;;28;;
comp;7668996..7669071;ttc;;12;;;;;
comp;7669084..7669200;5s;;159;;;;;
comp;7669360..7672297;23s;;256;;;;;
comp;7672554..7674095;16s;;537;*537;;;;
;7674633..7675382;CDS;;177794;;;;250;
;;;;;;;;;
comp;7853177..7853761;CDS;;57;57;;;195;57
comp;7853819..7853892;cac;;230;;230;;;
comp;7854123..7854196;cac;;404;*404;;;;
comp;7854601..7854801;CDS;;245639;;;;67;
;;;;;;;;;
comp;8100441..8100854;CDS;;123;123;;;138;123
comp;8100978..8101094;5s;;167;;;;;
comp;8101262..8104180;23s;;248;;;;;
comp;8104429..8105969;16s;;325;325;;;;
comp;8106295..8106636;CDS;;45281;;;;114;
;;;;;;;;;
comp;8151918..8152448;CDS;;460;*460;;;177;*460
comp;8152909..8153031;5s;;94;;;;;
comp;8153126..8156060;23s;;258;;;;;
comp;8156319..8157859;16s;;456;*456;;;;
;8158316..8158642;CDS;;98285;;;;109;
;;;;;;;;;
;8256928..8257746;CDS;;83;83;;;273;83
comp;8257830..8257903;gga;;5;;;5;;
comp;8257909..8257985;cca;;16;;;16;;
comp;8258002..8258078;cgt;;4;;;4;;
comp;8258083..8258157;ggc;;8;;;8;;
comp;8258166..8258248;cta;;42;;;42;;
comp;8258291..8258366;aaa;;8;;;8;;
comp;8258375..8258449;caa;;9;;;9;;
comp;8258459..8258532;tgg;;4;;;4;;
comp;8258537..8258613;atgf;;5;;;5;;
comp;8258619..8258694;gtc;;5;;;5;;
comp;8258700..8258774;gaa;;11;;;11;;
comp;8258786..8258859;atc;;43;;;;;
comp;8258903..8259019;5s;;94;;;;;
comp;8259114..8262048;23s;;255;;;;;
comp;8262304..8263845;16s;;306;306;;;;
comp;8264152..8264370;CDS;;58373;;;;73;
;;;;;;;;;
comp;8322744..8323205;CDS;;393;393;;;154;*393
comp;8323599..8323715;5s;;94;;;;;
comp;8323810..8326748;23s;;258;;;;;
comp;8327007..8328547;16s;;369;369;;;;
comp;8328917..8330413;CDS;;21505;;;;499;
;;;;;;;;;
comp;8351919..8354414;CDS;;396;396;;;832;
comp;8354811..8354884;atg;;149;149;;;;149
comp;8355034..8355537;CDS;;34450;;;;168;
;;;;;;;;;
;8389988..8390512;CDS;;296;296;;;175;*296
comp;8390809..8390925;5s;;94;;;;;
comp;8391020..8393954;23s;;259;;;;;
comp;8394214..8395754;16s;;234;234;;;;
comp;8395989..8396255;CDS;;220222;;;;89;
;;;;;;;;;
comp;8616478..8616924;CDS;;417;*417;;;149;
;8617342..8617418;gac;;157;157;;;;157
;8617576..8618541;CDS;;105821;;;;322;
;;;;;;;;;
;8724363..8724614;CDS;;455;*455;;;84;
comp;8725070..8725160;tcg;;165;165;;;;165
comp;8725326..8725559;CDS;;9205;;;;78;
;;opéron;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd

pmq cumuls[modifier | modifier le wikicode]

pmq;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cds dirigé;gammes;cdsa;cdsd
avec rRNA;opérons;14;1;0;1;1;0;1;0;100;15;8
;16 23 5s 0;5;20;14;107;50;3;20;1;200;18;10
;16 atc gca;0;40;1;12;100;4;40;0;300;12;6
;16 23 5s a;9;60;1;4;150;11;60;2;400;9;3
;max a;23;80;0;1;200;11;80;2;500;6;4
;a doubles;3;100;0;0;250;3;100;1;600;0;0
;spéciaux;0;120;0;2;300;6;120;3;700;0;0
;total aas;138;140;0;0;350;7;140;3;800;0;0
sans ;opérons;17;160;0;1;400;6;160;5;900;1;0
;1 aa;11;180;0;0;450;3;180;3;1000;1;0
;max a;9;200;0;0;500;3;200;4;1100;0;0
;a doubles;1;;2;0;;5;;7;;0;0
;total aas;35;;18;128;;62;;31;;62;31
total aas;;173;;;;;;;;;;
remarques;;3;;;;;;;;;;
avec jaune;;;moyenne;;16;;;;;;235;213
;;;variance;;20;;;;;;184;122
sans jaune;;;moyenne;16;14;;207;;126;;;
;;;variance;12;11;;106;;49;;;

pmq blocs[modifier | modifier le wikicode]

Les blocs à rRNAs pmq;;;;;
CDS;298;324;373;12;
16s;254;258;260;159;
23s;168;166;168;256;
5s;15;31;9;537;
1er aa;agc;aac;aac;ttc;
aas;9;16;17;9;
CDS;183;187;147;104;
;;;;;
CDS;677;797;537;54;43
16s;268;261;252;112;94
23s;95;94;94;258;255
5s;55;43;43;403;306
atc / aas;22;11;19;23;12
CDS;283;577;105;342;83
;;;;;
CDS;322;123;460;393;296
16s;269;167;94;94;94
23s;95;248;258;258;259
5s;178;325;456;369;234

lbu[modifier | modifier le wikicode]

lbu opérons[modifier | modifier le wikicode]

49.8%GC;29.7.19 Paris;16s 8;;;;;;;;
Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
comp;18533..19237;CDS;;128;128;;;235;128
;19366..19438;act;@1;195;195;;;;
;19634..20371;CDS;;6912;;;;246;
;;;;;;;;;
;27284..29785;CDS;;276;276;;;*834;
;30062..30134;act;;134;134;;;;134
;30269..30907;CDS;;11768;;;;213;
;;;;;;;;;
;42676..43248;cds hp;;451;*451;;;*191;
;43700..45271;16s;;209;;;;;
;45481..48391;23s;;69;;;;;
;48461..48577;5s;;275;275;;;;275
;48853..49091;cds hp;;56679;;;;80;
;;;;;;;;;
comp;105771..106547;CDS;;56;56;;;259;56
comp;106604..106679;aag;;125;125;;;;
;106805..107533;CDS;;103754;;;;243;
;;;;;;;;;
;211288..212553;CDS;;94;94;;;422;
;212648..212720;acc;;23;23;;;;23
comp<;212744..213262;CDS;;64997;;;;173;
;;;;;;;;;
;278260..278928;CDS;;69;69;;;223;69
comp;278998..279068;ggg;;181;181;;;;
;279250..280275;CDS;;44047;;;;342;
;;;;;;;;;
comp;324323..324949;CDS;;117;117;;;209;117
;325067..325138;ggc;+;4;;4;;;
;325143..325216;ccg;2 ggc;108;;;;;
;325325..325399;ggc;;155;155;;;;
;325555..326016;CDS;;37886;;;;154;
;;;;;;;;;
;363903..364394;CDS;;98;98;;;164;98
;364493..364564;caa;;614;*614;;;;
;365179..366360;CDS;;-14;;;;*394;
;;;;;;;;;
;366347..367402;CDS;;75;75;;;352;
;367478..367559;tac;;5;;5;;;
;367565..367636;caa;;62;62;;;;62
<;367699..368318;CDS;;14127;;;;207;
;;;;;;;;;
;382446..382907;CDS;;30;30;;;154;30
;382938..383026;ctt;;118;118;;;;
;383145..383768;CDS;;70441;;;;208;
;;;;;;;;;
;454210..455529;CDS;;61;61;;;440;61
;455591..455665;agg;;341;341;;;;
;456007..457035;CDS;;75557;;;;343;
;;;;;;;;;
;532593..533285;CDS;;82;82;;;231;82
comp;533368..533442;cgg;;296;296;;;;
;533739..534782;CDS;;48963;;;;348;
;;;;;;;;;
;583746..584728;CDS;;57;57;;;328;57
comp;584786..584858;cag;;5;;5;;;
comp;584864..584935;gag;;170;170;;;;
;585106..586110;CDS;;94988;;;;335;
;;;;;;;;;
;681099..682741;CDS;;518;*518;;;*548;
;683260..684831;16s;;106;;;;;
;684938..685011;atc;;69;;;69;;
;685081..685153;gca;;127;;;;;
;685281..688191;23s;;68;;;;;
;688260..688376;5s;;208;208;;;;208
comp;688585..689801;CDS;;55794;;;;406;
;;;;;;;;;
comp;745596..745821;CDS;;134;134;;;75;134
comp;745956..746044;tcg;;787;*787;;;;
;746832..749597;CDS;;36741;;;;*922;
;;;;;;;;;
;786339..787004;CDS;;54;54;;;222;54
;787059..787142;ctg;;109;109;;;;
comp;787252..787872;CDS;;2072;;;;207;
;;;;;;;;;
comp;789945..791867;CDS;;613;*613;;;*641;
;792481..794052;16s;;105;;;;;
;794158..794231;atc;;69;;;69;;
;794301..794373;gca;;126;;;;;
;794500..797410;23s;;69;;;;;
;797480..797596;5s;;87;87;;;;87
;797684..798559;CDS;;36;;;;292;
;;;;;;;;;
comp;798596..800178;CDS;;530;*530;;;*528;
;800709..800781;aac;@2;3;;3;;;
;800785..800858;cca;;24;;24;;;
;800883..800954;ggc;;30;;30;;;
;800985..801058;cgt;;2;;2;;;
;801061..801133;gta;;3;;3;;;
;801137..801208;gaa;;42;;42;;;
;801251..801338;tca;;9;;9;;;
;801348..801421;atgf;;3;;3;;;
;801425..801498;gac;;6;;6;;;
;801505..801577;ttc;;8;;8;;;
;801586..801667;tac;;4;;4;;;
;801672..801742;tgg;;13;;13;;;
;801756..801831;cac;;26;;26;;;
;801858..801928;tgc;;28;;28;;;
;801957..802041;ttg;;356;356;;;;356
;802398..802961;CDS;;284259;;;;188;
;;;;;;;;;
comp;1087221..1088531;CDS;;157;157;;;437;157
comp;1088689..1088760;caa;;656;*656;;;;
comp;1089417..1090313;CDS;;173317;;;;*299;
;;;;;;;;;
comp;1263631..1265769;CDS;;188;188;;;*713;188
comp;1265958..1266031;aga;;222;222;;;;
;1266254..1268632;CDS;;84103;;;;*793;
;;;;;;;;;
comp;1352736..1354022;CDS;;98;98;;;429;98
;1354121..1354204;ctg;;204;204;;;;
comp;1354409..1354928;CDS;;13182;;;;173;
;;;;;;;;;
comp;1368111..1369307;CDS;;161;161;;;399;161
comp;1369469..1369541;gta;;3;;;3;;
comp;1369545..1369616;gaa;;138;;;*138;;
comp;1369755..1369828;atgj;;6;;;6;;
comp;1369835..1369925;tcc;;8;;;8;;
comp;1369934..1370006;aac;;7;;;;;
comp;1370014..1370130;5s;;69;;;;;
comp;1370200..1373111;23s;;126;;;;;
comp;1373238..1373310;gca;;69;;;69;;
comp;1373380..1373453;atc;;105;;;;;
comp;1373559..1375130;16s;;547;*547;;;;
;1375678..1376604;CDS;;102845;;;;*309;
;;;;;;;;;
comp;1479450..1479824;CDS;;200;200;;;125;
comp;1480025..1480101;gac;;26;;;26;;
comp;1480128..1480199;gaa;;3;;;3;;
comp;1480203..1480275;gta;;2;;;2;;
comp;1480278..1480351;cgt;;35;;;35;;
comp;1480387..1480458;ggc;;36;;;;;
comp;1480495..1480611;5s;;68;;;;;
comp;1480680..1483590;23s;;208;;;;;
comp;1483799..1485370;16s;;153;153;;;;153
comp;1485524..1485716;CDS;;20944;;;;64;
;;;;;;;;;
comp;1506661..1507464;CDS;;270;270;;;268;
comp;1507735..1507807;aag;+;34;;34;;;
comp;1507842..1507914;aag;5 aag;33;;33;;;
comp;1507948..1508020;aag;;33;;33;;;
comp;1508054..1508126;aag;@3;33;;33;;;
comp;1508160..1508232;aag;;130;130;;;;130
comp;1508363..1509226;CDS;;167;;;;288;
;;;;;;;;;
;1509394..1510872;CDS;;106;106;;;493;106
comp;1510979..1511051;gta;;3;;3;;;
comp;1511055..1511126;gaa;;151;;*151;;;
;1511278..1511366;ctt;;113;113;;;;
;1511480..1512010;CDS;;21195;;;;177;
;;;;;;;;;
comp;1533206..1534129;CDS;;355;355;;;308;
comp;1534485..1534557;acg;;154;154;;;;154
comp;1534712..1535950;CDS;;18502;;;;413;
;;;;;;;;;
;1554453..1554638;CDS;;303;303;;;62;303
comp;1554942..1555029;agc;;673;*673;;;;
comp;1555703..1556203;CDS;;595;;;;*167;
;;;;;;;;;
;1556799..1558178;CDS;;277;277;;;460;
comp;1558456..1558572;5s;;68;;;;;
comp;1558641..1561551;23s;;126;;;;;
comp;1561678..1561750;gca;;69;;;69;;
comp;1561820..1561893;atc;;105;;;;;
comp;1561999..1563570;16s;;189;189;;;;189
;1563760..1563948;CDS;;19274;;;;63;
;;;;;;;;;
comp;1583223..1584392;CDS;;151;151;;;390;151
comp;1584544..1584628;ttg;+;17;;17;;;
comp;1584646..1584730;ttg;2 ttg;28;;28;;;
comp;1584759..1584829;tgc;2 ttc;26;;26;;;
comp;1584856..1584931;cac;2 atgf;13;;13;;;
comp;1584945..1585015;tgg;;4;;4;;;
comp;1585020..1585101;tac;;8;;8;;;
comp;1585110..1585182;ttc;;6;;6;;;
comp;1585189..1585262;gac;;3;;3;;;
comp;1585266..1585339;atgf;;9;;9;;;
comp;1585349..1585436;tca;;42;;42;;;
comp;1585479..1585550;gaa;;258;;*258;;;
comp;1585809..1585899;agc;;2;;2;;;
comp;1585902..1585975;atc;;3;;3;;;
comp;1585979..1586049;gga;;14;;14;;;
comp;1586064..1586136;ttc;;17;;17;;;
comp;1586154..1586227;atgf;;11;;11;;;
comp;1586239..1586312;atgi;;12;;12;;;
comp;1586325..1586398;atg;;36;;36;;;
comp;1586435..1586508;cca;;6;;6;;;
comp;1586515..1586588;cgt;;5;;5;;;
comp;1586594..1586679;tta;;15;;15;;;
comp;1586695..1586766;ggc;;4;;4;;;
comp;1586771..1586843;aca;;11;;11;;;
comp;1586855..1586936;cta;;12;;12;;;
comp;1586949..1587021;aaa;;2;;2;;;
comp;1587024..1587096;gta;;157;157;;;;
comp;1587254..1588681;CDS;;539;;;;476;
;;;;;;;;;
comp;1589221..1590557;CDS;;156;156;;;446;156
comp;1590714..1590830;5s;;68;;;;;
comp;1590899..1593809;23s;;126;;;;;
comp;1593936..1594008;gca;;69;;;69;;
comp;1594078..1594151;atc;;105;;;;;
comp;1594257..1595828;16s;;581;*581;;;;
comp;1596410..1597276;CDS;;189853;;;;*289;
;;;;;;;;;
comp;1787130..1788440;CDS;;298;298;;;437;298
comp;1788739..1788855;5s;;68;;;;;
comp;1788924..1791834;23s;@4;208;;;;;
comp;1792043..1793614;16s;;436;*436;;;;
comp;1794051..1794596;CDS;;-8;;;;*182;
comp;1794589..1795436;CDS;;138;138;;;283;138
comp;1795575..1795648;gac;;3;;;3;;
comp;1795652..1795724;gta;;2;;;2;;
comp;1795727..1795800;cgt;;35;;;35;;
comp;1795836..1795907;ggc;;19;;;19;;
comp;1795927..1796000;cca;;3;;;3;;
comp;1796004..1796076;aac;;7;;;;;
comp;1796084..1796200;5s;;68;;;;;
comp;1796269..1799179;23s;;208;;;;;
comp;1799388..1800959;16s;;501;*501;;;;
comp;1801461..1802087;CDS;;;;;;*209;

lbu cumuls[modifier | modifier le wikicode]

lbu cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;0;1;0;100;5
;16 23 5s 0;2;20;33;9;50;2;20;0;200;11
;16 atc gca;5;40;11;3;100;12;40;2;300;19
;16 23 5s a;2;60;2;0;150;11;60;3;400;11
;max a;7;80;0;5;200;14;80;3;500;11
;a doubles;0;100;0;0;250;3;100;4;600;2
;autres;0;120;0;0;300;6;120;2;700;1
;total aas;26;140;0;1;350;2;140;5;800;2
sans ;opérons;23;160;1;0;400;2;160;5;900;1
;1 aa;16;180;0;0;450;1;180;1;1000;1
;max a;26;200;0;0;500;1;200;2;1100;0
;a doubles;3;;1;0;;10;;5;;0
;total aas;72;;48;18;;64;;32;;64
total aas;;98;;;;;;;;;
remarques;;;;;;;;;;;
avec jaune;;;moyenne;;;;;;138;;320
;;;variance;;;;;;81;;182
sans jaune;;;moyenne;14;29;;159;;114;;275
;;;variance;12;29;;85;;50;;122

lbu blocs[modifier | modifier le wikicode]

lbu blocs;;;;;;;
5s;68;5s;68;;;;
23s;126;23s;126;;;;
gca;69;gca;69;;;;
atc;105;atc;105;;;;
16s;;16s;;;;;
;;;;;;;
;;;;aac;7;;
16s;106;16s;105;5s;69;;
atc;69;atc;69;23s;126;;
gca;127;gca;126;gca;69;;
23s;68;23s;69;atc;105;;
5s;;5s;;16s;;;
;;;;;;;
ggc;36;;;aac;7;;
5s;68;5s;68;5s;68;16s;209
23s;208;23s;208;23s;208;23s;69
16s;;16s;;16s;;5s;

ban*[modifier | modifier le wikicode]

ban opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Baci_anth_2002013094/baciAnth_2002013094-tRNAs.fa;gtRNAdb;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009902;ban*;;genome;;;;;;aas;cds dirigé
35.1%GC;15.8.19 Paris;16s 11;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Bacillus anthracis strain 2002013094;;;;;;;;;;
;618142..618366;;CDS;;188;188;;;75;188
;618555..618627;;gtc;;419;*419;;;;
comp;619047..619235;;CDS;;;;;;63;
;;;;;;;;;;
comp;1102183..1102602;;CDS;;130;130;;;140;130
comp;1102733..1102804;;gaa;+;1;;;1;;
comp;1102806..1102880;;aac;2 aca;8;;;8;;
comp;1102889..1102965;;atc;2 tca;11;;;11;;
comp;1102977..1103047;;tgg;;6;;;6;;
comp;1103054..1103126;;aca;;9;;;9;;
comp;1103136..1103211;;ttc;;9;;;9;;
comp;1103221..1103296;;gac;;4;;;4;;
comp;1103301..1103377;;atgf;;20;;;20;;
comp;1103398..1103490;;tca;;54;;;54;;
comp;1103545..1103637;;tca;;20;;;20;;
comp;1103658..1103730;;gca;;16;;;16;;
comp;1103747..1103820;;cca;;10;;;10;;
comp;1103831..1103904;;cgt;;3;;;3;;
comp;1103908..1103996;;tta;;16;;;16;;
comp;1104013..1104087;;ggc;;29;;;29;;
comp;1104117..1104197;;cta;;22;;;22;;
comp;1104220..1104295;;cac;;9;;;9;;
comp;1104305..1104380;;aca;;4;;;4;;
comp;1104385..1104460;;gta;;4;;;;;
comp;1104465..1104580;;5s;;97;;;;;
comp;1104678..1107604;;23s;;141;;;;;
comp;1107746..1109299;;16s;;694;*694;;;;
;1109994..1113038;;CDS;;;;;;*1015;
;;;;;;;;;;
comp;1306706..1307848;;CDS;;198;198;;;381;
comp;1308047..1308120;;gga;;115;115;;;;115
comp;1308236..1308889;;CDS;;;;;;218;
;;;;;;;;;;
;1312025..1312345;;CDS;;207;207;;;107;207
comp;1312553..1312637;;ttg;;10;;;10;;
comp;1312648..1312718;;tgc;;14;;;14;;
comp;1312733..1312807;;ggc;;5;;;5;;
comp;1312813..1312887;;caa;;63;;;63;;
comp;1312951..1313026;;cac;;19;;;19;;
comp;1313046..1313119;;tgg;;7;;;7;;
comp;1313127..1313210;;tac;;17;;;17;;
comp;1313228..1313303;;gta;;5;;;5;;
comp;1313309..1313383;;gaa;;24;;;24;;
comp;1313408..1313480;;acc;;4;;;4;;
comp;1313485..1313559;;aac;;9;;;;;
comp;1313569..1313684;;5s;;96;;;;;
comp;1313781..1316709;;23s;;141;;;;;
comp;1316851..1318405;;16s;;386;*386;;;;
;1318792..1319148;;CDS;;;;;;119;
;;;;;;;;;;
;1556278..1556507;;CDS;;57;57;;;77;57
comp;1556565..1556680;;5s;;49;;;;;
comp;1556730..1560126;;23s;;173;;;;;
comp;1560300..1562132;;16s;;476;*476;;;;
;1562609..1563322;;CDS;;;;;;238;
;;;;;;;;;;
>;1566949..1567219;;CDS;;99;99;;;90;99
comp;1567319..1567434;;5s;;46;;;;;
comp;1567481..1570409;;23s;;142;;;;;
comp;1570552..1572115;;16s;;451;*451;;;;
;1572567..1574498;;CDS;;;;;;*644;
;;;;;;;;;;
;1579539..1580615;;CDS;;14;14;;;359;14
comp;1580630..1580745;;5s;;45;;;;;
comp;1580791..1583912;;23s;;153;;;;;
comp;1584066..1585720;;16s;;294;294;;;;
comp;1586015..1587520;;CDS;;;;;;*502;
;;;;;;;;;;
comp;1600693..1601166;;CDS;;174;174;;;158;
comp;1601341..1601416;;gac;;3;;;3;;
comp;1601420..1601496;;atgf;;12;;;;;
comp;1601509..1601624;;5s;@1;46;;;;;
comp;1601671..1604598;;23s;;141;;;;;
comp;1604740..1606294;;16s;;75;;;;;
comp;1606370..1606440;;gga;;1;;1;;;
comp;1606442..1606518;;cca;+;4;;4;;;
comp;1606523..1606599;;cgt;Séquence 10;3;;3;;;
comp;1606603..1606691;;tta;;16;;16;;;
comp;1606708..1606782;;ggc;;29;;29;;;
comp;1606812..1606892;;cta;;14;;14;;;
comp;1606907..1606982;;aaa;;5;;5;;;
comp;1606988..1607062;;caa;;87;;*87;;;
comp;1607150..1607225;;gac;;46;;46;;;
comp;1607272..1607347;;gta;;4;;4;;;
comp;1607352..1607426;;gaa;;1;;1;;;
comp;1607428..1607502;;aac;2 aac;8;;8;;;
comp;1607511..1607587;;atc;;11;;11;;;
comp;1607599..1607669;;tgg;;6;;6;;;
comp;1607676..1607748;;aca;;9;;9;;;
comp;1607758..1607833;;ttc;;8;;8;;;
comp;1607842..1607917;;gac;;4;;4;;;
comp;1607922..1607998;;atgf;;20;;20;;;
comp;1608019..1608111;;tca;2 tca;54;;54;;;
comp;1608166..1608258;;tca;;20;;20;;;
comp;1608279..1608351;;gca;;16;;16;;;
comp;1608368..1608441;;cca;;10;;10;;;
comp;1608452..1608525;;cgt;;3;;3;;;
comp;1608529..1608617;;tta;;16;;16;;;
comp;1608634..1608708;;ggc;;29;;29;;;
comp;1608738..1608818;;cta;;13;;13;;;
comp;1608832..1608907;;aaa;;5;;5;;;
comp;1608913..1608987;;caa;;87;;*87;;;
comp;1609075..1609150;;gac;;46;;46;;;
comp;1609197..1609272;;gta;;4;;4;;;
comp;1609277..1609351;;gaa;;8;;8;;;
comp;1609360..1609450;;agc;;3;;3;;;
comp;1609454..1609528;;aac;;114;114;;;;114
comp;1609643..1610101;;CDS;;;;;;153;
;;;;;;;;;;
comp;1702642..1703788;;CDS;;114;114;;;382;114
comp;1703903..1703975;;gca;;10;;;10;;
comp;1703986..1704057;;ggc;;5;;;5;;
comp;1704063..1704138;;aaa;;5;;;5;;
comp;1704144..1704218;;caa;;65;;;65;;
comp;1704284..1704366;;tac;;17;;;17;;
comp;1704384..1704459;;gta;;5;;;5;;
comp;1704465..1704539;;gaa;;24;;;24;;
comp;1704564..1704636;;acc;;4;;;4;;
comp;1704641..1704715;;aac;;9;;;;;
comp;1704725..1704840;;5s;;82;;;;;
comp;1704923..1707851;;23s;;141;;;;;
comp;1707993..1709545;;16s;;223;223;;;;
comp;1709769..1709987;;CDS;;;;;;73;
;;;;;;;;;;
comp;1767157..1767618;;CDS;;206;206;;;154;206
comp;1767825..1767940;;5s;;45;;;;;
comp;1767986..1770913;;23s;;141;;;;;
comp;1771055..1772608;;16s;;372;*372;;;;
comp;1772981..1774480;;CDS;;;;;;*500;
;;;;;;;;;;
comp;1787717..1790188;;CDS;;259;259;;;*824;
comp;1790448..1790519;;gaa;;13;;13;;;
comp;1790533..1790606;;atgj;@2;160;160;;;;160
comp;1790767..1791249;;CDS;;;;;;161;
;;;;;;;;;;
comp;1820538..1820717;;CDS;;190;190;;;60;190
comp;1820908..1821023;;5s;;44;;;;;
comp;1821068..1823996;;23s;;77;;;;;
comp;1824074..1824149;;gca;;8;;;8;;
comp;1824158..1824234;;atc;;130;;;;;
comp;1824365..1825919;;16s;;217;217;;;;
comp;1826137..1826406;;CDS;;;;;;90;
;;;;;;;;;;
comp;1832600..1832992;;CDS;;166;166;;;131;
comp;1833159..1833251;;tca;;156;156;;;;156
comp;1833408..1834682;;CDS;;;;;;425;
;;;;;;;;;;
;1839668..1840669;;CDS;;34;34;;;334;34
comp;1840704..1840819;;5s;;44;;;;;
comp;1840864..1843791;;23s;;76;;;;;
comp;1843868..1843943;;gca;;8;;;8;;
comp;1843952..1844028;;atc;;130;;;;;
comp;1844159..1845713;;16s;;240;240;;;;
comp;1845954..1848425;;CDS;;;;;;*824;
;;;;;;;;;;
;1873838..1875127;;CDS;;139;139;;;430;139
;1875267..1875342;;aaa;;13;;13;;;
;1875356..1875427;;gaa;;21;;21;;;
;1875449..1875524;;gac;;41;;41;;;
;1875566..1875638;;ttc;;403;*403;;;;
;1876042..1876749;;CDS;;;;;;236;
;;;;;;;;;;
comp;2217640..2217846;;CDS;;205;205;;;69;205
;2218052..2218130;;cgg;;255;255;;;;
;2218386..2219693;;CDS;;;;;;436;
;;;;;;;;;;
comp;2428815..2429495;;CDS;;404;*404;;;227;
;2429900..2431456;;16s;;139;;;;;
;2431596..2434524;;23s;;97;;;;;
;2434622..2434737;;5s;;4;;;;;
;2434742..2434817;;gta;+;4;;;4;;
;2434822..2434897;;aca;2 cta;9;;;9;;
;2434907..2434982;;cac;2 aca;22;;;22;;
;2435005..2435085;;cta;;29;;;29;;
;2435115..2435189;;ggc;;16;;;16;;
;2435206..2435294;;tta;;3;;;3;;
;2435298..2435371;;cgt;;10;;;10;;
;2435382..2435455;;cca;;16;;;16;;
;2435472..2435544;;gca;;20;;;20;;
;2435565..2435657;;tca;;54;;;54;;
;2435712..2435805;;cta;;20;;;20;;
;2435826..2435902;;atgf;;1;;;1;;
;2435904..2435979;;gac;;12;;;12;;
;2435992..2436067;;ttc;;14;;;14;;
;2436082..2436157;;aca;;10;;;10;;
;2436168..2436243;;aaa;;13;;;13;;
;2436257..2436327;;gga;;10;;;10;;
;2436338..2436414;;atc;;7;;;7;;
;2436422..2436496;;aac;;7;;;7;;
;2436504..2436594;;agc;;6;;;6;;
;2436601..2436672;;gaa;;59;59;;;;59
;2436732..2436842;;CDS;;;;;;37;
;;;;;;;;;;
;2798971..2799474;;CDS;;109;109;;;168;109
;2799584..2799657;;gga;;1;;1;;;
;2799659..2799735;;aga;;407;*407;;;;
;2800143..2800343;;CDS;;;;;;67;
;;;;;;;;;;
comp;2991608..2992366;;CDS;;242;242;;;253;
;2992609..2992682;;atgi;;221;221;;;;221
;2992904..2993515;;CDS;;;;;;204;

ban cumuls[modifier | modifier le wikicode]

ban* cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;3;2;1;0;1;0;100;10
;16 23 5s 0;4;20;25;47;50;2;20;1;200;9
;16 atc gca;2;40;3;6;100;3;40;1;300;6
;16 23 5s a;5;60;4;2;150;6;60;2;400;4
;max a;21;80;0;2;200;7;80;0;500;4
;a doubles;2;100;2;0;250;8;100;1;600;1
;autres;0;120;0;0;300;3;120;4;700;1
;total aas;66;140;0;0;350;0;140;2;800;0
sans ;opérons;9;160;0;0;400;2;160;2;900;2
;1 aa;5;180;0;0;450;3;180;0;1000;0
;max a;33;200;0;0;500;0;200;2;1100;1
;a doubles;1;;0;0;;0;;4;;0
;total aas;46;;37;59;;34;;19;;38
total aas;;112;;;;;;;;;
remarques;;2;;;;;;;;;
avec jaune;;;moyenne;18;15;;232;;132;;274
;;;variance;21;14;;143;;62;;238
sans jaune;;;moyenne;14;;;165;;;;191
;;;variance;14;;;71;;;;124

ban blocs[modifier | modifier le wikicode]

ban intercalaires des 11 clusters à rRNAs;;;;;
aa;gta;aac;atgf;aac;CDS
inter aa;4;9;12;9;404
5s;97;96;46;82;139
23s;141;141;141;141;97
16s;694;386;75;223;4
CDS;CDS;CDS;gga;CDS;gta
;;;;;
CDS;57;99;14;206;
5s;49;46;45;45;
23s;173;142;153;141;
16s;476;451;294;372;
;;;;;
CDS;190;34;;;
5s;44;44;;;
23s;77;76;;;
gca;8;8;;;
atc;130;130;;;
16s;217;240;;;
CDS;;;;;

ban séquences[modifier | modifier le wikicode]

33 aas;inter;21 aas;inter;19 aas;inter;11 aas;inter
;;;;;;;
gga;1;;;;;ttg;10
cca;4;;;;;tgc;14
cgt;3;;;;;ggc;5
tta;16;;;;;caa;63
ggc;29;;;;;cac;19
cta;14;;;;;tgg;7
aaa;5;;;;;tac;17
caa;87;;;;;gta;5
gac;46;gaa;6;;;gaa;24
gta;4;agc;7;;;acc;4
gaa;1;aac;7;gaa;1;aac;
aac;8;atc;10;aac;8;;
atc;11;gga;13;atc;11;;
tgg;6;aaa;10;tgg;6;;
aca;9;aca;14;aca;9;;
ttc;8;ttc;12;ttc;9;;
gac;4;gac;1;gac;4;;
atgf;20;atgf;20;atgf;20;;
tca;54;cta;54;tca;54;9 aas;inter
tca;20;tca;20;tca;20;;
gca;16;gca;16;gca;16;gca;10
cca;10;cca;10;cca;10;ggc;5
cgt;3;cgt;3;cgt;3;aaa;5
tta;16;tta;16;tta;16;caa;65
ggc;29;ggc;29;ggc;29;tac;17
cta;13;cta;22;cta;22;gta;5
aaa;5;cac;9;cac;9;gaa;24
caa;87;aca;4;aca;4;acc;4
gac;46;gta;;gta;;aac;
gta;4;;;;;;
gaa;8;;;;;;
agc;3;;;;;;
aac;;;;;;;

clostridia[modifier | modifier le wikicode]

psor[modifier | modifier le wikicode]

psor opérons[modifier | modifier le wikicode]

27.3%GC;8.8.19 Paris;;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Paeniclostridium sordellii AM370;;;;;;;;;
;9847..10620;CDS;;205;205;;;258;
;10826..12332;16s;;196;;;;;
;12529..15445;23s;;78;;;;;
;15524..15640;5s;;85;85;;;;85
;15726..15947;CDS;;;;;;74;
;;;;;;;;;
;18845..19297;CDS;;3;3;;;151;3
;19301..19393;tcc;;27;;;;;
;19421..19685;ncRNA;;152;152;;;;
;19838..21478;CDS;;;;;;*547;
;;;;;;;;;
;24343..24570;CDS;;309;309;;;76;
;24880..26386;16s;;196;;;;;
;26583..29499;23s;;122;;;;;
;29622..29738;5s;;5;;;5;;
;29744..29832;tta;+;13;;;13;;
;29846..29921;atg;3 aaa;15;;;15;;
;29937..30011;gaa;6 atg;9;;;9;;
;30021..30094;gga;3 gta;6;;;6;;
;30101..30176;gta;1 cgt;5;;;5;;
;30182..30258;gac;1 ggc;16;;;16;;
;30275..30350;aac;2 fois suite;4;;;4;;
;30355..30429;aca;aac aca aga;4;;;4;;
;30434..30518;tac;caa cac cca;15;;;15;;
;30534..30617;cta;cta gaa gac;14;;;14;;
;30632..30708;aga;gga tac tca;7;;;7;;
;30716..30791;caa;tgc tta ttc;11;;;11;;
;30803..30878;aaa;;6;;;6;;
;30885..30973;tca;;3;;;3;;
;30977..31052;ttc;;9;;;9;;
;31062..31138;atg;;8;;;8;;
;31147..31223;atg;;21;;;21;;
;31245..31321;cca;;6;;;6;;
;31328..31404;cac;;4;;;4;;
;31409..31482;tgc;;25;;;25;;
;31508..31596;tta;;13;;;13;;
;31610..31685;atg;;15;;;15;;
;31701..31775;gaa;;9;;;9;;
;31785..31858;gga;;6;;;6;;
;31865..31940;gta;;5;;;5;;
;31946..32022;gac;;16;;;16;;
;32039..32114;aac;;4;;;4;;
;32119..32193;aca;;4;;;4;;
;32198..32282;tac;;15;;;15;;
;32298..32381;cta;;11;;;11;;
;32393..32467;ggc;;13;;;13;;
;32481..32557;aga;;7;;;7;;
;32565..32640;caa;;11;;;11;;
;32652..32727;aaa;;6;;;6;;
;32734..32822;tca;;3;;;3;;
;32826..32901;ttc;;9;;;9;;
;32911..32987;atg;;8;;;8;;
;32996..33072;atg;;21;;;21;;
;33094..33170;cca;;6;;;6;;
;33177..33253;cac;;9;;;9;;
;33263..33338;aaa;;21;;;21;;
;33360..33433;tgc;;6;;;6;;
;33440..33516;cgt;;10;;;;;
;33527..33602;gta;;162;162;;;;162
;33765..34016;CDS;;;;;;84;
;;;;;;;;;
;34042..34455;CDS;;249;249;;;138;
;34705..36211;16s;;196;;;;;
;36408..39324;23s;;78;;;;;
;39403..39519;5s;;402;*402;;;;
comp;39922..40113;CDS;;348;348;;;64;
;40462..41968;16s;;196;;;;;
;42165..45081;23s;;78;;;;;
;45160..45276;5s;;180;180;;;;*180
;45457..47394;CDS;;;;;;*646;
;;;;;;;;;
;101428..102144;CDS;;276;276;;;239;
;102421..103927;16s;;54;;;;;
;103982..104057;gca;;114;;;;;
;104172..107096;23s;;41;;;;;
;107138..107211;gga;;11;;;;;
;107223..107339;5s;;99;99;;;;99
comp;107439..108617;CDS;;;;;;393;
;;;;;;;;;
;111345..111884;CDS;;431;*431;;;180;
;112316..113822;16s;;54;;;;;
;113877..113952;gca;;114;;;;;
;114067..116982;23s;;193;;;;;
;117176..117292;5s;;5;;;;;
;117298..117386;tta;;9;;;9;;
;117396..117472;atg;;123;;;;;
;117596..119102;16s;;54;;;;;
;119157..119232;gca;;114;;;;;
;119347..122263;23s;;193;;;;;
;122457..122573;5s;;5;;;;;
;122579..122667;tta;;9;;;9;;
;122677..122753;atg;;123;;;;;
;122877..124383;16s;;54;;;;;
;124438..124513;gca;;114;;;;;
;124628..127549;23s;;78;;;;;
;127628..127744;5s;;100;100;;;;100
;127845..129260;CDS;;;;;;472;
;;;;;;;;;
;215388..216260;CDS;;264;264;;;291;
;216525..218030;16s;;123;;;;;
;218154..218229;gca;;152;;;;;
;218382..221296;23s;;50;;;;;
;221347..221420;gga;;12;;;;;
;221433..221549;5s;;109;109;;;;109
;221659..221940;CDS;;525;*525;;;94;
;222466..223972;16s;;196;;;;;
;224169..227083;23s;;144;;;;;
;227228..227344;5s;;228;228;;;;*228
;227573..227989;CDS;;;;;;139;
;;;;;;;;;
;449964..450266;CDS;;253;253;;;101;
;450520..452026;16s;;196;;;;;
;452223..455139;23s;;144;;;;;
;455284..455400;5s;;112;112;;;;112
comp;455513..456616;CDS;;;;;;368;
;;;;;;;;;
;498418..499074;CDS;;189;189;;;219;
;499264..500770;16s;;118;;;;;
;500889..500964;gca;;95;;;;;
;501060..503976;23s;;144;;;;;
;504121..504237;5s;;131;131;;;;131
;504369..504551;CDS;;;;;;61;
;;;;;;;;;
;546886..550416;CDS;;41;41;;;*1177;*41
comp;550458..550544;ttg;;138;138;;;;
;550683..553325;CDS;;;;;;*881;
;;;;;;;;;
;608009..608683;CDS;;195;195;;;225;
;608879..608975;tga;;37;37;;;;37
comp;609013..609732;CDS;;;;;;240;
;;;;;;;;;
;815939..816655;CDS;;71;71;;;239;71
;816727..816800;tgc;;12;;12;;;
;816813..816888;aac;;3;;3;;;
;816892..816966;aca;;285;285;;;;
;817252..818727;CDS;;;;;;492;
;;;;;;;;;
;1284870..1288097;CDS;;111;111;;;*1076;*111
;1288209..1288297;cta;;426;*426;;;;
;1288724..1290853;CDS;;;;;;*710;
;;;;;;;;;
;1445161..1445664;CDS;;135;135;;;168;135
;1445800..1445868;other;@1;258;258;;;;
;1446127..1446813;CDS;;;;;;229;
;;;;;;;;;
;2267513..2267698;CDS;@2;306;306;;;62;*306
comp;2268005..2268088;cta;;404;*404;;;;
;2268493..2269758;CDS;;;;;;422;
;;;;;;;;;
;3094098..3094784;CDS;;40;40;;;229;40
comp;3094825..3094941;5s;;78;;;;;
comp;3095020..3097936;23s;;194;;;;;
comp;3098131..3099637;16s;;276;276;;;;
comp;3099914..3101161;CDS;;;;;;416;
;;;;;;;;;
;3159922..3160827;CDS;;37;37;;;302;37
comp;3160865..3160956;agc;;120;120;;;;
comp;3161077..3161376;CDS;;;;;;100;
;;;;;;;;;
comp;3274188..3274733;CDS;;245;245;;;182;*245
comp;3274979..3275095;5s;@3;12;;;;;
comp;3275108..3275181;gga;;107;;;;;
comp;3275289..3278214;23s;;137;;;;;
comp;3278352..3279858;16s;;253;253;;;;
comp;3280112..3280690;CDS;;;;;;193;
;;;;;;;;;
comp;3303104..3304150;CDS;;124;124;;;349;124
comp;3304275..3304459;riboswitch;@4;96;;;;;
comp;3304556..3304672;5s;;11;;;;;
comp;3304684..3304758;aca;;116;;;;;
comp;3304875..3307789;23s;;196;;;;;
comp;3307986..3309492;16s;;364;*364;;;;
;3309857..3310504;CDS;;;;;;216;
;;;;;;;;;
comp;3438683..3439531;CDS;;142;142;;;283;142
comp;3439674..3439750;aga;;7;;;7;;
comp;3439758..3439832;ggc;;9;;;9;;
comp;3439842..3439918;gac;;5;;;5;;
comp;3439924..3439999;gta;;8;;;8;;
comp;3440008..3440082;gaa;;5;;;;;
comp;3440088..3440204;5s;;40;;;;;
comp;3440245..3443168;23s;;112;;;;;
comp;3443281..3443356;gca;;109;;;;;
comp;3443466..3444972;16s;;138;;;;;
comp;3445111..3445187;atg;+;13;;;13;;
comp;3445201..3445276;ttc;3 atg;6;;;6;;
comp;3445283..3445359;atc;2 cca;6;;;6;;
comp;3445366..3445442;cca;2 gga;31;;;31;;
comp;3445474..3445549;tgg;2 aac;11;;;11;;
comp;3445561..3445637;atg;;6;;;6;;
comp;3445644..3445720;cca;;6;;;6;;
comp;3445727..3445817;agc;;11;;;11;;
comp;3445829..3445917;tca;;6;;;6;;
comp;3445924..3445999;aaa;;12;;;12;;
comp;3446012..3446087;caa;;6;;;6;;
comp;3446094..3446170;aga;;19;;;19;;
comp;3446190..3446263;gga;;11;;;11;;
comp;3446275..3446359;tac;;4;;;4;;
comp;3446364..3446438;aca;;4;;;4;;
comp;3446443..3446518;aac;;31;;;31;;
comp;3446550..3446625;aac;;16;;;16;;
comp;3446642..3446718;gac;;5;;;5;;
comp;3446724..3446799;gta;;6;;;6;;
comp;3446806..3446879;gga;;9;;;9;;
comp;3446889..3446963;gaa;;15;;;15;;
comp;3446979..3447054;atg;;13;;;13;;
comp;3447068..3447156;tta;;5;;;;;
comp;3447162..3447278;5s;;213;;;;;
comp;3447492..3450406;23s;;196;;;;;
comp;3450603..3452109;16s;;239;239;;;;
comp;3452349..3452552;CDS;;;;;;68;
;;;;;;;;;
comp;3523330..3524046;CDS;;129;129;;;239;129
comp;3524176..3524251;gta;+;8;;8;;;
comp;3524260..3524334;gaa;2 fois;20;;20;;;
comp;3524355..3524430;aaa;gta gaa aaa;10;;10;;;
comp;3524441..3524515;aca;;10;;10;;;
comp;3524526..3524602;gac;;7;;7;;;
comp;3524610..3524685;gta;;9;;9;;;
comp;3524695..3524769;gaa;;5;;5;;;
comp;3524775..3524850;aaa;;289;289;;;;
;3525140..3526039;CDS;;;;;;300;

psor cumuls[modifier | modifier le wikicode]

psor cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;0;1;0;1;0;100;9
;16 23 5s 0;6;20;9;65;50;5;20;1;200;8
;16 atc gca;0;40;0;6;100;4;40;3;300;13
;16 23 5s a;2;60;0;0;150;10;60;1;400;4
;max a;44;80;0;0;200;5;80;1;500;4
;a doubles;2;100;0;0;250;5;100;3;600;1
;autres;9;120;0;0;300;8;120;3;700;1
;total aas;87;140;0;0;350;3;140;4;800;1
sans ;opérons;7;160;0;0;400;1;160;1;900;1
;1 aa;5;180;0;0;450;4;180;2;1000;0
;max a;8;200;0;0;500;0;200;0;1100;1
;a doubles;1;;0;0;;1;;3;;1
;total aas;17;;9;71;;46;;22;;44
total aas;;104;;;;;;;;;
remarques;;4;;;;;;;;;
avec jaune;;;moyenne;9;10;;206;;119;;304
;;;variance;5;6;;121;;73;;257
sans jaune;;;moyenne;;;;173;;95;;220
;;;variance;;;;90;;45;;121

psor blocs[modifier | modifier le wikicode]

I;;I2;I3;I4;;;II;;III;;IV;IV1;IV2
;;;;;;;;;;;;;
;;;;;;;;;CDS;124;;;
;;;;;;;CDS;245;riboswitch;96;;;
CDS;205;249;348;525;253;40;5s;12;5s;11;CDS;309;5
16s;196;196;196;196;196;78;gga;107;aca;116;16s;196;213
23s;78;78;78;144;144;194;23s;137;23s;196;23s;122;196
5s;85;402;180;228;112;276;16s;253;16s;364;5s;5;239
CDS;;;;;;;CDS;;CDS;;tta;;
V;;V2;VI;VI1;VII;VII1;VIII;VIII1;IX;;X;X1;
;;;;;;;;;;;;;
CDS;276;264;CDS;431;;;;;CDS;189;gaa;5;
16s;54;123;16s;54;16s;54;16s;54;16s;118;5s;40;
gca;114;152;gca;114;gca;114;gca;114;gca;95;23s;112;
23s;41;50;23s;193;23s;193;23s;78;23s;144;gca;109;
gga;11;12;5s;5;5s;5;5s;100;5s;131;16s;138;
5s;99;109;tta;9;tta;9;CDS;;CDS;;atg;;
CDS;;;atg;123;atg;123;;;;;;;
;;;;;;;;;;;;;
;CDS;431;;CDS;309;;CDS;142;;CDS;264;;
VI;16s;54;IV1;16s;196;;* * * *4aas;8;V2;16s;123;;
;gca;114;;23s;122;;gaa;5;;gca;152;;
;23s;193;;5s;5;;5s;40;;23s;50;;
;5s;5;;tta;13;;23s;112;;gga;12;;
;tta;9;;* * * * 42aas;10;;gca;109;;5s;109;;
;atg;123;;gta;162;X1;16s;138;;CDS;525;;
VII;16s;54;;CDS;25;;atg;13;I4;16s;196;;
;gca;114;;CDS;249;;* * * *21aas;13;;23s;144;;
;23s;193;I2;16s;196;;tta;5;;5s;228;;
;5s;5;;23s;78;;5s;213;;CDS;;;
;tta;9;;5s;402;;23s;196;;;;;
;atg;123;;CDS;348;IV2;16s;239;;;;;
VIII;16s;54;I3;16s;196;;CDS;;;;;;
;gca;114;;23s;78;;;;;;;;
;23s;78;;5s;180;;;;;;;;
;5s;100;;CDS;;;;;;;;;
;CDS;;;;;;;;;;;;

cdc[modifier | modifier le wikicode]

cdc opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  10 ;83 aas;doubles;intercalaires;CDS;cds pbs;avec aa;cdsa;cdsd;protéines
Peptoclostridium difficile CD196;;;;;;;;;;;
dir    ;9857..10630;;cds;;179;179;774;;258;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;10810..12317;;16s;;52;;1508;;;;
dir    ;12370..12445;;gca;;249;;76;;;;
dir    ;12695..15596;;23s;;111;;2902;;;;
dir    ;15708..15824;;5s;;126;126;117;;;126;
dir    ;15951..16460;;cds;;;;510;;170;;transcription repressor NadR
;;;;;;;;;;;
dir   ;19402..19857;;cds;;0;0;456;;152;0;nucleoside deaminase
dir   ;19858..19949;;tcc;;37;;92;;;;
dir   ;19987..20251;;ncRNA;@1;76;76;265;;;;
dir   ;20328..21965;;cds;;;;1638;;546;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;23419..24624;;cds;;505;*505;1206;;402;;glycosyl transferase
dir    ;25130..26637;;16s;;279;;1508;;;;
dir    ;26917..29816;;23s;+;180;;2900;;;;
dir    ;29997..30113;;5s;3 aaa;6;;117;;;;
dir    ;30120..30194;;aac;3 gta;6;;75;6;;;
dir    ;30201..30286;;tta;;15;;86;15;;;
dir    ;30302..30377;;atgf;;7;;76;7;;;
dir    ;30385..30459;;gaa;;9;;75;9;;;
dir    ;30469..30542;;gga;;5;;74;5;;;
dir    ;30548..30623;;gta;;5;;76;5;;;
dir    ;30629..30705;;gac;;9;;77;9;;;
dir    ;30715..30789;;aca;;14;;75;14;;;
dir    ;30804..30888;;tac;;8;;85;8;;;
dir    ;30897..30980;;cta;;29;;84;29;;;
dir    ;31010..31086;;aga;;7;;77;7;;;
dir    ;31094..31169;;caa;;88;;76;88;;;
dir    ;31258..31346;;tca;;3;;89;3;;;
dir    ;31350..31425;;ttc;;6;;76;6;;;
dir    ;31432..31508;;atgj;;11;;77;11;;;
dir    ;31520..31596;;atgi;;23;;77;23;;;
dir    ;31620..31696;;cca;;7;;77;7;;;
dir    ;31704..31780;;cac;;8;;77;8;;;
dir    ;31789..31864;;aaa;;7;;76;7;;;
dir    ;31872..31945;;tgc;;6;;74;6;;;
dir    ;31952..32026;;aac;;5;;75;5;;;
dir    ;32032..32117;;tta;;15;;86;15;;;
dir    ;32133..32208;;atgf;;7;;76;7;;;
dir    ;32216..32290;;gaa;;9;;75;9;;;
dir    ;32300..32373;;gga;;5;;74;5;;;
dir    ;32379..32454;;gta;;5;;76;5;;;
dir    ;32460..32536;;gac;;9;;77;9;;;
dir    ;32546..32620;;aca;;14;;75;14;;;
dir    ;32635..32719;;tac;;9;;85;9;;;
dir    ;32729..32812;;cta;;23;;84;23;;;
dir    ;32836..32910;;ggc;;24;;75;24;;;
dir    ;32935..33011;;aga;;9;;77;9;;;
dir    ;33021..33096;;caa;;8;;76;8;;;
dir    ;33105..33180;;aaa;;2;;76;2;;;
dir    ;33183..33271;;tca;;3;;89;3;;;
dir    ;33275..33350;;ttc;;6;;76;6;;;
dir    ;33357..33433;;atgj;;11;;77;11;;;
dir    ;33445..33521;;atgi;;17;;77;17;;;
dir    ;33539..33615;;cac;;8;;77;8;;;
dir    ;33624..33699;;aaa;;7;;76;7;;;
dir    ;33707..33780;;tgc;;7;;74;7;;;
dir    ;33788..33864;;cgt;;12;;77;12;;;
dir    ;33877..33952;;gta;;75;75;76;;;75;
dir    ;34028..34441;;cds;;308;308;414;;138;;hp
dir    ;34750..38181;;cds;;;;3432;;1144;;pyruvate carboxylase
;;;;;;;;;;;
dir    ;127011..127715;;cds;;281;281;705;;235;;N-acetylmuramoyl-L-alanine amidase CwlD
dir    ;127997..129505;;16s;;279;;1509;;;;
dir    ;129785..132685;;23s;+;131;;2901;;;;
dir    ;132817..132933;;5s;2 cca;6;;117;;;;
dir    ;132940..133014;;aac;;4;;75;4;;;
dir    ;133019..133093;;gaa;;5;;75;5;;;
dir    ;133099..133174;;gta;;5;;76;5;;;
dir    ;133180..133256;;gac;;10;;77;10;;;
dir    ;133267..133341;;aca;;14;;75;14;;;
dir    ;133356..133440;;tac;;9;;85;9;;;
dir    ;133450..133523;;gga;;10;;74;10;;;
dir    ;133534..133610;;aga;;9;;77;9;;;
dir    ;133620..133695;;caa;;11;;76;11;;;
dir    ;133707..133782;;aaa;;2;;76;2;;;
dir    ;133785..133873;;tca;;17;;89;17;;;
dir    ;133891..133981;;agc;;8;;91;8;;;
dir    ;133990..134066;;cca;;85;;77;85;;;
dir    ;134152..134227;;tgg;;60;;76;60;;;
dir    ;134288..134364;;cca;;6;;77;6;;;
dir    ;134371..134447;;atc;;3;;77;3;;;
dir    ;134451..134526;;ttc;;7;;76;7;;;
dir    ;134534..134610;;atgj;;114;;77;;;;
dir    ;134725..136115;;16s;;68;;1391;;;;
dir    ;136184..136259;;gca;;271;;76;;;;
dir    ;136531..139430;;23s;;126;;2900;;;;
dir    ;139557..139673;;5s;;213;213;117;;;213;
comp;139887..141071;;cds;;372;*372;1185;;395;;pyridoxal phosphate-dependent aminotransferase
dir    ;141444..143795;;cds;;21;21;2352;;784;;anaerobic ribonucleoside triphosphate reductase
dir    ;143817..144356;;cds;;776;*776;540;;180;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;145133..146640;;16s;;52;;1508;;;;
dir    ;146693..146768;;gca;;373;;76;;;;
dir    ;147142..150041;;23s;;126;;2900;;;;
dir    ;150168..150284;;5s;;7;;117;7;;;
dir    ;150292..150366;;aac;;5;;75;5;;;
dir    ;150372..150457;;tta;;15;;86;15;;;
dir    ;150473..150548;;atgf;;7;;76;7;;;
dir    ;150556..150630;;gaa;;14;;75;14;;;
dir    ;150645..150718;;gga;;5;;74;5;;;
dir    ;150724..150799;;gta;;5;;76;5;;;
dir    ;150805..150881;;gac;;10;;77;10;;;
dir    ;150892..150966;;ggc;;9;;75;9;;;
dir    ;150976..151049;;aga;;975;*975;74;;;;
dir    ;152025..152864;;cds;;;;840;;280;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;378341..380728;;cds;;583;*583;2388;;796;;cadmium-translocating P-type ATPase
dir   ;381312..382819;;16s;;311;;1508;;;;
dir   ;383131..386030;;23s;;126;;2900;;;;
dir   ;386157..386273;;5s;;177;177;117;;;177;
dir   ;386451..387059;;cds;;;;609;;203;;DedA family protein
;;;;;;;;;;;
comp;833130..833894;;cds;;258;258;765;;255;;DeoR/GlpR transcriptional regulator
dir    ;834153..834243;;agc;;87;87;91;;;87;
dir    ;834331..835119;;cds;;;;789;;263;;flagellar motor protein
;;;;;;;;;;;
dir    ;1089165..1090139;;cds;;239;239;975;;325;239;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1090379..1091886;;16s;;320;;1508;;;;
dir    ;1092207..1095106;;23s;;91;;2900;;;;
dir    ;1095198..1095271;;gga;@2;8;;74;;;;
dir    ;1095280..1095396;;5s;;273;273;117;;;;
dir    ;1095670..1097688;;cds;;;;2019;;673;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1181549..1182958;;cds;;1374;*1374;1410;;470;;MBOAT family protein
comp;1184333..1184415;;ttg;;318;318;83;;;318;
dir    ;1184734..1187382;;cds;;;;2649;;883;;DNA polymerase I
;;;;;;;;;;;
dir   ;1835768..1837498;;cds;;109;109;1731;;577;109;Na+/H+ antiporter NhaC family protein
dir   ;1837608..1837688;;cta;;231;231;81;;;;
<dir   ;1837920..1838093;;cds;;;;174;;58;;HXXEE domain-containing protein
;;;;;;;;;;;
dir   ;2981767..2982444;;cds;;159;159;678;;226;159;sortase SrtB
comp;2982604..2982678;;aca;@3;94;;75;;;;
comp;2982773..2985672;;23s;;184;;2900;;;;
comp;2985857..2987364;;16s;;340;340;1508;;;;
dir   ;2987705..2988643;;cds;;;;939;;313;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
comp;3787361..3788431;;cds;;454;*454;1071;;357;;ABC transporter ATP-binding protein
comp;3788886..3789002;;5s;;126;;117;;;;
comp;3789129..3792028;;23s;;281;;2900;;;;
comp;3792310..3793817;;16s;;191;191;1508;;;191;
comp;3794009..3794587;;cds;;;;579;;193;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;3944262..3944453;;cds;;119;119;192;;64;119;DUF378 domain-containing protein
comp;3944573..3944689;;5s;;126;;117;;;;
comp;3944816..3947715;;23s;;217;;2900;;;;
comp;3947933..3949440;;16s;;282;282;1508;;;;
comp;3949723..3950004;;cds;;221;221;282;;94;;hp
comp;3950226..3951755;;cds;;;;1530;;510;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4084445..4085437;;cds;;382;*382;993;;331;;DNA replication protein DnaC
comp;4085820..4085894;;aca;;33;;75;;;;
comp;4085928..4086003;;gta;;4;;76;;;;
comp;4086008..4086082;;gaa;;6;;75;;;;
comp;4086089..4086164;;aaa;;326;326;76;;;326;
comp;4086491..4087780;;cds;;;;1290;;430;;adenylosuccinate synthase

cdc cumuls[modifier | modifier le wikicode]

cdc cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;;0;1;1;1;1;100;3
;16 23 5s 0;3;20;2;61;50;1;20;0;200;5
;16 gca 235;3;40;1;4;100;3;40;0;300;7
;16 23 5s a;2;60;;1;150;3;60;0;400;5
;max a;43;80;;0;200;4;80;1;500;3
;a doubles;2;100;;2;250;4;100;1;600;3
;autres;2;120;;0;300;4;120;2;700;1
;total aas;75;140;;0;350;4;140;1;800;2
sans ;opérons;5;160;;0;400;2;160;1;900;1
;1 aa;4;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;1;200;1;1100;0
;a doubles;0;;;0;;5;;4;;1
;total aas;8;;3;68;;32;;13;;31
total aas;;83;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;14;12;;313;;165;;378
;;;variance;;15;;283;;94;;259
sans jaune;;;moyenne;;9;;206;;;;286
;;;variance;;5;;107;;;;144

cdc blocs[modifier | modifier le wikicode]

7.11.19 Tanger;;;;;;;;;;;;;;
cdc blocs;groupes;;types;;;;absents;;;;;;;
;cds;281;I;;;;;II;;III;;IV;IV1;IV2
IV2;16s;279;;;;;;;;;;;;
;23s;131;CDS;583;454;119;;cds;239;;;;;
;5s;6;16s;311;126;126;;16s;320;cds;159;cds;505;281
;aac;4;23s;126;281;217;;23s;91;aca;94;16s;279;279
;**16aas;3;5s;177;191;282;;gga;8;23s;184;23s;180;131
;ttc;7;CDS;;;;;5s;273;16s;340;5s;6;6
;atgj;114;;;;;;cds;;cds;;aac;6;4
VIII1;16s;68;;;;;;;;;;;;
;gca;271;;;;;;V;;V2;VI;VI1;VII;VII1
;23s;126;;;;;;;;;;;;
;5s;213;;;;;;;;;;;;
;cds;372;;;;;;;;;;;;
;cds;21;;;;;;VIII;VIII1;IX;;X;X1;
;cds;776;;;;;;;;;;cds;21;
X1;16s;52;;;;;;atgj;114;cds;179;cds;776;
;gca;373;;;;;;16s;68;16s;52;16s;52;
;23s;126;;;;;;gca;271;gca;249;gca;373;
;5s;7;;;;;;23s;126;23s;111;23s;126;
;aac;5;;;;;;5s;213;5s;126;5s;7;
;**7aas;9;;;;;;cds;372;cds;;aac;5;
;aga;975;;;;;;;;;;;;
;cds;;;;;;;;;;;;;

cdc psor[modifier | modifier le wikicode]

cdc-psor  comparaison;;7.11.19 Tanger;;;comparaisons internes cdc, psor;;;;
cdc;intercal;psor;intercal;diff;cdc;intercal;cdc;intercal;diff
cds;505;CDS;309;;cds;505;cds;281;
16s;279;16s;196;;16s;279;16s;279;
23s;180;23s;122;;23s;180;23s;131;
5s;6;5s;5;;5s;6;5s;6;
aac;6;tta;13;;aac;6;aac;4;
tta;15;atg;15;-2;tta;15;gaa;5;
atgf;7;gaa;9;8;atgf;7;gta;5;
gaa;9;gga;6;0;gaa;9;gac;10;
gga;5;gta;5;1;gga;5;aca;14;
gta;5;gac;16;;gta;5;tac;9;0
gac;9;aac;4;;gac;9;gga;10;1
aca;14;aca;4;-10;aca;14;aga;9;0
tac;8;tac;15;7;tac;8;caa;11;
cta;29;cta;14;-15;cta;29;aaa;2;
aga;7;aga;7;0;aga;7;tca;17;2
caa;88;caa;11;;caa;88;agc;8;
tca;3;aaa;6;;tca;3;cca;85;
ttc;6;tca;3;0;ttc;6;tgg;60;
atgj;11;ttc;9;3;atgj;11;cca;6;
atgi;23;atg;8;-3;atgi;23;atc;3;
cca;7;atg;21;-2;cca;7;ttc;7;
cac;8;cca;6;-1;cac;8;atgj;114;
aaa;7;cac;4;;aaa;7;16s;;
tgc;6;tgc;25;;tgc;6;cds;776;
aac;5;tta;13;-2;aac;5;16s;52;
tta;15;atg;15;8;tta;15;gca;373;
atgf;7;gaa;9;0;atgf;7;23s;126;
gaa;9;gga;6;1;gaa;9;5s;7;
gga;5;gta;5;0;gga;5;aac;5;
gta;5;gac;16;;gta;5;tta;15;0
gac;9;aac;4;;gac;9;atgf;7;1
aca;14;aca;4;-10;aca;14;gaa;14;0
tac;9;tac;15;6;tac;9;gga;5;
cta;23;cta;11;-12;cta;23;gta;5;
ggc;24;ggc;13;-11;ggc;24;gac;10;
aga;9;aga;7;-2;aga;9;ggc;9;0
caa;8;caa;11;3;caa;8;aga;975;3
aaa;2;aaa;6;4;aaa;2;cds;;0
tca;3;tca;3;0;tca;3;;;
ttc;6;ttc;9;3;ttc;6;;;
atgj;11;atg;8;-3;atgj;11;;;
atgi;17;atg;21;;atgi;17;;;
cac;8;cca;6;;cac;8;;;
aaa;7;cac;9;1;aaa;7;;;
tgc;7;aaa;21;14;tgc;7;;;
cgt;12;tgc;6;-1;cgt;12;;;
gta;75;cgt;10;-2;gta;75;;;
cds;;gta;162;;cds;;;;
;;CDS;;;;;;;
;;;;;psor;;psor;intercal;diff
cds;776;;;;CDS;309;CDS;239;
16s;52;;;;16s;196;16s;196;
gca;373;;;;23s;122;23s;213;
23s;126;;;;5s;5;5s;5;
5s;7;atg;138;;tta;13;tta;13;0
aac;5;16s;109;;atg;15;atg;15;0
tta;15;gca;112;;gaa;9;gaa;9;0
atgf;7;23s;40;;gga;6;gga;6;0
gaa;14;5s;5;;gta;5;gta;5;0
gga;5;gaa;8;;gac;16;gac;16;0
gta;5;gta;5;0;aac;4;aac;31;
gac;10;gac;9;-1;aca;4;aac;4;
ggc;9;ggc;7;-2;tac;15;aca;4;0
aga;975;aga;142;;cta;14;tac;11;-4
cds;;CDS;;;aga;7;gga;19;5
;;;;;caa;11;aga;6;-1
cds;281;CDS;239;;aaa;6;caa;12;1
16s;279;16s;196;;tca;3;aaa;6;0
23s;131;23s;213;;ttc;9;tca;11;
5s;6;5s;5;;atg;8;agc;6;
aac;4;tta;13;;atg;21;cca;6;
gaa;5;atg;15;;cca;6;atg;11;
gta;5;gaa;9;;cac;4;tgg;31;
gac;10;gga;6;;tgc;25;cca;6;
aca;14;gta;5;;tta;13;atc;6;0
tac;9;gac;16;;atg;15;ttc;13;0
gga;10;aac;31;;gaa;9;atg;138;0
aga;9;aac;4;;gga;6;16s;;0
caa;11;aca;4;-10;gta;5;atg;138;0
aaa;2;tac;11;2;gac;16;16s;109;0
tca;17;gga;19;9;aac;4;gca;112;
agc;8;aga;6;-3;aca;4;23s;40;0
cca;85;caa;12;1;tac;15;5s;5;
tgg;60;aaa;6;4;cta;11;gaa;8;
cca;6;tca;11;-6;ggc;13;gta;5;
atc;3;agc;6;-2;aga;7;gac;9;-1
ttc;7;cca;6;;caa;11;ggc;7;1
atgj;114;atg;11;;aaa;6;aga;142;0
16s;;tgg;31;-29;tca;3;CDS;;
;;cca;6;0;ttc;9;;;
;;atc;6;3;atg;8;;;
;;ttc;13;6;atg;21;;;
;;atg;138;;cca;6;;;
;;16s;;;cac;9;;;
;;;;;aaa;21;;;
;;CDS;129;;tgc;6;;;
;;gta;8;;cgt;10;;;
;;gaa;20;;gta;162;;;
;;aaa;10;;CDS;;;;
cds;382;aca;10;;;;;;
aca;33;gac;7;;;;;;
gta;4;gta;9;5;;;;;
gaa;6;gaa;5;-1;;;;;
aaa;326;aaa;289;;;;;;
cds;;CDS;;;;;;;
;;;;;;;;;
cdc-psor  coservation des cds;;;;;fréquence des diff psor-cdc des intercalaires;;;;
cdc;intercal;psor;intercal;protéines;;gamme;fréquence;;
cds;0;CDS;3;151 – 152;;-15;2;;
tcc;37;tcc;27;;;-14;;;
ncRNA;76;ncRNA;152;547 – 546;;-13;;;
cds;;CDS;;;;-12;1;;
;;;;;;-11;1;;
cds;1374;CDS;41;470 – 1177;;-10;3;;
ttg;318;ttg;138;883 – 881;;-9;;;
cds;;CDS;;;;-8;;;
;;;;;;-7;;;
cds;109;CDS;111;577 – 1076;;-6;1;;
cta;231;cta;426;;;-5;;;
cds;;CDS;;58 – 577;;-4;;;
;;;;;;-3;3;;
cds;258;CDS;37;255 – 302;;-2;7;;
agc;87;agc;120;;;-1;4;;
cds;;CDS;;263 – 100;;0;8;;
;;;;;;1;4;;
;;CDS;306;62;;2;1;;
;;cta;404;422;;3;4;;
;;CDS;;;;4;2;;
;;;;;;5;1;;
;;CDS;135;;;6;2;;
;;other;258;;;7;1;;
;;CDS;;;;8;2;;
;;;;;;9;1;;
;;CDS;195;;;10;;;
;;tga;37;;;11;;;
;;CDS;;;;12;;;
;;;;;;13;;;
;;CDS;71;;;14;1;;
;;tgc;12;;;15;;;
;;aac;3;;;;;;
;;aca;285;;;total;49;;
;;CDS;;;;sous t.  -2+2;24;;

cdc8[modifier | modifier le wikicode]

cdc8 opérons[modifier | modifier le wikicode]

28.6%GC;11.9.19 Paris;16s  16 ;110 aas;doubles;intercalaires;CDS;aa;avec aa;pbs;CDS dirigé;protéines
Peptoclostridium difficile M68;;;;;;;;;;;
dir   ;4299490..4300134;;cds;;214;214;;;645;;tyrosine-type recombinase/integrase
dir   ;4300349..4300807;;cds;@1;554;*554;;;459;;helix-turn-helix domain-containing protein
dir   ;4301362..4303101;;cds;;0;0;;;*1740;;hypothetical protein
dir   ;4303102..4303305;;cds;;167;167;;;204;;hp
dir   ;4303473..4304299;;23s°;;132;;;;827;;
dir   ;4304432..4304548;;5s;+;6;;;;117;;
dir   ;4304555..4304629;;aac;;4;;;4;75;;
dir   ;4304634..4304708;;gaa;2 cca;5;;;5;75;;
dir   ;4304714..4304789;;gta;;5;;;5;76;;
dir   ;4304795..4304871;;gac;;11;;;11;77;;
dir   ;4304883..4304957;;aca;;14;;;14;75;;
dir   ;4304972..4305056;;tac;;9;;;9;85;;
dir   ;4305066..4305139;;gga;;10;;;10;74;;
dir   ;4305150..4305226;;aga;;9;;;9;77;;
dir   ;4305236..4305311;;caa;;11;;;11;76;;
dir   ;4305323..4305398;;aaa;;2;;;2;76;;
dir   ;4305401..4305489;;tca;;18;;;18;89;;
dir   ;4305508..4305598;;agc;;8;;;8;91;;
dir   ;4305607..4305683;;cca;;85;;;*85;77;;
dir   ;4305769..4305844;;tgg;;60;;;*60;76;;
dir   ;4305905..4305981;;cca;;5;;;5;77;;
dir   ;4305987..4306063;;atc;;3;;;3;77;;
dir   ;4306067..4306142;;ttc;;7;;;7;76;;
dir   ;4306150..4306226;;atgj;;114;;;;77;;
dir   ;4306341..4307538;;16s;;0;0;;;1198;0;
dir   ;4307539..4308225;;cds;;100;100;;;687;;xylose isomerase
dir   ;1..796;4308325;23s°;;181;;;;796;;
dir   ;978..1094;;5s;;6;;;;117;;
dir   ;1101..1175;;aac;+;6;;;6;75;;
dir   ;1182..1267;;tta;3 aaa;15;;;15;86;;
dir   ;1283..1358;;atgf;3 gta;7;;;7;76;;
dir   ;1366..1440;;gaa;;9;;;9;75;;
dir   ;1450..1523;;gga;;5;;;5;74;;
dir   ;1529..1604;;gta;;5;;;5;76;;
dir   ;1610..1686;;gac;;9;;;9;77;;
dir   ;1696..1770;;aca;;14;;;14;75;;
dir   ;1785..1869;;tac;;10;;;10;85;;
dir   ;1880..1963;;cta;;28;;;28;84;;
dir   ;1992..2068;;aga;;7;;;7;77;;
dir   ;2076..2151;;caa;;89;;;*89;76;;
dir   ;2241..2329;;tca;;3;;;3;89;;
dir   ;2333..2408;;ttc;;6;;;6;76;;
dir   ;2415..2491;;atgj;;11;;;11;77;;
dir   ;2503..2579;;atgi;;29;;;29;77;;
dir   ;2609..2685;;cca;;7;;;7;77;;
dir   ;2693..2769;;cac;;8;;;8;77;;
dir   ;2778..2853;;aaa;;7;;;7;76;;
dir   ;2861..2934;;tgc;;6;;;6;74;;
dir   ;2941..3015;;aac;;6;;;6;75;;
dir   ;3022..3107;;tta;;15;;;15;86;;
dir   ;3123..3198;;atgf;;7;;;7;76;;
dir   ;3206..3280;;gaa;;9;;;9;75;;
dir   ;3290..3363;;gga;;5;;;5;74;;
dir   ;3369..3444;;gta;;5;;;5;76;;
dir   ;3450..3526;;gac;;9;;;9;77;;
dir   ;3536..3610;;aca;;14;;;14;75;;
dir   ;3625..3709;;tac;;9;;;9;85;;
dir   ;3719..3802;;cta;;24;;;24;84;;
dir   ;3827..3901;;ggc;;24;;;24;75;;
dir   ;3926..4002;;aga;;9;;;9;77;;
dir   ;4012..4087;;caa;;8;;;8;76;;
dir   ;4096..4171;;aaa;;2;;;2;76;;
dir   ;4174..4262;;tca;;3;;;3;89;;
dir   ;4266..4341;;ttc;;6;;;6;76;;
dir   ;4348..4424;;atgj;;11;;;11;77;;
dir   ;4436..4512;;atgi;;17;;;17;77;;
dir   ;4530..4606;;cac;;8;;;8;77;;
dir   ;4615..4690;;aaa;;7;;;7;76;;
dir   ;4698..4771;;tgc;;7;;;7;74;;
dir   ;4779..4855;;cgt;;12;;;12;77;;
dir   ;4868..4943;;gta;;75;75;;;76;75;
dir   ;5019..5432;;cds;;308;308;;;414;;hp
dir   ;5741..9172;;cds;;;;;;*3432;;pyruvate carboxylase
;;;;;;;;;;;
dir   ;94032..94736;;cds;;281;281;;;705;281;N-acetylmuramoyl-L-alanine amidase CwlD
dir   ;95018..95994;;16s°;;100;;;;977;;
dir   ;96095..97613;;23s°;;126;;;;1519;;
dir   ;97740..97856;;5s;;7;;;;117;;
dir   ;97864..97938;;aac;;6;;;6;75;;
dir   ;97945..98030;;tta;;15;;;15;86;;
dir   ;98046..98121;;atgf;;7;;;7;76;;
dir   ;98129..98203;;gaa;;8;;;8;75;;
dir   ;98212..98285;;gga;;4;;;4;74;;
dir   ;98290..98365;;gta;;5;;;5;76;;
dir   ;98371..98447;;gac;;10;;;10;77;;
dir   ;98458..98532;;ggc;;9;;;9;75;;
dir   ;98542..98615;;aga;;954;*954;;;74;;
dir   ;99570..100409;;cds;;;;;;840;;TIGR00159 family protein
;;;;;;;;;;;
dir   ;306829..309216;;cds;;733;;;;*2388;;cadmium-translocating P-type ATPase
<> comp;309950..310076;;cds;;1;1;;;127;1;glycine/sarcosine/betaine reductase complex  selenoprotein A
dir   ;310078..311313;;23s°;;126;;;;1236;;
dir   ;311440..311556;;5s;;177;177;;;117;;
dir   ;311734..312342;;cds;;;;;;609;;DedA family protein
;;;;;;;;;;;
comp;861856..862620;;cds;;258;258;;;765;;DeoR/GlpR transcriptional regulator
dir   ;862879..862969;;agc;;87;87;;;91;87;
dir   ;863057..863845;;cds;;;;;;789;;flagellar motor protein
;;;;;;;;;;;
dir    ;1106477..1107451;;cds;;238;238;;;975;238;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
dir    ;1107690..1109197;;16s;@2;320;;;;1508;;
dir    ;1109518..1112416;;23s;;91;;;;2899;;
dir    ;1112508..1112581;;gga;;8;;;;74;;
dir    ;1112590..1112706;;5s;;273;273;;;117;;
dir    ;1112980..1114998;;cds;;;;;;*2019;;N-acetylmuramoyl-L-alanine amidase
;;;;;;;;;;;
comp;1196804..1198213;;cds;;1378;*1378;;;*1410;;MBOAT family protein
comp;1199592..1199674;;ttg;;318;318;;;83;318;
dir    ;1199993..1202641;;cds;;;;;;*2649;;DNA polymerase I
;;;;;;;;;;;
dir    ;1850896..1852626;;cds;;109;109;;;*1731;109;Na+/H+ antiporter NhaC family protein
dir    ;1852736..1852816;;cta;;334;334;;;81;;
dir    ;1853151..1853666;;cds;;;;;;516;;HXXEE domain-containing protein
;;;;;;;;;;;
dir    ;3024038..3024715;;cds;;150;150;;;678;150;sortase SrtB
comp;3024866..3024940;;aca;@3;93;;;;75;;
comp;3025034..3027933;;23s;;184;;;;2900;;
comp;3028118..3029625;;16s;;374;374;;;1508;;
dir    ;3030000..3030938;;cds;;;;;;939;;delta-lactam-biosynthetic de-N-acetylase
;;;;;;;;;;;
dir    ;3805298..3806743;;cds;;208;208;;;*1446;;tyrosine-type recombinase/integrase
comp;3806952..3807028;;agg;;61;61;;;77;61;
<comp;3807090..3808790;;cds;;;;;;*1701;;formate dehydrogenase subunit alpha
;;;;;;;;;;;
comp;3875816..3876886;;cds;;452;*452;;;1071;;ABC transporter ATP-binding protein
comp;3877339..3877455;;5s;;125;;;;117;;
comp;3877581..3880480;;23s;;261;;;;2900;;
comp;3880742..3882249;;16s;;190;190;;;1508;190;
comp;3882440..3883018;;cds;;;;;;579;;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
;;;;;;;;;;;
comp;4017523..4017714;;cds;;118;118;;;192;118;DUF378 domain-containing protein
comp;4017833..4017949;;5s;;126;;;;117;;
comp;4018076..4020975;;23s;;321;;;;2900;;
comp;4021297..4022804;;16s;;292;292;;;1508;;
comp;4023097..4023378;;cds;;221;221;;;282;;hp
comp;4023600..4025129;;cds;;;;;;*1530;;lysine--tRNA ligase
;;;;;;;;;;;
dir    ;4135881..4136873;;cds;;383;383;;;993;;DNA replication protein DnaC
comp;4137257..4137331;;aca;;33;;33;;75;;
comp;4137365..4137440;;gta;;4;;4;;76;;
comp;4137445..4137519;;gaa;;6;;6;;75;;
comp;4137526..4137601;;aaa;;331;331;;;76;331;
comp;4137933..4139222;;cds;;;;;;*1290;;adenylosuccinate synthase
;;;;;;;;;;;
dir    ;4178197..4178970;;cds;;179;179;;;774;;SigB/SigF/SigG family RNA polymerase sigma factor
dir    ;4179150..4180587;;16s;;161;;;;1438;;
comp;4180749..4180865;;5s;;201;;;;117;;
comp;4181067..4183959;;23s;;217;;;;2893;;
comp;4184177..4185684;;16s;;108;;;;1508;;
comp;4185793..4185869;;atgi;;11;;;11;77;;
comp;4185881..4185969;;tta;;5;;;;89;;
comp;4185975..4186091;;5s;;201;;;;117;;
comp;4186293..4189192;;23s;;375;;;;2900;;
comp;4189568..4189643;;gca;;52;;;;76;;
comp;4189696..4190959;;16s’;@4;100;;;;1264;;
dir    ;4191060..4192225;;16s’;;52;;;;1166;;
dir    ;4192278..4192353;;gca;;248;;;;76;;
dir    ;4192602..4193197;;23s°;;100;;;;596;;
dir    ;4193298..4193874;;16s°;;321;;;;577;;
dir    ;4194196..4196423;;23s’;;100;;;;2228;;
dir    ;4196524..4197091;;16s°;;320;;;;568;;
dir    ;4197412..4199044;;23s°;;100;;;;1633;;
dir    ;4199145..4201593;;23s’;;126;;;;2449;;
dir    ;4201720..4201836;;5s;;127;127;;;117;127;
dir    ;4201964..4202473;;cds;;;;;;510;;transcription repressor NadR
;;;;;;;;;;;
dir    ;4205417..4205872;;cds;;0;0;;;456;0;nucleoside deaminase
dir    ;4205873..4205964;;tcc;@5;37;;;;92;;
dir    ;4206002..4206266;;ncRNA;;76;76;;;265;;
dir    ;4206343..4207980;;cds;;;;;;*1638;;DNA polymerase III subunit gamma/tau
;;;;;;;;;;;
comp;4209435..4210639;;cds;;496;*496;;;1205;;glycosyl transferase
;4211136..4212643;;16s;;321;;;;1508;;
;4212965..4213127;;23s°;;100;100;;;163;100;
<>comp;4213228..4213849;;cds;;111;;;;622;;CHAP domain-containing protein
;;;;;;;;;;;
comp;4213961..4214620;;cds;;228;228;;;660;228;type A-1 chloramphenicol O-acetyltransferase
dir    ;4214849..4216199;;16s;;321;;;;1351;;
dir    ;4216521..4217008;;23s°;;101;;;;488;;
comp;4217110..4218529;;23s°;;250;;;;1420;;
comp;4218780..4218855;;gca;;52;;;;76;;
comp;4218908..4219471;;16s°;;100;;;;564;;
comp;4219572..4219856;;23s°;;217;;;;285;;
comp;4220074..4221581;;16s;;179;179;;;1508;179;
>comp;4221761..4222206;;cds;;386;386;;;446;386;B/F/G family RNA polymerase sigma-70 factor
dir    ;4222593..4224100;;16s;;321;;;;1508;;
dir    ;4224422..4227321;;23s;;181;;;;2900;;
dir    ;4227503..4227619;;5s;;6;;;;117;;
dir    ;4227626..4227700;;aac;;6;;;6;75;;
dir    ;4227707..4227792;;tta;;15;;;15;86;;
dir    ;4227808..4227883;;atgf;;7;;;7;76;;
dir    ;4227891..4227965;;gaa;;9;;;9;75;;
dir    ;4227975..4228048;;gga;;5;;;5;74;;
dir    ;4228054..4228129;;gta;;5;;;5;76;;
dir    ;4228135..4228211;;gac;;9;;;9;77;;
dir    ;4228221..4228295;;aca;;14;;;14;75;;
dir    ;4228310..4228394;;tac;;10;;;10;85;;
dir    ;4228405..4228488;;cta;;28;;;28;84;;
dir    ;4228517..4228593;;aga;;7;;;7;77;;
dir    ;4228601..4228676;;caa;;89;;;*89;76;;
dir    ;4228766..4228854;;tca;;3;;;3;89;;
dir    ;4228858..4228933;;ttc;;6;;;6;76;;
dir    ;4228940..4229016;;atgj;;11;;;11;77;;
dir    ;4229028..4229104;;atgi;;29;;;29;77;;
dir    ;4229134..4229210;;cca;;7;;;7;77;;
dir    ;4229218..4229294;;cac;;8;;;8;77;;
dir    ;4229303..4229378;;aaa;;353;;;;76;;
comp;4229732..4229848;;5s;;126;;;;117;;
comp;4229975..4232010;;23s’;;582;;;;2036;;
dir    ;4232593..4234098;;16s;@6;217;;;;1506;;
dir    ;4234316..4237215;;23s;;126;;;;2900;;
dir    ;4237342..4237458;;5s;;216;216;;;117;216;
comp;4237675..4238859;;cds;;372;372;;;1185;;pyridoxal phosphate-dependent aminotransferase
dir    ;4239232..4241583;;cds;;21;21;;;*2352;;anaerobic ribonucleoside triphosphate reductase
dir    ;4241605..4242144;;cds;;778;*778;;;540;;anaerobic ribonucleoside-triphosphate reductase activating protein
dir    ;4242923..4244459;;16s;@7;261;;;;1537;;
dir    ;4244721..4247619;;23s;;201;;;;2899;;
dir    ;4247821..4247937;;5s;;5;;;;117;;
dir    ;4247943..4248031;;tta;;11;;;11;89;;
dir    ;4248043..4248119;;atgi;;108;;;;77;;
dir    ;4248228..4249735;;16s;;184;;;;1508;;
dir    ;4249920..4250564;;23s°;;100;100;;;645;100;
<dir    ;4250665..4250923;;cds;;112;112;;;259;112;hp
comp;4251036..4253145;;23s’;;375;;;;2110;;
comp;4253521..4253596;;gca;;52;;;;76;;
comp;4253649..4254226;;16s°;;282;282;;;578;;
dir    ;4254509..4254712;;cds;;12;12;;;204;;hp
dir    ;4254725..4256002;;cds;;;;;;*1278;;phage portal protein

cdc8 cumuls[modifier | modifier le wikicode]

cdc8 cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;21;1;;0;1;4;1;3;100;6
;16 23 5s 0;4;20;2;77;50;2;20;0;200;8
;16 gca 235;2;40;1;6;100;7;40;0;300;11
;16 23 5s a;5;60;;0;150;5;60;0;400;5
;max a;43;80;;1;200;5;80;2;500;5
;a doubles;2;100;;3;250;6;100;3;600;5
;autres;10;120;;0;300;5;120;3;700;1
;total aas;98;140;;0;350;4;140;1;800;1
sans ;opérons;6;160;;0;400;4;160;1;900;1
;1 aa;5;180;;0;450;0;180;1;1000;0
;max a;4;200;;0;500;2;200;1;1100;0
;a doubles;0;;;0;;4;;7;;1
;total aas;9;;3;87;;48;;22;;44
total aas;;108;;;;;;;;;
remarques;;7;;;;;;;;;
avec jaune;;;moyenne;14;14;;256;;155;;330
;;;variance;;16;;252;;109;;234
sans jaune;;;moyenne;;10;;182;;;;208
;;;variance;;6;;117;;;;97

cdc8 blocs[modifier | modifier le wikicode]

cdc8 blocs;;;;;;;;
Bloc type;groupes;intercal;Bloc type;groupes;intercal;Bloc type;groupe;intercal
;cds;554;;cds;150;;cds;496
;cds;0;;aca;93;;16s;321
;cds;168;;23s;184;;23s°;100
;23s°;133;III;16s;374;;cds;111
IV2;5s;7;;cds;;;cds;228
;aac;5;;;;;16s;321
;**16aas;8;;cds;452;;23s°;101
;atgj;115;;5s;125;;23s°;250
IV1;16s;1;;23s;261;;gca;52
;cds;100;I2;16s;190;;16s°;100
;23s°;182;;cds;;;23s°;217
;5s;7;;;;;16s;179
;aac;7;;cds;118;;cds;386
;**41aas;13;;5s;126;IV3;16s;321
;gta;76;;23s;321;;23s;181
;cds;308;I3;16s;292;;5s;6
;cds;;;cds;;;aac;6
;;;;;;;**17aas;8
;cds;281;;cds;179;;aaa;353
;16s°;100;;16s;161;;5s;126
;23s°;126;;5s;201;;23s;582
X1;5s;7;I1;23s;217;I4;16s;217
;aac;6;;16s;108;;23s;126
;**7aas;9;;atgi;11;;5s;216
;aga;954;;tta;5;;cds;372
;cds;;;5s;201;;cds;21
;;;;23s;375;;cds;778
;cds;733;VII1;gca;52;IV4;16s;261
;cds;1;;16s’;100;;23s;201
;23s°;126;;16s’;52;;5s;5
;5s;177;;gca;248;;tta;11
;cds;;;23s°;100;;atgi;108
;;;;16s°;321;;16s;184
;cds;238;;23s;100;;23s°;100
II;16s;320;;16s°;320;;cds;112
;23s;91;;23s°;100;;23s’;375
;gga;8;;23s’;126;;gca;52
;5s;273;;5s;127;;16s°;282
;cds;;;cds;;;cds;

cdc8 cdc psor 43[modifier | modifier le wikicode]

cdc8;43aas;cdc;43aas;;;cdc8;43aas;psor;44aas;
16s;1;;;;;16s;1;;;
cds;100;16s;279;;;cds;100;16s;196;
23s°;181;23s;180;-1;;23s°;181;23s;122;
5s;6;5s;6;0;;5s;6;5s;5;
aac;6;aac;6;0;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;10;tac;8;-2;;tac;10;tac;15;5
cta;28;cta;29;1;;cta;28;cta;14;-14
aga;7;aga;7;0;;aga;7;aga;7;0
caa;89;caa;88;-1;;caa;89;caa;11;
tca;3;tca;3;0;;tca;3;aaa;6;
ttc;6;ttc;6;0;;ttc;6;tca;3;0
atgj;11;atgj;11;0;;atgj;11;ttc;9;3
atgi;29;atgi;23;-6;;atgi;29;atg;8;-3
cca;7;cca;7;0;;cca;7;atg;21;-8
cac;8;cac;8;0;;cac;8;cca;6;-1
aaa;7;aaa;7;0;;aaa;7;cac;4;
tgc;6;tgc;6;0;;tgc;6;tgc;25;
aac;6;aac;5;-1;;aac;6;tta;13;-2
tta;15;tta;15;0;;tta;15;atg;15;8
atgf;7;atgf;7;0;;atgf;7;gaa;9;0
gaa;9;gaa;9;0;;gaa;9;gga;6;1
gga;5;gga;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;9;gac;9;0;;gac;9;aac;4;
aca;14;aca;14;0;;aca;14;aca;4;-10
tac;9;tac;9;0;;tac;9;tac;15;6
cta;24;cta;23;-1;;cta;24;cta;11;-13
ggc;24;ggc;24;0;;ggc;24;ggc;13;-11
aga;9;aga;9;0;;aga;9;aga;7;-2
caa;8;caa;8;0;;caa;8;caa;11;3
aaa;2;aaa;2;0;;aaa;2;aaa;6;4
tca;3;tca;3;0;;tca;3;tca;3;0
ttc;6;ttc;6;0;;ttc;6;ttc;9;3
atgj;11;atgj;11;0;;atgj;11;atg;8;-3
atgi;17;atgi;17;0;;atgi;17;atg;21;
cac;8;cac;8;0;;cac;8;cca;6;
aaa;7;aaa;7;0;;aaa;7;cac;9;1
tgc;7;tgc;7;0;;tgc;7;aaa;21;14
cgt;12;cgt;12;0;;cgt;12;tgc;6;-1
gta;75;gta;75;0;;gta;75;cgt;10;-2
cds;;cds;;;;cds;;gta;162;
;;;;;;;;cds;;

cdc8 cdc psor 18[modifier | modifier le wikicode]

cdc8;18aas;;;;;cdc8;19aas;psor;23aas;
cds;214;;;;;16s;321;16s;196;
cds;554;;;;;23s;181;23s;213;
cds;0;cdc;18aas;;;5s;6;5s;5;
cds;167;16s;279;;;aac;6;tta;13;-2
23s°;132;23s;131;-1;;tta;15;atg;15;8
5s;6;5s;6;0;;atgf;7;gaa;9;0
aac;4;aac;4;0;;gaa;9;gga;6;1
gaa;5;gaa;5;0;;gga;5;gta;5;0
gta;5;gta;5;0;;gta;5;gac;16;
gac;11;gac;10;-1;;gac;9;aac;31;
aca;14;aca;14;0;;aca;14;aac;4;
tac;9;tac;9;0;;tac;10;aca;4;-10
gga;10;gga;10;0;;cta;28;tac;11;
aga;9;aga;9;0;;aga;7;gga;19;
caa;11;caa;11;0;;caa;89;aga;6;-1
aaa;2;aaa;2;0;;tca;3;caa;12;
tca;18;tca;17;-1;;ttc;6;aaa;6;
agc;8;agc;8;0;;atgj;11;tca;11;
cca;85;cca;85;0;;atgi;29;agc;6;
tgg;60;tgg;60;0;;cca;7;cca;6;
cca;5;cca;6;1;;cac;8;atg;11;
atc;3;atc;3;0;;aaa;353;tgg;31;
ttc;7;ttc;7;0;;;;cca;6;
atgj;114;atgj;114;0;;;;atc;6;
;;;;;;;;ttc;13;
;;psor;23aas;;;;;atg;138;
;;16s;196;;;;;;;
cdc8;18aas;23s;213;;;;;cdc8;18aas;
cds;214;5s;5;;;;;cds;214;
cds;554;tta;13;;;;;cds;554;
cds;0;atg;15;;;cdc8;19aas;cds;0;
cds;167;gaa;9;;;16s;321;cds;167;
23s°;132;gga;6;;;23s;181;23s°;132;
5s;6;gta;5;0;;5s;6;5s;6;
aac;4;gac;16;;;aac;6;aac;4;
gaa;5;aac;31;;;tta;15;gaa;5;
gta;5;aac;4;;;atgf;7;gta;5;0
gac;11;aca;4;-10;;gaa;9;gac;11;2
aca;14;tac;11;2;;gga;5;aca;14;0
tac;9;gga;19;9;;gta;5;tac;9;
gga;10;aga;6;-3;;gac;9;gga;10;
aga;9;caa;12;1;;aca;14;aga;9;2
caa;11;aaa;6;4;;tac;10;caa;11;
aaa;2;tca;11;-7;;cta;28;aaa;2;
tca;18;agc;6;-2;;aga;7;tca;18;
agc;8;cca;6;;;caa;89;agc;8;
cca;85;atg;11;;;tca;3;cca;85;
tgg;60;tgg;31;-29;;ttc;6;tgg;60;
cca;5;cca;6;1;;atgj;11;cca;5;
atc;3;atc;6;3;;atgi;29;atc;3;
ttc;7;ttc;13;6;;cca;7;ttc;7;
atgj;114;atg;138;24;;cac;8;atgj;114;
;;;;;;aaa;353;;;

cdc8 cdc psor 9[modifier | modifier le wikicode]

cdc8;18aas;cdc8;9aas;;;cdc8;9aas;cdc;9aas;
cds;214;;;;;cds;281;16s;52;
cds;554;;;;;16s°;100;gca;373;
cds;0;cds;281;;;23s°;126;23s;126;
cds;167;16s°;100;;;5s;7;5s;7;
23s°;132;23s°;126;;;aac;6;aac;5;-1
5s;6;5s;7;;;tta;15;tta;15;0
aac;4;aac;6;;;atgf;7;atgf;7;0
gaa;5;tta;15;;;gaa;8;gaa;14;6
gta;5;atgf;7;;;gga;4;gga;5;1
gac;11;gaa;8;;;gta;5;gta;5;0
aca;14;gga;4;;;gac;10;gac;10;0
tac;9;gta;5;0;;ggc;9;ggc;9;0
gga;10;gac;10;;;aga;954;aga;975;21
aga;9;ggc;9;;;cds;;cds;;
caa;11;aga;954;;;;;;;
aaa;2;cds;;;;cdc8;I4;cdc;VIII1;
tca;18;;;;;;;16s;68;
agc;8;;;;;16s;217;gca;271;
cca;85;;;;;23s;126;23s;126;0
tgg;60;;;;;5s;216;5s;213;-3
cca;5;;;;;cds;372;cds;372;0
atc;3;;;;;cds;21;cds;21;0
ttc;7;;;;;cds;778;cds;776;-2
atgj;114;;;;;16s;261;16s;52;
;;;;;;23s;201;gca;373;
cdc8;19aas;cdc8;9aas;;;5s;5;23s;126;-75
;;cds;281;;;;;5s;7;2
16s;321;16s°;100;;;;;;;
23s;181;23s°;126;;;psor;VII1;cdc8;VII1;
5s;6;5s;7;;;CDS;431;cds;179;
aac;6;aac;6;0;;16s;54;16s;161;
tta;15;tta;15;9;;gca;114;5s;201;
atgf;7;atgf;7;-8;;23s;193;23s;217;
gaa;9;gaa;8;1;;5s;5;16s;108;
gga;5;gga;4;-5;;tta;9;atgi;11;2
gta;5;gta;5;0;;atg;123;tta;5;0
gac;9;gac;10;;;16s;54;5s;201;8
aca;14;ggc;9;;;gca;114;23s;375;261
tac;10;aga;954;;;23s;193;gca;52;-2
cta;28;cds;;;;5s;5;16s’;100;-23
aga;7;;;;;tta;9;16s’;52;
caa;89;;;;;atg;123;gca;248;
tca;3;;;;;16s;54;23s°;100;-2
ttc;6;;;;;gca;114;16s°;321;134
atgj;11;;;;;23s;78;23s;100;
atgi;29;;;;;5s;100;16s°;320;
cca;7;;;;;CDS;;23s°;100;
cac;8;;;;;;;23s’;126;
aaa;353;;;;;;;5s;127;
;;;;;;;;cds;;

cdc8 cdc protéines[modifier | modifier le wikicode]

Alignement sur cdc[modifier | modifier le wikicode]
;cdc;;;;;;cdc8;;;;;
ordre;Peptoclostridium difficile CD196;;;;;;Peptoclostridium difficile M68;;;;;
0;dir    ;9857..10630;cds;179;774;SigB;dir    ;4194196..4196423;23s’;100;2228;
;dir    ;10810..12317;16s;52;1508;;dir    ;4196524..4197091;16s°;320;568;
;dir    ;12370..12445;gca;249;76;;dir    ;4197412..4199044;23s°;100;1633;
1;dir    ;12695..15596;23s;111;2902;;dir    ;4199145..4201593;23s’;126;2449;
;dir    ;15708..15824;5s;126;117;;dir    ;4201720..4201836;5s;127;117;
;dir    ;15951..16460;cds;11;510;NadR;dir    ;4201964..4202473;cds;11;510;NadR
;dir    ;16472..17353;cds;457;882;mecano;dir    ;4202485..4203366;cds;458;882;mecano
;dir    ;17811..19082;cds;319;1272;S-ligase;dir    ;4203825..4205096;cds;320;1272;S-ligase
;dir   ;19402..19857;cds;0;456;Nuc-de;dir    ;4205417..4205872;cds;0;456;Nuc-de
;dir   ;19858..19949;tcc;37;92;;dir    ;4205873..4205964;tcc;37;92;
2;dir   ;19987..20251;ncRNA;76;265;;dir    ;4206002..4206266;ncRNA;76;265;
;dir   ;20328..21965;cds;;1638;III-tau;dir    ;4206343..4207980;cds;;1638;III-tau
;;;;;;;;;;;;
;comp;23419..24624;cds;505;1206;Glyco-tr;dir   ;4306341..4307538;16s;0;1198;
;dir    ;25130..26637;16s;279;1508;;dir   ;4307539..4308225;cds;100;687;xylose
;dir    ;26917..29816;23s;180;2900;;dir   ;1..796;23s°;181;796;
;dir    ;29997..30113;5s;6;117;;dir   ;978..1094;5s;6;117;
3;dir    ;30120..30194;aac;6;75;;dir   ;1101..1175;aac;6;75;
;dir    ;;**41aas;12;;;dir   ;;**41aas;12;;
;dir    ;33877..33952;gta;75;76;;dir   ;4868..4943;gta;75;76;
;dir    ;34028..34441;cds;308;414;hp-414;dir   ;5019..5432;cds;308;414;hp-414
;dir    ;34750..38181;cds;;3432;pyruvate;dir   ;5741..9172;cds;;3432;pyruvate
;;;;;;;;;;;;
;;;;;;;dir;4300349..4300807;cds;554;459;Helix
;dir    ;127011..127715;cds;281;705;CwlD;dir   ;4301362..4303101;cds;0;1740;hp-1740
;dir    ;127997..129505;16s;279;1509;;dir   ;4303102..4303305;cds;167;204;hp-204
;dir    ;129785..132685;23s;131;2901;;dir   ;4303473..4304299;23s°;132;827;
;dir    ;132817..132933;5s;6;117;;dir   ;4304432..4304548;5s;6;117;
4;dir    ;132940..133014;aac;4;75;;dir   ;4304555..4304629;aac;4;75;
;dir    ;;**16aas;8;;;dir   ;;**16aas;8;;
;dir    ;134534..134610;atgj;114;77;;dir   ;4306150..4306226;atgj;114;77;
;dir    ;134725..136115;16s;68;1391;;;;;;;
;dir    ;136184..136259;gca;271;76;;dir    ;4232593..4234098;16s;217;1506;
;dir    ;136531..139430;23s;126;2900;;dir    ;4234316..4237215;23s;126;2900;
;dir    ;139557..139673;5s;213;117;;dir    ;4237342..4237458;5s;216;117;
;comp;139887..141071;cds;372;1185;B6;comp;4237675..4238859;cds;372;1185;B6
5;dir    ;141444..143795;cds;21;2352;Art-red;dir    ;4239232..4241583;cds;21;2352;Art-red
;dir    ;143817..144356;cds;776;540;Art-reda;dir    ;4241605..4242144;cds;778;540;Art-reda
;dir    ;145133..146640;16s;52;1508;;dir   ;94032..94736;cds;281;705;CwlD
;dir    ;146693..146768;gca;373;76;;dir   ;95018..95994;16s°;100;977;
;dir    ;147142..150041;23s;126;2900;;dir   ;96095..97613;23s°;126;1519;
;dir    ;150168..150284;5s;7;117;;dir   ;97740..97856;5s;7;117;
6;dir    ;150292..150366;aac;5;75;;dir   ;97864..97938;aac;6;75;
;dir    ;;**7aas;6;;;dir   ;;**7aas;6;;
;dir    ;150976..151049;aga;975;74;;dir   ;98542..98615;aga;954;74;
;dir    ;152025..152864;cds;;840;TIGR;dir   ;99570..100409;cds;;840;TIGR
;;;;;;;;;;;;
;dir   ;378341..380728;cds;583;2388;cad;dir   ;306829..309216;cds;733;2388;cad
;dir   ;381312..382819;16s;311;1508;;<> comp;309950..310076;cds;1;127;seleno
;dir   ;383131..386030;23s;126;2900;;dir   ;310078..311313;23s°;126;1236;
7;dir   ;386157..386273;5s;177;117;;dir   ;311440..311556;5s;177;117;
;dir   ;386451..387059;cds;;609;DedA;dir   ;311734..312342;cds;;609;DedA
;;;;;;;;;;;;
;comp;833130..833894;cds;258;765;DeoR;comp;861856..862620;cds;258;765;DeoR
8;dir    ;834153..834243;agc;87;91;;dir   ;862879..862969;agc;87;91;
;dir    ;834331..835119;cds;;789;flagellar;dir   ;863057..863845;cds;;789;flagellar
;;;;;;;;;;;;
;dir    ;1089165..1090139;cds;239;975;Mannosyl;dir    ;1106477..1107451;cds;238;975;Mannosyl
;dir    ;1090379..1091886;16s;320;1508;;dir    ;1107690..1109197;16s;320;1508;
;dir    ;1092207..1095106;23s;91;2900;;dir    ;1109518..1112416;23s;91;2899;
;dir    ;1095198..1095271;gga;8;74;;dir    ;1112508..1112581;gga;8;74;
9;dir    ;1095280..1095396;5s;273;117;;dir    ;1112590..1112706;5s;273;117;
;dir    ;1095670..1097688;cds;;2019;Ala amid;dir    ;1112980..1114998;cds;;2019;Ala amid
;;;;;;;;;;;;
;comp;1181549..1182958;cds;1374;1410;MBOAT;comp;1196804..1198213;cds;1378;1410;MBOAT
10;comp;1184333..1184415;ttg;318;83;;comp;1199592..1199674;ttg;318;83;
;dir    ;1184734..1187382;cds;;2649;PolyI;dir    ;1199993..1202641;cds;;2649;PolyI
;;;;;;;;;;;;
;dir   ;1835768..1837498;cds;109;1731; NhaC;dir    ;1850896..1852626;cds;109;1731; NhaC
11;dir   ;1837608..1837688;cta;231;81;;dir    ;1852736..1852816;cta;334;81;
;<dir   ;1837920..1838093;cds;;174;HXXEE;dir    ;1853151..1853666;cds;;516;HXXEE
;;;;;;;;;;;;
;dir   ;2981767..2982444;cds;159;678;SrtB;dir    ;3024038..3024715;cds;150;678;SrtB
;comp;2982604..2982678;aca;94;75;;comp;3024866..3024940;aca;93;75;
;comp;2982773..2985672;23s;184;2900;;comp;3025034..3027933;23s;184;2900;
12;comp;2985857..2987364;16s;340;1508;;comp;3028118..3029625;16s;374;1508;
;dir   ;2987705..2988643;cds;;939;lactam;dir    ;3030000..3030938;cds;;939;lactam
;;;;;;;;;;;;
;comp;3787361..3788431;cds;454;1071;ABC;comp;3875816..3876886;cds;452;1071;ABC
;comp;3788886..3789002;5s;126;117;;comp;3877339..3877455;5s;125;117;
13;comp;3789129..3792028;23s;281;2900;;comp;3877581..3880480;23s;261;2900;
;comp;3792310..3793817;16s;191;1508;;comp;3880742..3882249;16s;190;1508;
;comp;3794009..3794587;cds;;579;precorrin;comp;3882440..3883018;cds;;579;precorrin
;;;;;;;;;;;;
;comp;3944262..3944453;cds;119;192;DUF378;comp;4017523..4017714;cds;118;192;DUF378
;comp;3944573..3944689;5s;126;117;;comp;4017833..4017949;5s;126;117;
14;comp;3944816..3947715;23s;217;2900;;comp;4018076..4020975;23s;321;2900;
;comp;3947933..3949440;16s;282;1508;;comp;4021297..4022804;16s;292;1508;
;comp;3949723..3950004;cds;221;282;hp-282;comp;4023097..4023378;cds;221;282;hp-282
;comp;3950226..3951755;cds;;1530;K-ligase;comp;4023600..4025129;cds;;1530;K-ligase
;;;;;;;;;;;;
;dir    ;4084445..4085437;cds;382;993; DnaC;dir    ;4135881..4136873;cds;383;993; DnaC
;comp;4085820..4085894;aca;33;75;;comp;4137257..4137331;aca;33;75;
15;comp;4085928..4086003;gta;4;76;;comp;4137365..4137440;gta;4;76;
;comp;4086008..4086082;gaa;6;75;;comp;4137445..4137519;gaa;6;75;
;comp;4086089..4086164;aaa;326;76;;comp;4137526..4137601;aaa;331;76;
;comp;4086491..4087780;cds;;1290;succinate;comp;4137933..4139222;cds;;1290;succinate
Alignement sur cdc8[modifier | modifier le wikicode]
;cdc8;;;;;;;cdc8;;;;;;;psor;;;;
ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;;ordre cdc;sens;adresse;gène;intercal;pbs;abrégé;adresse;gène;intercal;pbs;abrégé
insert;dir   ;4299490..4300134;cds;214;645;Y-r1;;0;dir    ;4178197..4178970;cds;179;774;SigB;127845..129260;CDS;100;1416;R-deca
insert;dir   ;4300349..4300807;cds;554;459;Helix;;insert;dir    ;4179150..4180587;16s;161;1438;;127628..127744;5s;78;;
;dir   ;4301362..4303101;cds;0;1740;hp-1740;;insert;comp;4180749..4180865;5s;201;117;;124628..127549;23s;114;;
;dir   ;4303102..4303305;cds;167;204;hp-204;;insert;comp;4181067..4183959;23s;217;2893;;124438..124513;gca;54;;
;dir   ;4303473..4304299;23s°;132;827;;;insert;comp;4184177..4185684;16s;108;1508;;122877..124383;16s;123;;
4;dir   ;4304432..4304548;5s;6;117;;;insert;comp;4185793..4185869;atgi;11;77;;122677..122753;atg;9;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4185881..4185969;tta;5;89;;122579..122667;tta;5;;
;dir   ;4304634..4304708;gaa;5;75;;;insert;comp;4185975..4186091;5s;201;117;;122457..122573;5s;193;;
;dir   ;4304555..4304629;aac;4;75;;;insert;comp;4186293..4189192;23s;375;2900;;119347..122263;23s;114;;
;dir   ;;**16aas;8;;;;insert;comp;4189568..4189643;gca;52;76;;119157..119232;gca;54;;
;dir   ;4306150..4306226;atgj;114;77;;;insert;comp;4189696..4190959;16s’;100;1264;;117596..119102;16s;123;;
;dir   ;4306341..4307538;16s;0;1198;;;insert;dir    ;4191060..4192225;16s’;52;1166;;117396..117472;atg;9;;
;dir   ;4307539..4308225;cds;100;687;xylose;;insert;dir    ;4192278..4192353;gca;248;76;;117298..117386;tta;5;;
;dir   ;1..796;23s°;181;796;;;insert;dir    ;4192602..4193197;23s°;100;596;;117176..117292;5s;193;;
3;dir   ;978..1094;5s;6;117;;;insert;dir    ;4193298..4193874;16s°;321;577;;114067..116982;23s;114;;
;dir    ;1101..1175;aac;6;75;;;insert;dir    ;4194196..4196423;23s’;100;2228;;113877..113952;gca;54;;
;dir    ;;**41aas;12;;;;;dir    ;4196524..4197091;16s°;320;568;;112316..113822;16s;431;;
;dir    ;4868..4943;gta;75;76;;;1;dir    ;4197412..4199044;23s°;100;1633;;111345..111884;CDS;;540;Art-reda
;dir    ;5019..5432;cds;308;414;hp-414;;;dir    ;4199145..4201593;23s’;126;2449;;;;;;
;dir    ;5741..9172;cds;;3432;pyruvate ;;;dir    ;4201720..4201836;5s;127;117;;;;;;
;;;;;;;;;dir    ;4201964..4202473;cds;11;510;NadR;;;;;
;dir   ;94032..94736;cds;281;705;CwlD;;;dir    ;4202485..4203366;cds;458;882;mecano;;;;;
;dir   ;95018..95994;16s°;100;977;;;;dir    ;4203825..4205096;cds;320;1272;S-ligase;;;;;
;dir   ;96095..97613;23s°;126;1519;;;;dir    ;4205417..4205872;cds;0;456;Nuc-de;;;;;
6;dir   ;97740..97856;5s;7;117;;;;dir    ;4205873..4205964;tcc;37;92;;;;;;
;dir   ;97864..97938;aac;6;75;;;2;dir    ;4206002..4206266;ncRNA;76;265;;;;;;
;dir   ;;**7aas;6;;;;;dir    ;4206343..4207980;cds;;1638;III-tau;;;;;
;dir   ;98542..98615;aga;954;74;;;;;;;;;;;;;;
;dir   ;99570..100409;cds;;840;TIGR;;insert;comp;4209435..4210639;cds;496;1205;Glyco-tr;;;;;
;;;;;;;;insert;;4211136..4212643;16s;321;1508;;;;;;
;<> cp;309950..310076;cds;1;127;seleno;;insert;;4212965..4213127;23s°;100;163;;;;;;
;dir   ;310078..311313;23s°;126;1236;;;insert;<>comp;4213228..4213849;cds;;622;CHAP;;;;;
7;dir   ;311440..311556;5s;177;117;;;insert;;;;;;;;;;;
;dir   ;311734..312342;cds;;609;DedA;;insert;comp;4213961..4214620;cds;228;660;A-1chlor;;;;;
;;;;;;;;insert;dir    ;4214849..4216199;16s;321;1351;;;;;;
;comp;861856..862620;cds;258;765;DeoR;;insert;dir    ;4216521..4217008;23s°;101;488;;;;;;
8;dir   ;862879..862969;agc;87;91;;;insert;comp;4217110..4218529;23s°;250;1420;;;;;;
;dir   ;863057..863845;cds;;789;flagellar;;insert;comp;4218780..4218855;gca;52;76;;;;;;
;;;;;;;;insert;comp;4218908..4219471;16s°;100;564;;;;;;
;dir    ;1106477..1107451;cds;238;975;Mannosyl;;insert;comp;4219572..4219856;23s°;217;285;;;;;;
;dir    ;1107690..1109197;16s;320;1508;;;insert;comp;4220074..4221581;16s;179;1508;;;;;;
;dir    ;1109518..1112416;23s;91;2899;;;insert;>comp;4221761..4222206;cds;386;446;SigB2;3452349..3452552;CDS;239;204;hp-204
;dir    ;1112508..1112581;gga;8;74;;;insert;dir    ;4222593..4224100;16s;321;1508;;3450603..3452109;16s;196;;
9;dir    ;1112590..1112706;5s;273;117;;;insert;dir    ;4224422..4227321;23s;181;2900;;3447492..3450406;23s;213;;
;dir    ;1112980..1114998;cds;;2019;Ala amid;;insert;dir    ;4227503..4227619;5s;6;117;;3447162..3447278;5s;5;;
;;;;;;;;insert;dir    ;4227626..4227700;aac;6;75;;3447068..3447156;tta;13;;
;comp;1196804..1198213;cds;1378;1410;MBOAT;;insert;dir    ;4227707..4227792;tta;15;86;;3446979..3447054;atg;15;;
10;comp;1199592..1199674;ttg;318;83;;;insert;dir    ;4227808..4227883;atgf;7;76;;3446889..3446963;gaa;9;;
;dir    ;1199993..1202641;cds;;2649;PolyI;;insert;dir    ;4227891..4227965;gaa;9;75;;3446806..3446879;gga;6;;
;;;;;;;;insert;dir    ;4227975..4228048;gga;5;74;;3446724..3446799;gta;5;;
;dir    ;1850896..1852626;cds;109;1731; NhaC;;insert;dir    ;4228054..4228129;gta;5;76;;3446642..3446718;gac;16;;
11;dir    ;1852736..1852816;cta;334;81;;;insert;dir    ;4228135..4228211;gac;9;77;;3446550..3446625;aac;31;;
;dir    ;1853151..1853666;cds;;516;HXXEE;;insert;dir    ;4228221..4228295;aca;14;75;;3446443..3446518;aac;4;;
;;;;;;;;insert;dir    ;4228310..4228394;tac;10;85;;3446364..3446438;aca;4;;
;dir    ;3024038..3024715;cds;150;678;SrtB;;insert;dir    ;4228405..4228488;cta;28;84;;3446275..3446359;tac;11;;
;comp;3024866..3024940;aca;93;75;;;insert;dir    ;4228517..4228593;aga;7;77;;3446190..3446263;gga;19;;
12;comp;3025034..3027933;23s;184;2900;;;insert;dir    ;4228601..4228676;caa;89;76;;3446094..3446170;aga;6;;
;comp;3028118..3029625;16s;374;1508;;;insert;dir    ;4228766..4228854;tca;3;89;;3446012..3446087;caa;12;;
;dir    ;3030000..3030938;cds;;939;lactam;;insert;dir    ;4228858..4228933;ttc;6;76;;3445924..3445999;aaa;6;;
;;;;;;;;insert;dir    ;4228940..4229016;atgj;11;77;;3445829..3445917;tca;11;;
;dir    ;3805298..3806743;cds;208;1446;Y-r2;;insert;dir    ;4229028..4229104;atgi;29;77;;3445727..3445817;agc;6;;
;comp;3806952..3807028;agg;61;77;;;insert;dir    ;4229134..4229210;cca;7;77;;3445644..3445720;cca;6;;
;<comp;3807090..3808790;cds;;1701;fdHa;;insert;dir    ;4229218..4229294;cac;8;77;;3445561..3445637;atg;11;;
;;;;;;;;insert;dir    ;4229303..4229378;aaa;353;76;;3445474..3445549;tgg;31;;
;comp;3875816..3876886;cds;452;1071;ABC;;insert;comp;4229732..4229848;5s;126;117;;3445366..3445442;cca;6;;
;comp;3877339..3877455;5s;125;117;;;insert;comp;4229975..4232010;23s’;582;2036;;3445283..3445359;atc;6;;
13;comp;3877581..3880480;23s;261;2900;;;;dir    ;4232593..4234098;16s;217;1506;;3445201..3445276;ttc;13;;
;comp;3880742..3882249;16s;190;1508;;;;dir    ;4234316..4237215;23s;126;2900;;3445111..3445187;atg;;;
;comp;3882440..3883018;cds;;579;precorrin;;;dir    ;4237342..4237458;5s;216;117;;;;;;
;;;;;;;;;comp;4237675..4238859;cds;372;1185;B6;;;;;
;comp;4017523..4017714;cds;118;192;DUF378;;5;dir    ;4239232..4241583;cds;21;2352;Art-red;;;;;
;comp;4017833..4017949;5s;126;117;;;;dir    ;4241605..4242144;cds;778;540;Art-reda;;;;;
14;comp;4018076..4020975;23s;321;2900;;;insert;dir    ;4242923..4244459;16s;261;1537;;;;;;
;comp;4021297..4022804;16s;292;1508;;;insert;dir    ;4244721..4247619;23s;201;2899;;;;;;
;comp;4023097..4023378;cds;221;282;hp-282;;insert;dir    ;4247821..4247937;5s;5;117;;111345..111884;CDS;431;540;Art-reda
;comp;4023600..4025129;cds;;1530;K-ligase;;insert;dir    ;4247943..4248031;tta;11;89;;112316..113822;16s;54;;
;;;;;;;;insert;dir    ;4248043..4248119;atgi;108;77;;113877..113952;gca;114;;
;dir    ;4135881..4136873;cds;383;993; DnaC;;insert;dir    ;4248228..4249735;16s;184;1508;;114067..116982;23s;193;;
;comp;4137257..4137331;aca;33;75;;;insert;dir    ;4249920..4250564;23s°;100;645;;117176..117292;5s;5;;
15;comp;4137365..4137440;gta;4;76;;;insert;<dir    ;4250665..4250923;cds;112;259;hp-259;117298..117386;tta;9;;
;comp;4137445..4137519;gaa;6;75;;;insert;comp;4251036..4253145;23s’;375;2110;;117396..117472;atg;123;;
;comp;4137526..4137601;aaa;331;76;;;insert;comp;4253521..4253596;gca;52;76;;117596..119102;16s;54;;
;comp;4137933..4139222;cds;;1290;succinate;;insert;comp;4253649..4254226;16s°;282;578;;119157..119232;gca;114;;
;;;;;;;;insert;dir    ;4254509..4254712;cds;12;204;hp-204;119347..122263;23s;193;;
;;;;;;;;insert;dir    ;4254725..4256002;cds;;1278;phagePP;122457..122573;5s;5;;
;;;;;;;;;;;;;;;122579..122667;tta;9;;
;;;;;;;;début;début;début;début;début;début;début;122677..122753;atg;123;;
;;;;;;;;insert;dir   ;4299490..4300134;cds;214;645;Y-r1;122877..124383;16s;54;;
;;;;;;;;insert;dir   ;4300349..4300807;cds;554;459;Helix;124438..124513;gca;114;;
;;;;;;;;;dir   ;4301362..4303101;cds;0;1740;hp-1740;124628..127549;23s;78;;
;;;;;;;;;dir   ;4303102..4303305;cds;167;204;hp-204;127628..127744;5s;100;;
;;;;;;;;4;dir   ;4303473..4304299;23s°;132;827;;127845..129260;CDS;;1416;R-deca

cdc8 cdc création de cds[modifier | modifier le wikicode]

;;création de cds;;;;
;cdc8;pbs;cdc;pbs;psor;pbs
seleno A;309950..310076;127;0;;-;
Y-r;457663..457878;216;457207..457422;216;-;
;1237414..1237986;573;1223841..1224413;573;;
;1291413..1292327;915;1277836..1278750;915;;
;1418672..1419580;909;1405262..1406170;909;;
;2120221..2121348;1128;;;;
;2785863..2786042;180;;;;
;3564835..3565434;600;;;;
Y-r2;3805298..3806743;1446;;;;
Y-r1;4299490..4300134;645;;;;
Helix;351106..351336;231;391813..392001;189;-;
;379952..380503;552;429510..430061;552;;
;456588..456776;189;461727..462398;672;;
;1187185..1187736;552;1169984..1170535;552;;
;1466364..1466783;420;1292255..1292926;672;;
;1467749..1468147;399;1454375..1454773;399;;
;1605760..1606344;585;1517855..1518619;765;;
;1694358..1694750;393;1592306..1592890;585;;
;1936722..1937267;546;1682266..1682658;393;;
;2105662..2106711;1050;1695592..1696284;693;;
;2196549..2198204;1656;1916424..1916630;207;;
;2342487..2342690;204;1922813..1923358;546;;
;2353934..2354578;645;2164151..2165806;1656;;
;2378761..2379891;1131;2308386..2308589;204;;
;2721795..2722316;522;2319833..2320477;645;;
;3485137..3486024;888;2344477..2345607;1131;;
;3570953..3571183;231;2501260..2501931;672;;
;3571660..3571878;219;2688255..2688776;522;;
;3804379..3804627;249;3459701..3460588;888;;
;3804878..3805279;402;3475449..3475589;141;;
;4286854..4287222;369;;;;
;4288799..4289518;720;;;;
;4300349..4300807;459;;;;
xylose;3383443..3384780;1338;3349843..3351180;1338;0;
;<4307539..4308225;687;;;;
CHAP;<4213228..>4213849;622;0;;-;
A-1chlor;4213961..4214620;660;0;;0;
SigB2;4221761..4222206;446;0;;0;
fdHa;4221761..4222206;1701;3711229..3713373;2145;-;
R-deca;0;;0;;127845..129260;1416
;;;;;876023..877522;1500
phagePP;1448919..1449983;1065;1435547..1436611;1065;1489507..1490769;1263
;1450539..1450985;447;1437167..1437613;447;;
;1709611..1711050;1440;1697521..1698963;1443;;
;1718404..1718844;441;1708192..1708632;441;;
;3560756..3561910;1155;3841162..3842367;1206;;
;4254725..4256002;1278;;;;
;4260531..4261586;1056;;;;
;4262058..4262474;417;;;;
hp-204;4254509..4254712;204;;;;
phagePP;4254725..4256002;1278;;;;
phageHM;4255980..4256741;762;;;;
hp;;;3840525..3841067;543;;
phagePP;;;3841162..3842367;1206;;
hydrolase;;;3842345..3842512;168;;
terminase;;;;;1487770..1489491;1722
phagePP;;;;;1489507..1490769;1263
Clp;;;;;1490762..1491607;846

cdc8 cdc abrégé protéines[modifier | modifier le wikicode]

A-1chlor;type A-1 chloramphenicol O-acetyltransferase
ABC;ABC transporter ATP-binding protein
Ala amid;N-acetylmuramoyl-L-alanine amidase
Art-red;anaerobic ribonucleoside triphosphate reductase
Art-reda;anaerobic ribonucleoside-triphosphate reductase activating protein
B6;pyridoxal phosphate-dependent aminotransferase
cad;cadmium-translocating P-type ATPase
CHAP;CHAP domain-containing protein
CwlD;N-acetylmuramoyl-L-alanine amidase CwlD
DedA;DedA family protein
DeoR;DeoR/GlpR transcriptional regulator
DnaC;DNA replication protein DnaC
DUF378;DUF378 domain-containing protein
fdHa;formate dehydrogenase subunit alpha
flagellar;flagellar motor protein
Glyco-tr;glycosyl transferase
Helix;helix-turn-helix domain-containing protein
hp-1740;hp-1740
hp-204;hp-204
hp-282;hp-282
hp-414;hp-414
HXXEE;HXXEE domain-containing protein
III-tau;DNA polymerase III subunit gamma/tau
K-ligase;lysine--tRNA ligase
S-ligase;serine--tRNA ligase
lactam;delta-lactam-biosynthetic de-N-acetylase
Mannosyl;Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
MBOAT;MBOAT family protein
mecano;mechanosensitive ion channel
NadR;transcription repressor NadR
NhaC;Na+/H+ antiporter NhaC family protein
Nuc-de;nucleoside deaminase
phagePP;phage portal protein
PolyI;DNA polymerase I
precorrin;bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
pyruvate;pyruvate carboxylase
R-deca;arginine decarboxylase
seleno;glycine/sarcosine/betaine reductase complex  selenoprotein A
SigB;SigB/SigF/SigG family RNA polymerase sigma factor
SigB2;B/F/G family RNA polymerase sigma-70 factor
SrtB;sortase SrtB
succinate;adenylosuccinate synthase
TIGR;TIGR00159 family protein
xylose;xylose isomerase
Y-r1;tyrosine-type recombinase/integrase – 1
Y-r2;tyrosine-type recombinase/integrase – 2

cdc8 cdc psor stats[modifier | modifier le wikicode]

NCBI du 13.11.19;cdc8;cdc;psor
date;15-MAR-2017;18-MAY-2017;08-JAN-2018
DNA circulaire;4 308 325;4 110 554;3 550 458
Genes (total)         ;4 025;3 807;3 528
CDS (total)           ;3 870;3 691;3 368
Genes (coding)        ;3 763;3 615;3 327
CDS (coding)          ;3 763;3 615;3 327
Genes (RNA)           ;155;116;160
RRNAs  (5S, 16S, 23S); 14, 16, 13; 9, 10, 10;17, 17, 17
complete rRNAs        ; 14, 16, 13; 9, 10, 10;17, 17, 17
tRNAs     ;108;83;105
ncRNAs    ;4;4;4
Pseudo Genes (total)  ;107;76;41
Pseudo Genes (ambiguous residues) ; 0 of 107; 0 of 76; 0 of 41
Pseudo Genes (frameshifted)       ; 60 of 107; 42 of 76; 4 of 41
Pseudo Genes (incomplete)         ; 35 of 107; 30 of 76; 18 of 41
Pseudo Genes (internal stop)      ; 31 of 107; 18 of 76; 22 of 41
Pseudo Genes (multiple problems)  ; 18 of 107; 12 of 76; 3 of 41
CRISPR Arrays         ;4;9; - 
;;;
Décompte du 19.11.19;;;
hypothetical protein;609;523;1 256
hp / cds (total);0,16;0,14;0,37

cbc[modifier | modifier le wikicode]

cbc opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  5;;52;doubles;intercalaires
Clostridium botulinum CDC_297;;;NCBI;gtRNAdb;;
comp;1309334..1309408;;Glu;gag;;
;;;;;;
comp;1385938..1386012;;Asn;aac;;8
comp;1386021..1386134;;5s;;;108
comp;1386243..1389140;;23s;;;228
comp;1389369..1390866;;16s;;@1;
;;;;;;
comp;1392997..1393072;;Phe;ttc;;7
comp;1393080..1393193;;5s;;;108
comp;1393302..1396199;;23s;;;228
comp;1396428..1397925;;16s;;;
;;;;;;
comp;1408673..1408762;;Ser;tcc;;
;;;;;;
comp;1412183..1412259;;Arg;agg;;
;;;;;;
comp;1415464..1415540;;Arg;cgt;;84
comp;1415625..1415715;;Ser;agc;+;20
comp;1415736..1415826;;Ser;tca;2 agc;306
comp;1416133..1416223;;Ser;agc;2 tca;20
comp;1416244..1416334;;Ser;tca;@4;
;;;;;;
comp;1425969..1426044;;Ala;gca;;3
comp;1426048..1426124;;Met;atgi;;8
comp;1426133..1426246;;5s;;;79
comp;1426326..1427823;;16s;;@2;117
comp;1427941..1428051;;MNEGCDRILIVVARWQVSKNKKMLTKIKKRATIIKH;CDS 108pb;;
;;;;;;
;1694943..1695017;;Gln;cag;;
;;;;;;
comp;1722580..1722664;;Tyr;tac;;5
comp;1722670..1722745;;Thr;aca;;
;;;;;;
comp;1841437..1841510;;Cys;tgc;;
;;;;;;
comp;1842698..1842811;;5s;;;108
comp;1842920..1845817;;23s;;;228
comp;1846046..1847543;;16s;;;
;;;;;;
;1890534..1890608;;Glu;gaa;+;17
;1890626..1890701;;Val;gta;3 gaa;9
;1890711..1890787;;Asp;gac;3 gta;4
;1890792..1890867;;Thr;aca;3 gac;5
;1890873..1890947;;Glu;gaa;2 aca;18
;1890966..1891041;;Val;gta;;7
;1891049..1891125;;Asp;gac;;57
;1891183..1891257;;Glu;gaa;;17
;1891275..1891350;;Val;gta;;9
;1891360..1891436;;Asp;gac;;4
;1891441..1891516;;Thr;aca;;
;;;;;;
comp;1948153..1948228;;Pro;cca;;
;;;;;;
;1969157..1969245;;Leu;tta;;4
;1969250..1969325;;Met;atgf;+;53
;1969379..1969454;;Met;atgf;2 atgf;10
;1969465..1969541;;Met;atg;;
;;;;;;
;1987541..1989040;;16s;;@3;226
;1989267..1992166;;23s;;;93
;1992260..1992375;;5s;;;7
;1992383..1992457;;Asn;aac;+;27
;1992485..1992559;;Asn;aac;;
;;;;;;
;2013239..2013313;;Gly;ggg;;18
;2013332..2013407;;Thr;acc;;
;;;;;;
;2222515..2222590;;Trp;tgg;;
;;;;;;
;2294767..2294842;;Pro;cca;+;7
;2294850..2294923;;Gly;gga;2 cca;6
;2294930..2295006;;Arg;aga;2 gga;5
;2295012..2295087;;Lys;aag;;26
;2295114..2295189;;Pro;cca;;29
;2295219..2295292;;Gly;gga;;24
;2295317..2295393;;Arg;cga;;
;;;;;;
;2402556..2402631;;Val;gta;;5
;2402637..2402713;;Asp;gac;;3
;2402717..2402792;;Phe;ttc;;4
;2402797..2402871;;Gly;ggc;;9
;2402881..2402954;;Cys;tgc;;
;;;;;;
;2517305..2517391;;Leu;ttg;;
;;;;;;
;2548708..2548792;;Leu;ctc;;
;;;;;;
;2583298..2583388;;SeC;tga;;

cbc cumuls[modifier | modifier le wikicode]

cbc* cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;5;1;0;0
;16 23 5s 0;1;20;22;1
;16 atc gca;0;40;3;1
;16 23 5s a;3;60;2;0
;max a;2;80;0;0
;a doubles;1;100;1;0
;spéciaux;1;120;0;0
;total aas;6;140;0;0
sans ;opérons;17;160;0;0
;1 aa;10;180;0;0
;max a;11;200;0;0
;a doubles;4;;0;0
;total aas;46;;28;2
total aas;;52;;;
remarques;;4;;;
avec jaune;;;moyenne;17;15
;;;variance;19;
sans jaune;;;moyenne;15;
;;;variance;14;

cbc blocs[modifier | modifier le wikicode]

cbc* blocs;;;;
aac;8;7;-;
5s;108;108;108;226
23s;228;228;228;93
16s;;;-;7
;;;;
gca;3;;;
atgi;8;;;
5s;79;;;
16s;;;;

cbn[modifier | modifier le wikicode]

cbn opérons[modifier | modifier le wikicode]

28%GC;30.6.19 Paris;16s  10;86;doubles;intercal;aa;avec aa
;Clostridium botulinum BKT015925;;;;;;
;20666..20741;;acg;;;;
;;;;;;;
;36413..36487;;gaa;+;12;12;
;36500..36575;;gta;2 gaa;13;13;
;36589..36665;;gac;2 gta;5;5;
;36671..36746;;aca;2 gac;18;18;
;36765..36839;;gaa;2 aca;12;12;
;36852..36927;;gta;;13;13;
;36941..37017;;gac;;5;5;
;37023..37098;;aca;;;;
;;;;;;;
;137366..137441;;cca;;;;
;;;;;;;
;161964..162052;;tta;+;5;5;
;162058..162133;;atgf;3 tta;5;5;
;162139..162215;;atgj;3 atgf;46;46;
;162262..162350;;tta;2 atgj;5;5;
;162356..162431;;atgf;;30;30;
;162462..162538;;atgj;;46;46;
;162585..162673;;tta;;5;5;
;162679..162754;;atgf;;;;
;;;;;;;
;76258..176332;;aac;;;;
;;;;;;;
;180177..181695;;16s;@5;233;;
;181929..184836;;23s;;45;;
;184882..184956;;aac;+;14;;
;184971..185087;;5s;;7;;
;185095..185169;;aac;2 aac;;;
;;;;;;;
;222409..222484;;acc;;;;
;;;;;;;
comp;578417..578492;;cag;;;;
;;;;;;;
comp;944747..944833;;ttg;;;;
;;;;;;;
;955546..955630;;ctt;;;;
;;;;;;;
;1026946..1027021;;gta;;17;17;17
;1027039..1027115;;gac;;14;14;14
;1027130..1027205;;ttc;;4;4;4
;1027210..1027284;;ggc;;8;8;8
;1027293..1027367;;tgc;+;57;57;57
;1027425..1027499;;tgc;2 tgc;;;
;;;;;;;
comp;2030816..2030890;;aac;;45;;
comp;2030936..2033842;;23s;;96;;
comp;2033939..2034015;;atc;;7;;7
comp;2034023..2034098;;gca;;121;;
comp;2034220..2035734;;16s;;;;
;;;;;;;
comp;2283768..2283884;;5s;;95;;
comp;2283980..2286886;;23s;;233;;
comp;2287120..2288638;;16s;@3;464;;
comp;2289103..2289176;;gga;;15;;15
comp;2289192..2289268;;atc;;7;;7
comp;2289276..2289351;;gca;;;;
;;;;;;;
comp;2350598..2350674;;cga;+;21;21;
comp;2350696..2350769;;gga;4 gga;28;28;
comp;2350798..2350873;;aaa;2 aaa;4;4;
comp;2350878..2350952;;caa;2 caa;4;4;
comp;2350957..2351032;;cac;2 cac;5;5;
comp;2351038..2351112;;aag;3 aag;3;3;
comp;2351116..2351192;;aga;3 aga;6;6;
comp;2351199..2351272;;gga;2 cca;4;4;
comp;2351277..2351352;;cca;2 ggc;21;21;
comp;2351374..2351449;;aag;;5;5;
comp;2351455..2351531;;aga;;5;5;
comp;2351537..2351610;;gga;;5;5;
comp;2351616..2351690;;ggc;;3;3;
comp;2351694..2351777;;cta;;22;22;
comp;2351800..2351875;;aaa;;4;4;
comp;2351880..2351954;;caa;;4;4;
comp;2351959..2352034;;cac;;5;5;
comp;2352040..2352115;;aag;;5;5;
comp;2352121..2352197;;aga;;5;5;
comp;2352203..2352276;;gga;;5;5;
comp;2352282..2352356;;ggc;;6;6;
comp;2352363..2352438;;cca;;;;
;;;;;;;
comp;2432784..2432859;;tgg;;;;
;;;;;;;
comp;2454880..2454964;;tac;+;39;39;
comp;2455004..2455079;;gta;2 tac;8;8;
comp;2455088..2455172;;tac;;4;4;
comp;2455177..2455252;;aca;;;;
;;;;;;;
comp;2697795..2697911;;5s;@1;31;;
comp;2697943..2700847;;23s;;233;;
comp;2701081..2702599;;16s;;;;
;;;;;;;
comp;2703946..2704021;;aaa;;311;;311
comp;2704333..2704408;;ttc;;5;;
comp;2704414..2704530;;5s;;336;;
comp;2704867..2704942;;ttc;;5;;
comp;2704948..2705064;;5s;;97;;
comp;2705162..2708066;;23s;;233;;
comp;2708300..2709814;;16s;;;;
;;;;;;;
comp;2721253..2721328;;aaa;@2;5;;
comp;2721334..2721450;;5s;;95;;
comp;2721546..2724452;;23s;;233;;
comp;2724686..2726203;;16s;;;;
;;;;;;;
comp;2731902..2731976;;gag;;61;;61
comp;2732038..2732112;;caa;;6;;6
comp;2732119..2732195;;aga;;4;;4
comp;2732200..2732273;;gga;;19;;19
comp;2732293..2732376;;cta;;16;;16
comp;2732393..2732467;;gaa;;4;;
comp;2732472..2732588;;5s;;97;;
comp;2732686..2735592;;23s;@4;94;;
comp;2735687..2735763;;atc;;3;;
comp;2735767..2735842;;gca;;74;;
comp;2735917..2737435;;16s;;;;
;;;;;;;
comp;2742262..2742351;;tcc;;;;
;;;;;;;
comp;2743220..2743312;;tcg;;;;
;;;;;;;
comp;2743891..2743967;;agg;;;;
;;;;;;;
comp;2748534..2748610;;cgt;;144;144;
comp;2748755..2748845;;agc;;23;23;
comp;2748869..2748959;;tca;+;69;69;
comp;2749029..2749119;;tca;2 tca;;;
;;;;;;;
comp;2758688..2758763;;gca;;4;;4
comp;2758768..2758844;;atgi;;3;;
comp;2758848..2758964;;5s;;73;;
comp;2759038..2761942;;23s;;233;;
comp;2762176..2763694;;16s;;;;
;;;;;;;
comp;2150504..2150620;;5s;;31;;
comp;2150652..2153560;;23s;;233;;
comp;2153794..2155308;;16s;;;;
;;;;;;;
comp;2169525..2169641;;5s;;32;;
comp;2169674..2172579;;23s;;233;;
comp;2172813..2174331;;16s;;;;
;;;;;;;
sur plasmide;;;tgg;;;;

cbn cumuls[modifier | modifier le wikicode]

cbn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;10;1;0;0
;16 23 5s 0;3;20;34;9
;16 gca atc;2;40;7;0
;16 23 5s a;4;60;3;0
;max a;8;80;1;1
;a doubles;1;100;0;0
;spéciaux;1;120;0;0
;total aas;22;140;0;0
sans ;opérons;18;160;1;0
;1 aa;12;180;0;0
;max a;22;200;0;0
;a doubles;6;;0;0
;total aas;64;;46;10
total aas;;86;;;
remarques;;5;;;
avec jaune;;;moyenne;17;
;;;variance;25;
sans jaune;;;moyenne;14;14
;;;variance;15;17

cbn blocs[modifier | modifier le wikicode]

cbn blocs;;;;;;
5s;31;31;32;;;
23s;233;233;233;;;
16s;;;;;;
;;;;;ttc;5
;;;;;5s;336
aaa;5;3;;;ttc;5
5s;95;73;5s;95;5s;97
23s;233;233;23s;233;23s;233
16s;aaa;atgi;16s;464;16s;
;;;gga;15;;
16s;233;;;;;
23s;45;;;;;
aac;14;;;;;
5s;7;;;;;
aac;;;;;;
gaa;4;;;;;
5s;97;aac;45;;;
23s;94;23s;96;;;
atc;3;atc;7;;;
gca;74;gca;121;;;
16s;;16s;;;;

cle[modifier | modifier le wikicode]

cle opérons[modifier | modifier le wikicode]

34.3%GC;30.6.19 Paris;16s  11;104;doubles;intercalaires;;
;Clostridium lentocellum DSM 5427;;;;;;
;10157..10246;;agc;@1;202;;
;10449..11981;;16s;;72;;
;12054..12171;;5s;;4;;
;12176..12248;;gca;;262;;
;12511..15414;;23s;;55;;
;15470..15543;;gac;;61;;61
;15605..15677;;gta;;7;;7
;15685..15757;;aca;;34;;34
;15792..15872;;tac;;12;;12
;15885..15961;;atg;;3;;3
;15965..16040;;ttc;;3;;3
;16044..16116;;aaa;;;;
;;;;;30118;;
;46235..47767;;16s;@3;21284;;
;;;;;;;
;69052..71964;;23s;;;;
;;;;;4873;;
;76838..78371;;16s;;72;;
;78444..78561;;5s;;5;;
;78567..78639;;gca;;282;;
;78922..81829;;23s;;;;
;;;;;904;;
;82734..82851;;5s;;4;;
;82856..82928;;ggc;;;;
;;;;;1463;;
;84392..85929;;16s;;72;;
;86002..86119;;5s;;4;;
;86124..86196;;gca;;280;;
;86477..89386;;23s;;;;
;;;;;7380;;
;96767..96884;;5s;;89;;
;96974..97047;;ggc;;;;
;;;;;5082;;
;102130..102204;;cag;;;;
;;;;;;;
;104716..104799;;tta;;13;13;
;104813..104898;;tca;;;;
;;;;;;;
;141499..143034;;16s;;138;;
;143173..143290;;5s;;7;;
;143298..143374;;atc; ;258;;
;143633..146538;;23s;;;;
;;;;;;;
;150968..151085;;5s;@4;4;;
;151090..151161;;gaa;;457;;
;151619..153160;;16s;;605;;
;153766..156671;;23s;;475;;
;157147..157219;;aaa;;9;;9
;157229..157299;;gga;;6;;6
;157306..157379;;aga;;;;
;;;;;4223;;
;161603..161720;;5s;;4;;
;161725..161797;;ggc;;;;
;;;;;11104;;
;172902..172973;;gaa;;23;23;
;172997..173071;;cca;;45;45;
;173117..173189;;aaa;;11;11;
;173201..173274;;gac;;56;56;
;173331..173403;;gta;;7;7;
;173411..173494;;tta;;187;187;
;173682..173754;;aca;;26;26;
;173781..173861;;tac;;10;10;
;173872..173948;;atg;;31;31;
;173980..174052;;ttc;;;;
;;;;;248498;;
;422551..424086;;16s;;;;
;;;;;113898;;
;537985..540890;;23s;;;;
;;;;;25153;;
;566044..566117;;cac;;23;23;
;566141..566212;;caa;;32;32;
;566245..566330;;tca;;;;
;;;;;;;
;571984..573519;;16s;;72;;
;573592..573709;;5s;;4;;
;573714..573786;;gca;;282;;
;574069..576975;;23s;;;;
;;;;;25302;;
;602278..603812;;16s;;137;;
;603950..604067;;5s;;;;
;;;;;11014;;
;615082..617987;;23s;;;;
;;;;;21159;;
;639147..639362;;16s°;@5;;;
;;;;;98139;;
;737502..737619;;5s;;4;;
;737624..737696;;ggc;;;;
;;;;;3291;;
;740988..741058;;gga;;;;
;;;;;;;
;759839..759920;;cta;;;;
;;;;;;;
;911999..912083;;ctt;+;148;148;
;912232..912316;;ctt;2 ctt;;;
;;;;;;;
;1035192..1035265;;cga;;;;
;;;;;;;
;1061152..1061225;;agg;;;;
;;;;;;;
comp;1136376..1136448;;ccc;;;;
;;;;;;;
;1229184..1230718;;16s;@2;72;;
;1230791..1230908;;5s;;7;;
;1230916..1230989;;atc;;53;;53
;1231043..1231115;;gca;;261;;
;1231377..1234282;;23s;;110;;
;1234393..1234464;;aac;+;9;;9
;1234474..1234545;;gaa;2 tgc ;6;;6
;1234552..1234622;;tgc;2 aac;23;;23
;1234646..1234717;;aac;;58;;58
;1234776..1234846;;tgc;;;;
;;;;;;;
;1280211..1280283;;atg;;;;
;;;;;;;
;1283250..1283320;;gga;+;5;5;
;1283326..1283399;;aga;2 gga;5;5;
;1283405..1283478;;cac;2 aga;31;31;
;1283510..1283581;;caa;2 caa;23;23;
;1283605..1283677;;aaa;;30;30;
;1283708..1283792;;cta;;23;23;
;1283816..1283886;;gga;;5;5;
;1283892..1283965;;aga;;6;6;
;1283972..1284043;;caa;;;;
;;;;;;;
;1299560..1299632;;ggc;;4;4;
;1299637..1299711;;cca;;;;
;;;;;;;
;1346208..1346290;;ctg;;;;
;;;;;;;
;1363346..1363428;;ctg;;;;
;;;;;;;
;1515234..1515305;;gaa;;62;62;
;1515368..1515442;;cca;;22;22;
;1515465..1515537;;aaa;;;;
;;;;;;;
;1597292..1597364;;acg;;;;
;;;;;;;
;1611976..1612042;;acg;;;;
;;;;;;;
;2065352..2065425;;ata;;;;
;;;;;;;
comp;2090478..2090550;;acc;;;;
;;;;;;;
;2394421..2394501;;tac;;3;3;
;2394505..2394577;;ttc;;;;
;;;;;;;
;2592342..2592422;;ttg;;;;
;;;;;;;
;2606024..2606104;;ttg;;;;
;;;;;;;
comp;2737232..2737304;;gcc;;;;
;;;;;;;
comp;2798802..2798874;;aag;;;;
;;;;;;;
comp;2881571..2881642;;gag;;;;
;;;;;;;
comp;3215471..3215545;;cca;;;;
;;;;;;;
comp;3252582..3252655;;atg;;7;7;
comp;3252663..3252735;;gta;;4;4;
comp;3252740..3252813;;gac;;10;10;
comp;3252824..3252896;;tgg;;20;20;
comp;3252917..3252988;;aac;;;;
;;;;;683;;
comp;3253672..3253748;;atg;;7;;7
comp;3253756..3253828;;gta;;9;;9
comp;3253838..3253910;;tgg;;18;;18
comp;3253929..3254000;;aac;;60;;
comp;3254061..3256967;;23s;;;;
;;;;;362637;;
comp;3619605..3619677;;aca;+;4;;4
comp;3619682..3619755;;cgt;2 cgt;50;;50
comp;3619806..3619879;;cgt;2 aca;27;;27
comp;3619907..3619990;;tta;;3;;3
comp;3619994..3620069;;gta;;47;;47
comp;3620117..3620190;;gac;;22;;22
comp;3620213..3620289;;atg;;23;;23
comp;3620313..3620385;;aca;;14;;14
comp;3620400..3620471;;gaa;;9;;9
comp;3620481..3620552;;aac;;110;;
comp;3620663..3623568;;23s;;261;;
comp;3623830..3623902;;gca;;53;;53
comp;3623956..3624029;;atc;;7;;
comp;3624037..3624154;;5s;;72;;
comp;3624227..3625761;;16s;;149;;
comp;3625911..3625999;;tcc;;33;;33
comp;3626033..3626118;;tca;;;;
;;;;;;;
comp;3714637..3714709;;gta;;1;1;
comp;3714711..3714787;;atg;;;;

cle cumuls[modifier | modifier le wikicode]

cle cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;19;1;1;0
;16 5 aa 23;5;20;14;15
;16 5 atc gca;2;40;10;6
;solo;11;60;2;5
;max a;14;80;1;1
;a doubles;2;100;0;0
;indéterminé;1;120;0;0
;total aas;46;140;0;0
sans ;opérons;29;160;1;0
;1 aa;19;180;0;0
;max a;10;200;1;0
;a doubles;2;;0;0
;total aas;59;;30;27
total aas;;105;;;
remarques;;5;;;
avec jaune;;;moyenne;29;
;;;variance;41;
sans jaune;;;moyenne;19;22
;;;variance;16;19

cle blocs[modifier | modifier le wikicode]

cle blocs;;;
Solitaires;;;
16s;*2;16s°;@5
;;;
23s;*3;;
;;;
5s;3*4;89;
ggc;;;
;;;
aac;60;;
23s;;;
;;;
16s;137;;
5s;;;
;;;
16s;72;72;72
5s;5;4;4
gca;282;280;282
23s;;;
;;;
;;agc;202
16s;138;16s;72
5s;7;5s;4
atc;258;gca;262
23s;;23s;55
;;gac;61
;;;
;;;
;;aac;110
16s;72;23s;261
5s;7;gca;53
atc;53;atc;7
gca;261;5s;72
23s;110;16s;149
aac;9;tcc;33
;;;
;;;
5s;4;;@4
gaa;457;;
16s;605;;
23s;475;;
aaa;9;;

hmo[modifier | modifier le wikicode]

hmo opérons[modifier | modifier le wikicode]

57%GC;24.7.19 Paris;16s ;109;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
Heliobacterium modesticaldum Ice1 ATCC 51547 ;;;;;;;;;;
;103699..104088;;CDS;;380;;;;130;
;;;;;;;;;;
;104469..105695;;CDS;;186;186;;;409;186
comp;105882..105956;;ggc;;1;;1;;;
comp;105958..106044;;ctg;;321;321;;;;
comp;106366..106929;;CDS;@1;241;241;;;188;241
comp;107171..107246;;aca;;202;202;;;;202
comp;107449..108183;;CDS;;111772;;;;245;
;;;;;;;;;;
comp;219956..220483;;CDS;;260;260;;;176;260
comp;220744..220820;;gac;;5;;;5;;
comp;220826..220901;;gta;;10;;;10;;
comp;220912..220987;;gaa;;4;;;4;;
comp;220992..221067;;aaa;;18;;;18;;
comp;221086..221160;;caa;;103;;;;;
comp;221264..224182;;23s;;237;;;;;
comp;224420..224495;;gcc;;64;;;;;
comp;224560..224676;;5s;@2;328;;;;;
comp;225005..226536;;16s;;651;651;;;;
comp;227188..228162;;CDS;;98792;;;;325;
;;;;;;;;;;
comp;326955..328340;;CDS;;178;178;;;462;178
comp;328519..328601;;cta;;65;;65;;;
comp;328667..328743;;aga;;60;;60;;;
comp;328804..328880;;cca;;568;568;;;;
comp;329449..330090;;CDS;;57730;;;;214;
;;;;;;;;;;
comp;387821..388105;;CDS;;135;135;;;95;
;388241..388317;;ccc;;7;;7;;;
;388325..388410;;tac;;47;47;;;;47
comp;388458..388742;;CDS;;588493;;;;95;
;;;;;;;;;;
comp;977236..978504;;CDS;;439;439;;;423;
comp;978944..981860;;23s;;237;;;;;
comp;982098..982173;;gcc;;64;;;;;
comp;982238..982354;;5s;;328;;;;;
comp;982683..984208;;16s;;460;;;;;
comp;984669..984744;;tgg;@3;5;;;5;;
comp;984750..984824;;cgg;;207;207;;;;207
comp;985032..987656;;CDS;;26258;;;;875;
;;;;;;;;;;
comp;1013915..1014760;;CDS;;105;105;;;282;105
comp;1014866..1014942;;gac;;75;;75;;;
comp;1015018..1015093;;gaa;;265;265;;;;
comp;1015359..1016642;;CDS;;40115;;;;428;
;;;;;;;;;;
;1056758..1058014;;CDS;;121;121;;;419;121
comp;1058136..1058233;;tga;;173;173;;;;
;1058407..1058733;;CDS;;62951;;;;109;
;;;;;;;;;;
;1121685..1122878;;CDS;;588;588;;;398;
;1123467..1124998;;16s;;328;;;;;
;1125327..1125443;;5s;;64;;;;;
;1125508..1125583;;gcc;;233;;;;;
;1125817..1128734;;23s;;337;337;;;;337
>;1129072..1129785;;CDS;;24938;;;;238;
;;;;;;;;;;
;1154724..1155224;;CDS;;99;99;;;167;
;1155324..1155413;;tca;;56;56;;;;56
comp;1155470..1156627;;CDS;;13350;;;;386;
;;;;;;;;;;
;1169978..1171828;;CDS;;129;129;;;617;129
;1171958..1172034;;cgt;;85;;85;;;
;1172120..1172196;;agg;;181;181;;;;
;1172378..1172812;;CDS;;62;62;;;145;62
;1172875..1172966;;tcg;;548;548;;;;
;1173515..1174330;;CDS;;6655;;;;272;
;;;;;;;;;;
comp;1180986..1182974;;CDS;;444;444;;;663;
;1183419..1183512;;tcc;;39;39;;;;39
;1183552..1183817;;ncRNA;;11908;;;;89;
;;;;;;;;;;
;1195726..1195998;;CDS;;181;181;;;91;
;1196180..1196255;;gcg;;151;151;;;;151
;1196407..1197051;;CDS;;86894;;;;215;
;;;;;;;;;;
comp;1283946..1285331;;CDS;;177;177;;;462;177
;1285509..1285584;;atgf;;5;;5;;;
;1285590..1285667;;atgj;;7;;7;;;
;1285675..1285750;;gaa;;542;542;;;;
;1286293..1287630;;CDS;;63447;;;;446;
;;;;;;;;;;
;1351078..1352549;;CDS;;704;704;;;491;
;1353254..1354786;;16s;;252;;;;;
;1355039..1355155;;5s;;64;;;;;
;1355220..1355296;;atc;;194;;;;;
;1355491..1358408;;23s;;112;;;;;
;1358521..1358595;;aac;;109;109;;;;109
comp;1358705..1358926;;CDS;;139555;;;;74;
;;;;;;;;;;
;1498482..1498898;;CDS;;535;535;;;139;
comp;1499434..1499509;;acg;;238;238;;;;238
;1499748..1500836;;CDS;;262182;;;;363;
;;;;;;;;;;
;1763019..1763858;;CDS;;68;68;;;280;68
;1763927..1764003;;gac;;4;;4;;;
;1764008..1764083;;ttc;;3;;3;;;
;1764087..1764161;;ggc;;92;92;;;;
comp;1764254..1764493;;CDS;;72;72;;;80;72
;1764566..1764641;;tgc;;18;;18;;;
;1764660..1764746;;tta;;253;253;;;;
comp;1765000..1765467;;CDS;;52131;;;;156;
;;;;;;;;;;
;1817599..1818318;;CDS;;487;487;;;240;
;1818806..1820337;;16s;;252;;;;;
;1820590..1820706;;5s;;64;;;;;
;1820771..1820847;;atc;;6;;;6;;
;1820854..1820929;;gca;;229;;;;;
;1821159..1824076;;23s;;112;;;;;
;1824189..1824263;;aac;;6;;;6;;
;1824270..1824345;;atgf;;243;243;;;;243
;1824589..1825014;;CDS;;168198;;;;142;
;;;;;;;;;;
;1993213..1994328;;CDS;;99;99;;;372;
;1994428..1994502;;atgi;;41;41;;;;41
;1994544..1995368;;CDS;;284281;;;;275;
;;;;;;;;;;
;2279650..2279997;;CDS ;;541;541;;;116;
;2280539..2282070;;16s;;253;;;;;
;2282324..2282440;;5s;;64;;;;;
;2282505..2282580;;gcc;;234;;;;;
;2282815..2285735;;23s;;119;;;;;
;2285855..2285948;;tcc;;6;;;6;;
;2285955..2286031;;ccg;;10;;;10;;
;2286042..2286115;;gga;;14;;;14;;
;2286130..2286205;;cac;;1;;;1;;
;2286207..2286281;;tgc;;9;;;9;;
;2286291..2286367;;gtc;;3;;;3;;
;2286371..2286446;;ttc;;6;;;6;;
;2286453..2286537;;tac;;4;;;4;;
;2286542..2286616;;caa;;17;;;17;;
;2286634..2286709;;aaa;;4;;;4;;
;2286714..2286789;;gaa;;5;;;5;;
;2286795..2286870;;gta;;5;;;5;;
;2286876..2286952;;gac;;7;;;7;;
;2286960..2287050;;agc;;43;;;43;;
;2287094..2287170;;ccc;;30;;;30;;
;2287201..2287287;;ctg;;3;;;3;;
;2287291..2287365;;ggc;;4;;;4;;
;2287370..2287446;;cgt;;4;;;4;;
;2287451..2287526;;acc;;352;352;;;;352
;2287879..2288343;;CDS ;;33184;;;;155;
;;;;;;;;;;
comp;2321528..2322544;;CDS ;;268;268;;;339;
comp;2322813..2322889;;gtc;;9;;9;;;
comp;2322899..2322973;;cgg;;81;81;;;;81
comp;2323055..2323243;;CDS ;;3375;;;;63;
;;;;;;;;;;
;2326619..2327947;;CDS ;;464;464;;;443;464
;2328412..2329943;;16s;;327;;;;;
;2330271..2330387;;5s;;226;;;;;
;2330614..2333532;;23s;;98;;;;;
;2333631..2333706;;aaa;;4;;;4;;
;2333711..2333786;;acc;;8;;;8;;
;2333795..2333877;;ctc;;89;89;;;;89
comp;2333967..2334704;;CDS;;7389;;;;246;
;;;;;;;;;;
;2342094..2342804;;CDS;;155;155;;;237;155
comp;2342960..2343030;;ttc;;213;213;;;;
;2343244..2343936;;CDS;;563;563;;;231;
;2344500..2346025;;16s;;252;;;;;
;2346278..2346394;;5s;;64;;;;;
;2346459..2346535;;atc;;141;;;;;
;2346677..2349594;;23s;;100;;;;;
;2349695..2349769;;aac;;6;;;6;;
;2349776..2349851;;atgf;;102;102;;;;102
;2349954..2350976;;CDS;;113601;;;;341;
;;;;;;;;;;
;2464578..2465114;;CDS;;271;271;;;179;271
comp;2465386..2465461;;aca;;432;432;;;;
;2465894..2466226;;CDS;;4722;;;;111;
;;;;;;;;;;
;2470949..2471977;;CDS;;69;69;;;343;69
;2472047..2472133;;ctg;;678;678;;;;
;2472812..2473192;;CDS;;22232;;;;127;
;;;;;;;;;;
;2495425..2496048;;CDS;;402;402;;;208;
comp;2496451..2496527;;gtc;;4;;4;;;
comp;2496532..2496609;;atgj;;175;175;;;;175
;2496785..2497120;;CDS;;217;217;;;112;
comp;2497338..2497420;;ctc;;7;;7;;;
comp;2497428..2497503;;acc;;18;;18;;;
comp;2497522..2497596;;tgg;;14;;14;;;
comp;2497611..2497684;;ggg;;19;;19;;;
comp;2497704..2497778;;ggc;;7;;7;;;
comp;2497786..2497873;;ttg;;8;;8;;;
comp;2497882..2497958;;gtg;;-10;-10;;;;-10
comp;2497949..2498185;;CDS;;66;66;;;79;66
;2498252..2498328;;ccg;;314;314;;;;
comp;2498643..2499506;;CDS;;55292;;;;288;
;;;;;;;;;;
;2554799..2554984;;CDS;;109;109;;;62;109
;2555094..2555169;;gaa;;2;;2;;;
;2555172..2555247;;ttc;;6;;6;;;
;2555254..2555338;;tac;;4;;4;;;
;2555343..2555417;;caa;;18;;18;;;
;2555436..2555511;;aaa;;4;;4;;;
;2555516..2555590;;ggc;;9;;9;;;
;2555600..2555675;;cac;;117;117;;;;
comp;2555793..2557049;;CDS;;235940;;;;419;
;;;;;;;;;;
comp;2792990..2793442;;CDS;;219;219;;;151;219
comp;2793662..2796583;;23s;;236;;;;;
comp;2796820..2796895;;gca;;6;;;6;;
comp;2796902..2796978;;atc;;64;;;;;
comp;2797043..2797159;;5s;;328;;;;;
comp;2797488..2799019;;16s;;505;;;;;
comp;2799525..2799599;;ggc;+;1;;;1;;
comp;2799601..2799687;;ctg;2 ggc;32;;;32;;
comp;2799720..2799796;;ccc;;42;;;42;;
comp;2799839..2799915;;cgt;;4;;;4;;
comp;2799920..2799994;;ggc;;120;;;120;;
comp;2800115..2800192;;atgj;;42;;;42;;
comp;2800235..2800325;;agc;;16;;;16;;
comp;2800342..2800417;;atgf;;6;;;6;;
comp;2800424..2800498;;aac;;7;;;7;;
comp;2800506..2800581;;gaa;;4;;;4;;
comp;2800586..2800661;;aaa;;18;;;18;;
comp;2800680..2800754;;caa;;4;;;4;;
comp;2800759..2800843;;tac;;91;;;91;;
comp;2800935..2801011;;gtc;;7;;;7;;
comp;2801019..2801093;;tgc;;325;325;;;;
;2801419..2801724;;CDS;;230813;;;;102;
;;;;;;;;;;
;3032538..3032729;;CDS;;109;109;;;64;109
comp;3032839..3035757;;23s;;233;;;;;
comp;3035991..3036066;;gcc;;64;;;;;
comp;3036131..3036247;;5s;;253;;;;;
comp;3036501..3038026;;16s;;779;779;;;;
comp;3038806..3040017;;CDS;;232;;;;404;
;;;;;;;;;;
comp;3040250..3042013;;CDS;;;;;;588;

hmo cumuls[modifier | modifier le wikicode]

hmo cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;1;2;1;1;40;1;100;10
;16 5s gcc 23;5;20;20;34;50;3;80;8;200;16
;16 5s atc 23;2;40;0;2;100;11;120;7;300;14
;16 5 23s a;1;60;1;3;150;9;160;4;400;8
;max a;20;80;2;0;200;9;200;4;500;11
;a doubles;1;100;1;1;250;8;240;4;600;0
;16 5s atc gca;2;120;0;1;300;5;280;4;700;2
;total aas;60;140;0;0;350;4;320;0;800;0
sans ;opérons;24;160;0;0;400;1;360;2;900;1
;1 aa;12;180;0;0;450;4;400;0;1000;0
;max a;7;200;0;0;500;2;440;0;1100;0
;a doubles;0;;0;0;;11;;1;;0
;total aas;49;;25;43;;68;;35;;62
total aas;;109;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;8;8;;196;;137;;230
;;;variance;6;7;;120;;71;;128

hmo blocs[modifier | modifier le wikicode]

hmo blocs;;;;;tgg
CDS ;541;651;588;779;460
16s;253;328;328;253;328
5s;64;64;64;64;64
gcc;234;237;233;233;237
23s;119;103;337;109;439
tcc;tcc;caa;cds;cds;cds
;;;;;
CDS;704;563;;CDS ;464
16s;252;252;;16s;327
5s;64;64;;5s;226
atc;194;141;;23s;98
23s;112;100;;aaa;
aac;aac;aac;;;
;;;;;
;;ggc;;;
CDS;487;505;;;
16s;252;328;;;
5s;64;64;;;
atc;6;6;;;
gca;229;236;;;
23s;112;219;;;
aac;aac;cds;;;

cbei[modifier | modifier le wikicode]

cbei opérons[modifier | modifier le wikicode]

29.65%GC;29.7.19 Paris;16s 16 ;;;;;;;;
Clostridium beijerinckii strain NCIMB 14988;;;;doubles;intercalaires;CDS;aa;avec aa;aas;CDS dirigé
;6477551..6480031;;CDS;;496;496;;;827;
;6480528..6482044;;16s;;213;;;;;
;6482258..6485171;;23s;;108;;;;;
;6485280..6485394;;5s;;14;;;;;
;15..91;;atgi;;1;;;1;;
;93..168;;gca;;85;85;;;;85
;254..769;;CDS;;1940;;;;172;
;;;;;;;;;;
;2710..2937;;CDS;;119;119;;;76;119
;3057..3147;;tca;+;30;;30;;;
;3178..3268;;agc;2 tca;241;;*241;;;
;3510..3600;;tca;2 agc;18;;18;;;
;3619..3709;;agc;;125;125;;;;
;3835..4350;;CDS;;9470;;;;172;
;;;;;;;;;;
;13821..14726;;CDS;;187;187;;;302;
;14914..14988;;cgt;;34;34;;;;34
comp;15023..15913;;CDS;;109014;;;;297;
;;;;;;;;;;
;124928..125338;;CDS;;275;275;;;137;275
;125614..125702;;tta;+;20;;20;;;
;125723..125798;;atgf;4 tta;7;;7;;;
;125806..125882;;atgj;4 atgf;6;;6;;;
;125889..125977;;tta;2 atgj;22;;22;;;
;126000..126075;;atgf;;7;;7;;;
;126083..126159;;atgj;;6;;6;;;
;126166..126254;;tta;;21;;21;;;
;126276..126351;;atgf;;70;;70;;;
;126422..126510;;tta;;21;;21;;;
;126532..126607;;atgf;;664;664;;;;
;127272..129683;;CDS;;8954;;;;804;
;;;;;;;;;;
;138638..140143;;CDS;;307;307;;;502;
;140451..140525;;aac;+;234;;*234;;;
;140760..140834;;aac;3 aac;439;;*439;;;
;141274..141348;;aac;@6;299;299;;;;299
;141648..143039;;CDS;;1587;;;;464;
;;;;;;;;;;
comp;144627..145649;;CDS;;543;543;;;341;
;146193..147709;;16s;;140;;;;;
;147850..147925;;gca;;3;;;3;;
;147929..148005;;atc;;111;;;;;
;148117..151030;;23s;;70;;;;;
;151101..151217;;5s;;5;;;5;;
;151223..151298;;ttc;;4;;;;;
;151303..151377;;tgc;;167;167;;;;167
;151545..151841;;CDS;;25608;;;;99;
;;;;;;;;;;
;177450..178097;;CDS;;76;76;;;216;
;178174..178249;;acc;;65;65;;;;65
;178315..179508;;CDS;;134221;;;;398;
;;;;;;;;;;
;313730..316207;;CDS;;90;90;;;826;90
;316298..316382;;cta;;4;;4;;;
;316387..316461;;ggg;;120;120;;;;
comp;316582..316986;;CDS;;85487;;;;135;
;;;;;;;;;;
;402474..402953;;CDS;;125;125;;;160;125
;403079..403154;;cca;+;17;;17;;;
;403172..403245;;gga;2x;149;;*149;;;
;403395..403471;;aga;cca gga aga;6;;6;;;
;403478..403553;;cca;;16;;16;;;
;403570..403643;;gga;;35;;35;;;
;403679..403755;;aga;;5;;5;;;
;403761..403836;;cac;;3;;3;;;
;403840..403914;;caa;2x;7;;7;;;
;403922..403997;;aaa;caa aaa cta ;18;;18;;;
;404016..404100;;cta;ggc gga ;5;;5;;;
;404106..404180;;ggc;;25;;25;;;
;404206..404279;;gga;;5;;5;;;
;404285..404360;;aag;;57;;57;;;
;404418..404492;;caa;;7;;7;;;
;404500..404575;;aaa;;18;;18;;;
;404594..404678;;cta;;5;;5;;;
;404684..404758;;ggc;;25;;25;;;
;404784..404857;;gga;;46;;46;;;
;404904..404980;;cga;;325;325;;;;
<;405306..405467;;CDS;;8393;;;;54;
;;;;;;;;;;
;413861..415921;;CDS;;385;385;;;687;
;416307..417823;;16s;@5;132;;;;;
;417956..418032;;atc;;84;;;;;
;418117..421031;;23s;;71;;;;;
;421103..421177;;aac;;345;345;;;;345
;421523..422449;;CDS;;63814;;;;309;
;;;;;;;;;;
;486264..486668;;CDS;;159;159;;;135;159
;486828..486912;;tac;+;9;;9;;;
;486922..486997;;gta;3 tac;27;;27;;;
;487025..487099;;aca;2 gta;12;;12;;;
;487112..487196;;tac;2 aca;9;;9;;;
;487206..487281;;gta;;30;;30;;;
;487312..487386;;aca;;12;;12;;;
;487399..487483;;tac;;451;451;;;;
;487935..489110;;CDS;;50956;;;;392;
;;;;;;;;;;
;540067..540969;;CDS;;187;187;;;301;187
;541157..541231;;tgg;;208;208;;;;
;541440..541820;;CDS;;97;;;;127;
;;;;;;;;;;
comp;541918..542985;;CDS;;252;252;;;356;252
;543238..543312;;tgg;;354;354;;;;
;543667..544683;;CDS;;347735;;;;339;
;;;;;;;;;;
;892419..893339;;CDS;;560;560;;;307;
;893900..895416;;16s;;137;;;;;
;895554..895629;;gca;;118;;;;;
;895748..898661;;23s;;204;;;;;
;898866..898982;;5s;;552;552;;;;*552
;899535..900446;;CDS;;351;;;;304;
;;;;;;;;;;
;900798..902048;;CDS;;704;704;;;417;
;902753..904269;;16s;;339;;;;;
;904609..907522;;23s;;273;;;;;
;907796..907912;;5s;;69;69;;;;69
comp;907982..908449;;CDS;;43545;;;;156;
;;;;;;;;;;
;951995..952630;;CDS;;97;97;;;212;97
;952728..952813;;ctc;;396;396;;;;
;953210..954919;;CDS;;784414;;;;570;
;;;;;;;;;;
;1739334..1739933;;CDS;;380;380;;;200;380
;1740314..1740389;;cac;;3;;3;;;
;1740393..1740467;;cag;;5;;5;;;
;1740473..1740548;;aaa;;443;443;;;;
comp;1740992..1742350;;CDS;;151829;;;;453;
;;;;;;;;;;
;1894180..1895406;;CDS;;34;34;;;409;34
comp;1895441..1895527;;ttg;;574;574;;;;
;1896102..1896794;;CDS;;200701;;;;231;
;;;;;;;;;;
;2097496..2097915;;CDS;;722;722;;;140;
;2098638..2100154;;16s;;502;;;;;
;2100657..2103569;;23s;;205;;;;;
;2103775..2103891;;5s;;315;315;;;;315
;2104207..2104905;;CDS;;234313;;;;233;
;;;;;;;;;;
;2339219..2340322;;CDS;;662;662;;;368;
;2340985..2342501;;16s;;338;;;;;
;2342840..2345755;;23s;;140;;;;;
;2345896..2345970;;aac;;3;;;;;
;2345974..2346090;;5s;;429;429;;;;429
;2346520..2348088;;CDS;;3574;;;;523;
;;;;;;;;;;
;2351663..2352139;;CDS;;568;568;;;159;
;2352708..2354224;;16s;;338;;;;;
;2354563..2357477;;23s;;140;;;;;
;2357618..2357692;;aac;;3;;;;;
;2357696..2357812;;5s;;90;90;;;;90
;2357903..2358316;;CDS;;406783;;;;138;
;;;;;;;;;;
;2765100..2765525;;CDS;;625;625;;;142;
;2766151..2767667;;16s;;503;;;;;
;2768171..2771082;;23s;;202;;;;;
;2771285..2771401;;5s;;5;;;;;
;2771407..2771482;;ttc;;6;;;6;;
;2771489..2771565;;gac;;25;;;25;;
;2771591..2771665;;gaa;;448;448;;;;448
;2772114..2774864;;CDS;;781818;;;;917;
;;;;;;;;;;
;3556683..3557051;;CDS;;565;565;;;123;*565
;3557617..3557691;;gag;;925;925;;;;
comp;3558617..3559759;;CDS;;192275;;;;381;
;;;;;;;;;;
comp;3752035..3752652;;CDS;;245;245;;;206;245
comp;3752898..3752985;;agt;@1;711;711;;;;
comp;3753697..3755112;;CDS;;501326;;;;472;
;;;;;;;;;;
comp;4256439..4258403;;CDS;;267;267;;;655;267
comp;4258671..4258746;;aaa;;79;;79;;;
comp;4258826..4258901;;cac;;7;;7;;;
comp;4258909..4258985;;aga;;35;;35;;;
comp;4259021..4259094;;gga;;752;752;;;;
;4259847..4260392;;CDS;;619853;;;;182;
;;;;;;;;;;
comp;4880246..4880488;;CDS;;508;508;;;81;*508
comp;4880997..4881113;;5s;;274;;;;;
comp;4881388..4884300;;23s;;578;;;;;
comp;4884879..4886395;;16s;;703;703;;;;
comp;4887099..4888034;;CDS;;1272704;;;;312;
;;;;;;;;;;
comp;6160739..6161977;;CDS;;343;343;;;413;
;6162321..6162396;;cca;;242;242;;;;242
;6162639..6163283;;CDS;;2040;;;;215;
;;;;;;;;;;
;6165324..6165734;;CDS;;222;222;;;137;
comp;6165957..6166032;;ttc;;5;;;;;
comp;6166038..6166154;;5s;@2;188;188;;;;188
;6166343..6167074;;CDS;;8085;;;;244;
;;;;;;;;;;
comp;6175160..6175597;;CDS;;249;249;;;146;249
comp;6175847..6175922;;gca;;1;;;1;;
comp;6175924..6176000;;atgi;;44;;;;;
comp;6176045..6176161;;5s;;138;;;;;
comp;6176300..6179216;;23s;;339;;;;;
comp;6179556..6181072;;16s;;567;567;;;;
comp;6181640..6182446;;CDS;;223;;;;269;
;;;;;;;;;;
;6182670..6183419;;CDS;;190;190;;;250;190
comp;6183610..6183685;;aaa;+;5;;;;;
comp;6183691..6183807;;5s;2 aaa;159;159;;;;159
comp;6183967..6184914;;CDS;@3;294;294;;;316;294
comp;6185209..6185284;;aaa;;7;;;;;
comp;6185292..6185408;;5s;;138;;;;;
comp;6185547..6188463;;23s;;339;;;;;
comp;6188803..6190319;;16s;;771;771;;;;
comp;6191091..6192203;;CDS;;7306;;;;371;
;;;;;;;;;;
comp;6199510..6202059;;CDS;;661;661;;;850;
comp;6202721..6202837;;5s;@4;139;;;;;
comp;6202977..6205893;;23s;;339;;;;;
comp;6206233..6207749;;16s;;1102;;;;;
comp;6208852..6208968;;5s;;138;;;;;
comp;6209107..6212023;;23s;;339;;;;;
comp;6212363..6213879;;16s;;502;502;;;;*502
comp;6214382..6215329;;CDS;;90019;;;;316;
;;;;;;;;;;
comp;6305349..6306314;;CDS;;123;123;;;322;123
comp;6306438..6306527;;tcc;;281;281;;;;
comp;6306809..6307984;;CDS;;66527;;;;392;
;;;;;;;;;;
;6374512..6375684;;CDS;;125;125;;;391;125
comp;6375810..6375884;;agg;;303;303;;;;
comp;6376188..6378578;;CDS;;13398;;;;797;
;;;;;;;;;;
comp;6391977..6392753;;CDS;;114;114;;;259;114
comp;6392868..6392984;;5s;;134;;;;;
comp;6393119..6396033;;23s;;214;;;;;
comp;6396248..6397764;;16s;;1120;;;;;
comp;6398885..6399001;;5s;;139;;;;;
comp;6399141..6402055;;23s;;214;;;;;
comp;6402270..6403786;;16s;;748;748;;;;
comp;6404535..6405107;;CDS;;31702;;;;191;
;;;;;;;;;;
;6436810..6437790;;CDS;;192;192;;;327;
comp;6437983..6438059;;gac;+;6;;6;;;
comp;6438066..6438141;;gta;3x;14;;14;;;
comp;6438156..6438230;;gaa;gac gta ;29;;29;;;
comp;6438260..6438334;;aca;gaa aca – 1;10;;10;;;
comp;6438345..6438421;;gac;;6;;6;;;
comp;6438428..6438503;;gta;;16;;16;;;
comp;6438520..6438594;;gaa;;29;;29;;;
comp;6438624..6438698;;aca;;10;;10;;;
comp;6438709..6438785;;gac;;6;;6;;;
comp;6438792..6438867;;gta;;14;;14;;;
comp;6438882..6438956;;gaa;;162;162;;;;162
comp;6439119..6439685;;CDS;;37865;;;;189;

cbei cumuls[modifier | modifier le wikicode]

cbei cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;17;1;0;2;1;0;1;0;100;4
;16 23 5s 0;7;20;34;3;50;2;50;2;200;19
;16 atc gca;1;40;12;1;100;7;100;6;300;11
;16 5 23s a;3;60;2;0;150;7;150;5;400;20
;max a;4;80;2;0;200;9;200;7;500;6
;a doubles;1;100;0;0;250;5;250;3;600;3
;autres;6;120;0;0;300;6;300;5;700;2
;total aas;19;140;0;0;350;6;350;2;800;1
sans ;opérons;20;160;1;0;400;4;400;1;900;4
;1 aa;11;180;0;0;450;3;450;2;1000;1
;max a;19;200;0;0;500;2;500;0;1100;0
;a doubles;5;;3;0;;21;;4;;0
;total aas;74;;54;6;;72;;37;;71
total aas;;93;;;;;;;;;
remarques;;6;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;
sans jaune;;;moyenne;18;7;;350;;195;;328
;;;variance;17;9;;225;;111;;206

cbei blocs[modifier | modifier le wikicode]

cbei blocs;;;;
16s;213;503;339;
23s;108;202;138;
5s;14;5;44;
atgi;atgi;ttc;atgi;
;;;;
16s;339;502;578;
23s;273;205;274;
5s;;;;
;;;;
aaa;5;;;
5s;159;5s;139;134
cds;294;23s;339;214
aaa;7;16s;1102;1120
5s;138;5s;138;139
23s;339;23s;339;214
16s;;16s;;
;;;;
16s;338;338;16s;140
23s;140;140;gca;3
aac;3;3;atc;111
5s;aac;aac;23s;70
;;;5s;5
;;;ttc;
;;;;
16s;137;;16s;132
gca;118;;atc;84
23s;204;;23s;71
5s;;;aac;
;;;;
ttc;5;;;
5s;;;;

afn[modifier | modifier le wikicode]

afn opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Acid_ferm_DSM_20731/;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_013740.1;afn;;;;
56%GC;30.6.19 Paris;16s  6;60;doubles;intercalaires
;Acidaminococcus fermentans DSM 20731;;;;
;24678..26242;;16s;@1;359
;26602..29507;;23s;;228
;29736..29852;;5s;;
;;;;;
;36819..36894;;acg;;
;;;;;
;57713..59277;;16s;;359
;59637..62543;;23s;;228
;62772..62888;;5s;;
;;;;;
;169459..169534;;gcc;;
;;;;;
;249791..249867;;agg;;
;;;;;
comp;274627..274703;;cgt;;
;;;;;
;311123..311198;;aca;;22
;311221..311305;;tac;;5
;311311..311386;;atg;;3
;311390..311465;;acc;;6
;311472..311548;;atgf;;
;;;;;
;380482..382046;;16s;;251
;382298..385204;;23s;;229
;385434..385550;;5s;;
;;;;;
;461553..461627;;aac;;3
;461631..461705;;gaa;;8
;461714..461789;;gta;;50
;461840..461916;;cca;;11
;461928..462001;;gga;;8
;462010..462086;;aga;;
;;;;;
;526984..527070;;ctg;+;30
;527101..527186;;ctc;2 ctg;52
;527239..527325;;ctg;;
;;;;;
;578049..578123;;ggc;;
;;;;;
;636984..638548;;16s;@2;94
;638643..638719;;atc;;66
;638786..638861;;gca;;273
;639135..642040;;23s;;139
;642180..642296;;5s;;
;;;;;
;712229..712304;;cac;;18
;712323..712398;;caa;;3
;712402..712477;;aaa;;16
;712494..712577;;cta;;
;;;;;
comp;724421..724497;;gtc;;
;;;;;
;774880..774956;;gac;;4
;774961..775036;;ttc;;8
;775045..775119;;ggc;;9
;775129..775202;;tgc;;13
;775216..775304;;tta;;
;;;;;
;796654..796728;;cgg;;
;;;;;
;842393..842469;;gac;;2
;842472..842547;;ttc;;8
;842556..842630;;ggc;;9
;842640..842713;;tgc;;
;;;;;
;889670..889746;;ccc;;
;;;;;
;906136..906210;;aac;;
;;;;;
;1022783..1022859;;gac;;2
;1022862..1022936;;ggc;;1
;1022938..1023011;;tgg;;
;;;;;
;1555201..1555277;;ccg;;
;;;;;
comp;1567911..1567999;;tca;;
;;;;;
comp;1613773..1613863;;agc;;
;;;;;
;1702659..1702744;;ttg;;
;;;;;
comp;1711770..1711886;;5s;;228
comp;1712115..1715021;;23s;;359
comp;1715381..1716945;;16s;;
;;;;;
comp;1823852..1823927;;gta;;6
comp;1823934..1824008;;gaa;;8
comp;1824017..1824092;;aag;;
;;;;;
;1909446..1909536;;tcc;;
;;;;;
comp;1911342..1911429;;tcg;;
;;;;;
comp;1974984..1975058;;atgi;;
;;;;;
comp;1984782..1984856;;gag;;12
comp;1984869..1984942;;cag;+;111
comp;1985054..1985127;;cag;2 cag;
;;;;;
comp;2072279..2072395;;5s;;228
comp;2072624..2075529;;23s;;298
comp;2075828..2075903;;gca;;66
comp;2075970..2076046;;atc;;94
comp;2076141..2077705;;16s;;
;;;;;
;2148343..2148418;;gcg;;
;;;;;
comp;2287117..2287192;;aaa;;
;;;;;
comp;2303018..2303094;;gtg;;
;;;;;
comp;2323563..2323636;;ggg;;

afn cumuls[modifier | modifier le wikicode]

afn cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;6;1;1;-
;16 23 5s 0;4;20;21;
;16 atc gca;2;40;2;
;16 23 5s a;0;60;2;
;max a;2;80;0;
;a doubles;0;100;0;
;spéciaux;0;120;1;
;total aas;4;140;0;
sans ;opérons;29;160;0;
;1 aa;20;180;0;
;max a;6;200;0;
;a doubles;2;;0;
;total aas;56;;27;0
total aas;;60;;;
remarques;;2;;;
avec jaune;;;moyenne;16;
;;;variance;23;
sans jaune;;;moyenne;12;
;;;variance;13;

afn blocs[modifier | modifier le wikicode]

afn blocs;;;;;;
16s;359;1565;359;1565;251;1565
23s;228;2906;228;2907;229;2907
5s;;117;;117;;117
;;;;;;
16s;94;1565;;5s;228;117
atc;66;;;23s;298;2906
gca;273;;;gca;66;
23s;139;2906;;atc;94;
5s;;117;;16s;;1565
;;;;;;
5s;228;117;;;;
23s;359;2907;;;;
16s;;1565;;;;

afn remarques[modifier | modifier le wikicode]

afn;;;;;;;60
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;2
atc;2;acc;1;aac;2;agc;1
ctc;1;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;3;ggc;4
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;2;aga;1
cta;1;cca;1;caa;1;cga;
gta;2;gca;2;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;2;ccg;1;cag;2;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

gamma[modifier | modifier le wikicode]

Shewanella[modifier | modifier le wikicode]

spl opérons[modifier | modifier le wikicode]

39.1%GC;30.6.19 Paris;16s  11;147;doubles;intercalaires
;Shewanella pealeana;;;;
;45136..46685;;16s;@1;339
;47025..49946;;23s;;112
;50059..50174;;5s;;
;;;;;
;51490..53039;;16s;;339
;53379..56298;;23s;;114
;56413..56528;;5s;;
;;;;;
;182271..183820;;16s;@2;71
;183892..183968;;atc;;65
;184034..184109;;gca;;364
;184474..187395;;23s;;112
;187508..187623;;5s;;100
;187724..187800;;gac;;
;;;;;
;191614..191689;;aca;;8
;191698..191782;;tac;;35
;191818..191891;;gga;;
;;;;;
;235182..236731;;16s;;374
;237106..240025;;23s;;114
;240140..240255;;5s;;
;;;;;
;243631..245180;;16s;;338
;245519..248440;;23s;;113
;248554..248669;;5s;;68
;248738..248813;;acc;;17
;248831..248946;;5s;;
;;;;;
;416766..416842;;cgg;;39
;416882..416957;;cac;;41
;416999..417075;;cca;+;58
;417134..417210;;cca;2 cca;
;;;;;
;493711..495260;;16s;;339
;495600..498519;;23s;;114
;498634..498749;;5s;;
;;;;;
;641376..641466;;tca;@3;1172
;642639..642729;;tca;;
;;;;;
;645847..647396;;16s;;71
;647468..647544;;atc;;65
;647610..647685;;gca;;329
;648015..650937;;23s;;156
;651094..651209;;5s;;
;;;;;
;728115..728199;;ttg;;
;;;;;
comp;1168942..1169018;;atgi;;
;;;;;
comp;1339706..1339781;;aca;+;52
comp;1339834..1339909;;ttc;2 ttc;539
comp;1340449..1340524;;aca;2 aca;52
comp;1340577..1340652;;ttc;;
;;;;;
comp;1342467..1342542;;aca;;52
comp;1342595..1342670;;ttc;;
;;;;;
;1456724..1456815;;agc;;21
;1456837..1456913;;cgt;+;30
;1456944..1457020;;cgt;7 cgt;32
;1457053..1457129;;cgt;3 agc;30
;1457160..1457236;;cgt;;33
;1457270..1457346;;cgt;;9
;1457356..1457447;;agc;;76
;1457524..1457600;;cgt;;35
;1457636..1457712;;cgt;;9
;1457722..1457813;;agc;;
;;;;;
comp;1627363..1627438;;agg;;
;;;;;
comp;1770483..1770558;;gta;+;37
comp;1770596..1770671;;gta;11 gta;37
comp;1770709..1770784;;gta;;37
comp;1770822..1770897;;gta;;37
comp;1770935..1771010;;gta;;37
comp;1771048..1771123;;gta;;37
comp;1771161..1771236;;gta;;37
comp;1771274..1771349;;gta;;37
comp;1771387..1771462;;gta;;37
comp;1771500..1771575;;gta;;39
comp;1771615..1771690;;gta;;
;;;;;
;1773910..1773985;;gcc;+;80
;1774066..1774141;;gaa;13 gaa;102
;1774244..1774319;;gaa;2 gcc;102
;1774422..1774497;;gaa;;102
;1774600..1774675;;gaa;;102
;1774778..1774853;;gaa;;102
;1774956..1775031;;gaa;;102
;1775134..1775209;;gaa;;102
;1775312..1775387;;gaa;;253
;1775641..1775716;;gaa;;102
;1775819..1775894;;gaa;;102
;1775997..1776072;;gaa;;102
;1776175..1776250;;gaa;;102
;1776353..1776428;;gaa;;47
;1776476..1776551;;gcc;;
;;;;;
;2081297..2082846;;16s;;338
;2083185..2086104;;23s;;114
;2086219..2086334;;5s;;
;;;;;
comp;2143274..2143350;;ccc;;
;;;;;
comp;2366164..2366240;;atgf;+;40
comp;2366281..2366357;;atgf;4 atgf;40
comp;2366398..2366474;;atgf;;40
comp;2366515..2366591;;atgf;;
;;;;;
;2376218..2376308;;tca;;
;;;;;
;2379767..2379842;;ggc;;13
;2379856..2379929;;tgc;;85
;2380015..2380100;;tta;;
;;;;;
;2550857..2550932;;ggc;;13
;2550946..2551019;;tgc;+;95
;2551115..2551200;;tta;3 tgc;634
;2551835..2551908;;tgc;3 tta;95
;2552004..2552089;;tta;;479
;2552569..2552642;;tgc;;132
;2552775..2552860;;tta;;
;;;;;
;2558019..2558109;;tca;;
;;;;;
comp;2717566..2717655;;tcc;;
;;;;;
comp;2759730..2759806;;atgf;+;189
comp;2759996..2760072;;atgf;4 atgf;45
comp;2760118..2760194;;gtc;2 gtc;2
comp;2760197..2760273;;atgf;;35
comp;2760309..2760385;;gtc;;13
comp;2760399..2760475;;atgf;;
;;;;;
;2858823..2858907;;tac;+;30
;2858938..2859022;;tac;5 tac;85
;2859108..2859192;;tac;;107
;2859300..2859384;;tac;;107
;2859492..2859576;;tac;;
;;;;;
;2866268..2866343;;aac;+;45
;2866389..2866464;;aac;7aac;41
;2866506..2866581;;aac;;26
;2866608..2866683;;aac;;32
;2866716..2866791;;aac;;33
;2866825..2866900;;aac;;40
;2866941..2867016;;aac;;
;;;;;
comp;2929429..2929505;;gac;+;97
comp;2929603..2929679;;gac;4 gac;97
comp;2929777..2929853;;gac;;83
comp;2929937..2930013;;gac;;
;;;;;
comp;3120289..3120364;;aaa;+;58
comp;3120423..3120498;;aaa;12 aaa;58
comp;3120557..3120632;;aaa;;58
comp;3120691..3120766;;aaa;;59
comp;3120826..3120901;;aaa;;57
comp;3120959..3121034;;aaa;;58
comp;3121093..3121168;;aaa;;58
comp;3121227..3121302;;aaa;;59
comp;3121362..3121437;;aaa;;58
comp;3121496..3121571;;aaa;;59
comp;3121631..3121706;;aaa;;59
comp;3121766..3121841;;aaa;;
;;;;;
comp;3269860..3269935;;cac;;8
comp;3269944..3270020;;aga;;63
comp;3270084..3270160;;cca;;
;;;;;
comp;3757983..3758059;;atgf;;
comp;3758163..3758249;;ctc;;
;;;;;
comp;3835257..3835331;;caa;+;51
comp;3835383..3835467;;cta;5 caa;131
comp;3835599..3835673;;caa;5 cta;20
comp;3835694..3835778;;cta;3 atg;96
comp;3835875..3835949;;caa;;49
comp;3835999..3836083;;cta;;211
comp;3836295..3836371;;atg;;5
comp;3836377..3836451;;caa;;47
comp;3836499..3836583;;cta;;55
comp;3836639..3836715;;atg;;5
comp;3836721..3836795;;caa;;47
comp;3836843..3836927;;cta;;55
comp;3836983..3837059;;atg;;
;;;;;
comp;3862885..3862961;;tgg;+;167
comp;3863129..3863205;;tgg;2 tgg;
;;;;;
comp;3867049..3867164;;5s;;114
comp;3867279..3870198;;23s;;338
comp;3870537..3872086;;16s;;
;;;;;
;3882154..3882229;;ttc;;
;;;;;
comp;4331488..4331563;;ggc;+;130
comp;4331694..4331769;;ggc;6 ggc;47
comp;4331817..4331892;;ggc;;162
comp;4332055..4332130;;ggc;;16
comp;4332147..4332222;;ggc;;48
comp;4332271..4332346;;ggc;;
;;;;;
comp;4616881..4616996;;5s;;112
comp;4617109..4620030;;23s;;364
comp;4620395..4620470;;gca;;65
comp;4620536..4620612;;atc;;71
comp;4620684..4622233;;16s;;
;;;;;
comp;5129770..5129846;;gac;;100
comp;5129947..5130062;;5s;;115
comp;5130178..5133097;;23s; ;339
comp;5133437..5134986;;16s;;

spl cumuls[modifier | modifier le wikicode]

spl cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;0;;1;;1;;100;
;16 23 5s 0;6;20;12;;50;;20;;200;
;16 atc gca;3;40;27;;100;;40;;300;
;16 23 5s a;2;60;28;;150;;60;;400;
;max a;3;80;3;;200;;80;;500;
;a doubles;0;100;8;;250;;100;;600;
;spéciaux;0;120;13;;300;;120;;700;
;total aas;9;140;3;;350;;140;;800;
sans ;opérons;29;160;0;;400;;160;;900;
;1 aa;8;180;2;;450;;180;;1000;
;max a;15;200;1;;500;;200;;1100;
;a doubles;15;;6;;;;;;;
;total aas;133;;103;;;0;;0;;0
total aas;;142;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;88;;;;;;;
;;;variance;143;;;;;;;
sans jaune;;;moyenne;58;;;;;;;
;;;variance;35;;;;;;;

spl blocs[modifier | modifier le wikicode]

spl blocs;;;;;;;
16s;339;339;374;339;338;338;
23s;112;114;114;114;114;114;
5s;;;;;;;
;;;;;;;
16s;71;71;71;16s;338;16s;339
atc;65;65;65;23s;113;23s;115
gca;364;329;364;5s;68;5s;100
23s;112;156;112;acc;17;gac;
5s;100;;;5s;;;
gac;;;;;;;

Vibrio parahaemolyticus[modifier | modifier le wikicode]

vpb opérons[modifier | modifier le wikicode]

45.3%GC;6.7.19 Paris;16s 11 ;126;doubles;intercalaires
Vibrio parahaemolyticus BB22OP;;;chr1;;
;33614..35175;;16s;@4;80
;35256..35331;;gaa;;2
;35334..35409;;aaa;;30
;35440..35515;;gta;;55
comp;35571..35768;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;59
;35828..38743;;23s;;73
;38817..38932;;5s;;
;;;;;
;49997..50073;;cgg;;32
;50106..50181;;cac;+;72
;50254..50330;;cca;2 cac;49
;50380..50455;;cac;2 cca;24
;50480..50556;;cca;;
;;;;;
comp;400045..400120;;atgi;;
;;;;;
;577971..579532;;16s;;88
;579621..579696;;gcc;;12
;579709..579784;;gaa;;258
;580043..582958;;23s;;73
;583032..583147;;5s;;30
;583178..583254;;gac;;35
;583290..583366;;tgg;;
;;;;;
comp;769649..769733;;cta;+;29
comp;769763..769847;;cta;10 cta;47
comp;769895..769971;;atg;4 atg;24
comp;769996..770080;;cta;5 caa;52
comp;770133..770207;;caa;;29
comp;770237..770321;;cta;;53
comp;770375..770451;;atg;;24
comp;770476..770560;;cta;;52
comp;770613..770687;;caa;;29
comp;770717..770801;;cta;;54
comp;770856..770930;;caa;;29
comp;770960..771044;;cta;;35
comp;771080..771154;;caa;;48
comp;771203..771287;;cta;;31
comp;771319..771403;;cta;;77
comp;771481..771557;;atg;;77
comp;771635..771709;;caa;;31
comp;771741..771825;;cta;;40
comp;771866..771942;;atg;;
;;;;;
;786939..787015;;cca;;
;;;;;
comp;802315..802391;;agg;;
;;;;;
;910219..910295;;aga;;
;;;;;
comp;982089..982173;;tac;+;81
comp;982255..982339;;tac;4 tac;81
comp;982421..982505;;tac;;81
comp;982587..982671;;tac;;
;;;;;
;1124715..1124802;;tcc;;
;;;;;
;1418321..1418397;;gtc;+;32
;1418430..1418506;;gtc;2gtc;
;;;;;
comp;1988127..1988202;;ggc;+;10
comp;1988213..1988299;;tta;2 ggc;76
comp;1988376..1988451;;ggc;;20
comp;1988472..1988545;;tgc;;
;;;;;
;2164082..2164157;;aac;;
;;;;;
;2193593..2193683;;tca;;
;;;;;
comp;2547884..2547960;;atgf;;56
comp;2548017..2548100;;ctc;;
;;;;;
;2652092..2652168;;cgt;+;56
comp;2652225..2652301;;cgt;9 cgt;57
comp;2652359..2652435;;cgt;2 agc;57
comp;2652493..2652569;;cgt;;57
comp;2652627..2652703;;cgt;;57
comp;2652761..2652837;;cgt;;56
comp;2652894..2652970;;cgt;;210
comp;2653181..2653257;;cgt;;31
comp;2653289..2653380;;agc;@5;320
comp;2653701..2653777;;cgt;;31
comp;2653809..2653900;;agc;;
;;;;;
;2735697..2735772;;ttc;+;64
;2735837..2735912;;aca;3 ttc;7
;2735920..2735995;;ttc;2 aca;70
;2736066..2736141;;aac;2 aac;71
;2736213..2736288;;aca;;7
;2736296..2736371;;ttc;;43
;2736415..2736490;;aac;;
;;;;;
;2738623..2738698;;ttc;;51
;2738750..2738825;;aca;+;21
;2738847..2738922;;aac;2 aca;39
;2738962..2739037;;aca;2 aac;15
;2739053..2739128;;aac;;
;;;;;
comp;2741263..2741339;;gac;;31
comp;2741371..2741487;;5s;;57
comp;2741545..2741620;;acc;;100
comp;2741721..2741836;;5s;;73
comp;2741910..2744825;;23s;;257
comp;2745083..2745158;;gca;;41
comp;2745200..2745276;;atc;;56
comp;2745333..2746894;;16s;;
;;;;;
comp;2755928..2756012;;ttg;;
;;;;;
comp;2847646..2847722;;tgg;;68
comp;2847791..2847867;;gac;;30
comp;2847898..2848013;;5s;;73
comp;2848087..2851002;;23s;;258
comp;2851261..2851336;;gaa;;80
comp;2851417..2852978;;16s;;
;;;;;
comp;2987485..2987561;;atgf;+;56
comp;2987618..2987693;;ggc;5 atgf;18
comp;2987712..2987788;;atgf;8 ggc;35
comp;2987824..2987899;;ggc;;50
comp;2987950..2988025;;ggc;;49
comp;2988075..2988150;;ggc;;49
comp;2988200..2988275;;ggc;;30
comp;2988306..2988382;;atgf;;55
comp;2988438..2988513;;ggc;;30
comp;2988544..2988620;;atgf;;39
comp;2988660..2988735;;ggc;;19
comp;2988755..2988831;;atgf;;35
comp;2988867..2988942;;ggc;;
;;;;;
comp;3060924..3061000;;tgg;;68
comp;3061069..3061145;;gac;;30
comp;3061176..3061291;;5s;;73
comp;3061365..3064280;;23s;;257
comp;3064538..3064613;;gta;;14
comp;3064628..3064703;;gca;;32
comp;3064736..3064811;;aaa;;2
comp;3064814..3064889;;gaa;;80
comp;3064970..3066531;;16s;@3;319
comp;3066851..3066966;;5s;;73
comp;3067040..3069955;;23s;;261
comp;3070217..3071778;;16s;;
;;;;;
comp;3105094..3105169;;acc;;13
comp;3105183..3105257;;gga;;35
comp;3105293..3105377;;tac;;36
comp;3105414..3105489;;aca;;
;;;;;
comp;3111073..3111149;;gac;;30
comp;3111180..3111295;;5s;;73
comp;3111369..3114284;;23s;;261
comp;3114546..3116107;;16s;@1;317
comp;3116425..3116540;;5s;;73
comp;3116614..3119529;;23s;;261
comp;3119791..3121352;;16s;;
;;;;;
comp;3175944..3176034;;tca;;69
comp;3176104..3176219;;5s;;73
comp;3176293..3179211;;23s;;257
comp;3179469..3179544;;gca;;41
comp;3179586..3179662;;atc;;56
comp;3179719..3181280;;16s;@2;
;;;;;
comp;3217187..3217263;;gac;;30
comp;3217294..3217409;;5s;;73
comp;3217483..3220398;;23s;;59
;3220458..3220655;;MQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKL LKSYVSSQGSTFSKDFQSRRF;CDS 198;55
comp;3220711..3220786;;gta;;30
comp;3220817..3220892;;aaa;;2
comp;3220895..3220970;;gaa;;80
comp;3221051..3222612;;16s;;
Vibrio parahaemolyticus BB22OP;;;chr2;;
;132908..134469;;16s;;80
;134550..134625;;gaa;;2
;134628..134703;;aaa;;16
;134720..134795;;gca;;14
;134810..134885;;gta;;54
comp;134940..135122;;MTSHQSCLQFLNMMQTRFCRTQIPRTLECVILVFVIKTNIENFTNNNKLLFCQLSKLLKS;CDS 180;19
;135142..138059;;23s;;73
;138133..138248;;5s;;69
;138318..138408;;tca;;
;;;;;
comp;192886..192969;;ctc;;
;;;;;
comp;591931..592021;;tca;;
;;;;;
comp;1009457..1009530;;tgc;;73
comp;1009604..1009690;;tta;;
;;;;;
comp;1021568..1021641;;tgc;;73
comp;1021715..1021801;;tta;;
;;;;;
comp;1029973..1030048;;ggc;;3
comp;1030052..1030125;;tgc;;

vpb cumuls[modifier | modifier le wikicode]

vpb cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;9;1;0;0;1;;1;;100;
;16 23 5s 0;0;20;9;8;50;;20;;200;
;16 atc gca;2;40;24;4;100;;40;;300;
;16 23 5s a;1;60;21;2;150;;60;;400;
;max a;6;80;9;2;200;;80;;500;
;a doubles;0;100;3;0;250;;100;;600;
;spéciaux;6;120;0;0;300;;120;;700;
;total aas;33;140;0;0;350;;140;;800;
sans ;opérons;25;160;0;0;400;;160;;900;
;1 aa;11;180;0;0;450;;180;;1000;
;max a;19;200;0;0;500;;200;;1100;
;a doubles;8;;1;0;;;;;;
;total aas;93;;67;16;;0;;0;;0
total aas;;126;;;;;;;;;
remarques;;5;;;;;;;;;
avec jaune;;;moyenne;46;26;;;;;;
;;;variance;29;22;;;;;;
sans jaune;;;moyenne;43;;;;;;;
;;;variance;17;;;;;;;

vpb blocs[modifier | modifier le wikicode]

vpb blocs;;;;;;;
16s;80;16s;80;16s;80;;
gaa;2;gaa;2;gaa;2;;
aaa;30;aaa;30;aaa;16;;
gta;55;gta;55;gca;14;;
cds 198;59;cds 198;59;gta;54;;
23s;73;23s;73;cds 180;19;;
5s;;5s;30;23s;73;;
;;gac;;5s;69;;
;;;;tca;;;
;;;;;;;
16s;56;16s;56;16s;88;16s;80
atc;41;atc;41;gcc;12;gaa;258
gca;257;gca;257;gaa;258;23s;73
23s;73;23s;73;23s;73;5s;30
5s;100;5s;69;5s;30;gac;
acc;57;tca;;gac;;;
5s;31;;;;;;
gac;;;;;;;
;;;;;;;
16s;261;16s;261;;;;
23s;73;23s;73;;;;
5s;319;5s;317;;;;
16s;80;16s;261;;;;
gaa;2;23s;73;;;;
aaa;32;5s;30;;;;
gca;14;gac;;;;;
gta;257;;;;;;
23s;73;;;;;;
5s;30;;;;;;
gac;;;;;;;

Escherichia albertii[modifier | modifier le wikicode]

eal opérons[modifier | modifier le wikicode]

49.6%GC;10.3.19 Paris;16s   7;89;doubles;intercalaires
Escherichia albertii;;;;;
;219063..219144;;tac;+;212
;219357..219438;;tac;2 tac;
;;;;;
;413135..413219;;tcc;;
;;;;;
;462888..462972;;tca;;
;;;;;
comp;489120..489191;;gga;;6
comp;489198..489270;;aca;;
;;;;;
;615149..615233;;tcc;;
;;;;;
comp;756823..756895;;aaa;+;5
comp;756901..756973;;gta;3 aaa ;48
comp;757022..757094;;aaa;2 gta;5
comp;757100..757172;;gta;;48
comp;757221..757293;;aaa;;
;;;;;
;834529..834602;;atg;+;10
;834613..834694;;cta;2atg ;26
;834721..834792;;caa;2caa ;37
;834830..834901;;caa;2 cag;18
;834920..834993;;atg;;51
;835045..835116;;cag;;35
;835152..835223;;cag;;
;;;;;
comp;968958..969031;;aga;;
;;;;;
comp;1192416..1192488;;acg;;
;;;;;
comp;1269526..1269599;;gac;;
;;;;;
comp;1277040..1277113;;gac;;52
comp;1277166..1277285;;5s;@1;169
comp;1277455..1280377;;23s;;186
comp;1280564..1280636;;gca;;45
comp;1280682..1280755;;atc;;70
comp;1280826..1282367;;16s;;
;;;;;
;1567231..1567314;;ctg;+;31
;1567346..1567429;;ctg;3 ctg;35
;1567465..1567548;;ctg;;
;;;;;
comp;1657309..1657390;;ttg;;
;;;;;
comp;1765401..1765473;;ggc;+;159
comp;1765633..1765705;;ggc;2 ggc;
;;;;;
;1795516..1795588;;ttc;;
;;;;;
comp;2006002..2006121;;5s;;169
comp;2006291..2009214;;23s;;186
comp;2009401..2009473;;gca;;45
comp;2009519..2009592;;atc;;70
comp;2009663..2011202;;16s;;
;;;;;
comp;2042057..2043241;;tuf1;CDS 1185pb;117
comp;2043359..2043431;;acc;;9
comp;2043441..2043512;;gga;;119
comp;2043632..2043713;;tac;;11
comp;2043725..2043797;;aca;@3;
;;;;;
comp;2047429..2047548;;5s;;169
comp;2047718..2050648;;23s;;186
comp;2050835..2050907;;gca;;45
comp;2050953..2051026;;atc;;68
comp;2051095..2052636;;16s;;
;;;;;
comp;2208305..2208424;;5s;@2;169
comp;2208594..2211517;;23s;;198
comp;2211716..2211788;;gaa;;85
comp;2211874..2213418;;16s;;
;;;;;
comp;2267554..2267627;;cca;;43
comp;2267671..2267754;;ctg;;23
comp;2267778..2267850;;cac;;61
comp;2267912..2267985;;cgg;;
;;;;;
comp;2305358..2305430;;tgg;;11
comp;2305442..2305515;;gac;;52
comp;2305568..2305687;;5s;;169
comp;2305857..2308779;;23s;;198
comp;2308978..2309050;;gaa;;85
comp;2309136..2310676;;16s;;
;;;;;
comp;2426158..2426248;;tga;;
;;;;;
;2556305..2556378;;ccg;;
;;;;;
;2810766..2812307;;16s;;85
;2812393..2812465;;gaa;;198
;2812664..2815586;;23s;;169
;2815756..2815875;;5s;;151
;2816027..2816099;;acc;;40
;2816140..2816259;;5s;;
;;;;;
;2911129..2911212;;ctc;;
;;;;;
; 2913088..2913161;;atgf;;
;;;;;
comp;3010332..3010404;;atgi;;
;;;;;
comp;3177717..3177789;;ttc;;
;;;;;
;3301617..3301687;;ggg;;
;;;;;
comp;3366868..3366941;;atgf;+;37
comp;3366979..3367052;;atgf;3 atgf;37
comp;3367090..3367163;;atgf;;
;;;;;
;3469914..3470003;;agc;;6
;3470010..3470083;;cgt;+;201
;3470285..3470358;;cgt;3 cgt;200
; 3470559..3470632;;cgt;;
;;;;;
;3505321..3505393;;atgi;;
;;;;;
;3563056..3564598;;16s;;85
;3564684..3564756;;gaa;;198
;3564955..3567876;;23s;;169
;3568046..3568165;;5s;;
;;;;;
comp;3779750..3779822;;aaa;;7
comp;3779830..3779902;;gta;+;47
comp;3779950..3780022;;gta;2 gta;
;;;;;
;3782718..3782790;;gcc;+;42
;3782833..3782905;;gcc;2 gcc;
;;;;;
comp;3810369..3810440;;agg;;
;;;;;
comp;3993500..3993573;;ccc;;
;;;;;
comp;4232176..4232248;;aac;;
;;;;;
;4233996..4234068;;aac;;
;;;;;
comp;4242952..4243024;;aac;;
;;;;;
comp;4248342..4248414;;aac;;
;;;;;
;4249406..4249492;;tcg;;
;;;;;
;4256696..4256768;;atgi;;100
;4256869..4256942;;aga;;
;;;;;
;4317980..4318052;;ggc;;56
;4318109..4318179;;tgc;;14
;4318194..4318277;;tta;;
;;;;;
comp;4556753..4556826;;gtc;+;7
comp;4556834..4556907;;gtc;2 gtc;

eal cumuls[modifier | modifier le wikicode]

eal cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;8;;100;;40;;300;
;16 23 5s a;0;60;7;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;1;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;13;140;0;;350;;140;;800;
sans ;opérons;38;160;1;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;1;;500;;200;;1100;
;a doubles;10;;2;;;;;;;
;total aas;72;;33;0;;0;;0;;0
total aas;;85;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;53;;;;;;;
;;;variance;59;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eal blocs[modifier | modifier le wikicode]

eal blocs;;;
16s;70;70;68
atc;45;45;45
gca;186;186;186
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;85;85
gaa;198;198;198
23s;169;169;169
5s;52;;
gac;;;
;;;
16s;85;;
gaa;198;;
23s;169;;
5s;151;;
acc;40;;
5s;;;

Escherichia coli[modifier | modifier le wikicode]

eco opérons[modifier | modifier le wikicode]

Escherichia coli str. K-12 substr. MG1655;;;;;;;
50.6%GC;10.3.19 Paris;16s 7 ;89;doubles;interca;EcoCyc;adIP
;223771..225312;;16s;;68;opéron;
;225381..225457;;atc;;42;ileV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30045]
;225500..225575;;gca;;183;« ;
;225759..228662;;23s;;93;« ;
;228756..228875;;5s;@1;52;« ;
;228928..229004;;gac;;;aspU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30024]
;;;;;;;
;236931..237007;;gac;;;;
;;;;;;;
;262871..262946;;acg;;;;
;;;;;;;
;564723..564799;;aga;;;;
;;;;;;;
comp;696430..696504;;cag;+;37;opéron;
comp;696542..696616;;cag;2 cag;47;glnT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30029]
comp;696664..696740;;atg;2 atg;15;« ;
comp;696756..696830;;caa;2 caa;34;« ;
comp;696865..696939;;caa;;23;« ;
comp;696963..697047;;cta;;9;« ;
comp;697057..697133;;atg;;;;
;;;;;;;
;780554..780629;;aaa;+;135;lysT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30055]
;780765..780840;;gta;5 aaa;2;opéron;
;780843..780918;;aaa;2 gta;149;« ;
;781068..781143;;gta;;3;valZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6389]
;781147..781222;;aaa;;146;opéron;
;781369..781444;;aaa;;132;lysZ;[https://biocyc.org/gene?orgid=ECOLI&id=G6391]
;781577..781652;;aaa;;;lysQ;[https://biocyc.org/gene?orgid=ECOLI&id=G6392]
;;;;;;EcoCyc;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30055&chromosome=COLI-K12]
comp;925884..925971;;tcc;;;InfA-serW;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
;;;;;;;
comp;1031625..1031712;;tca;;;;
;;;;;;;
comp;1097565..1097652;;tcc;;;;
;;;;;;;
comp;1287087..1287176;;tpr ;cds 90pb;67;tpr;
comp;1287244..1287328;;tac;+;209;opéron;
comp;1287538..1287622;;tac;2 tac;;tyrT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30106]
;;;;;;;
; 1746435..1746511;;gtc;+;4;valV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30111]
; 1746516..1746592;;gtc;2 gtc;;opéron;
;;;;;;«RNA 67pb;
comp;1991815..1991901;;tta;;12;leuZ;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1983402/2000314]
comp;1991914..1991987;;tgc;;54;« ;
comp;1992042..1992117;;ggc;;;opéron;
;;;;;;;
comp;2043468..2043557;;tcg;;;;
;;;;;;;
;2044549..2044624;;aac;;;;
;;;;;;;
comp;2058027..2058102;;aac;;;;
;;;;;;;
; 2059851..2059926;;aac;;;;
;;;;;;;
;2062260..2062335;;aac;;;;
;;;;;;;
;2286211..2286287;;ccc;;;;
;;;;;;;
;2466309..2466383;;agg;;;;
;;;;;;;
comp;2518041..2518116;;gcc;+;39;alaX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30012]
comp;2518156..2518231;;gcc;2 gcc;;opéron;
;;;;;;;
;2520931..2521006;;gta;+;44;valU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30110]
;2521051..2521126;;gta;3gta;46;opéron;
;2521173..2521248;;gta;;4;« ;
;2521253..2521328;;aaa;;;« ;
;;;;;;;
comp;2726069..2726188;;5s;@2;92;opéron;
comp;2726281..2729184;;23s;;184;;
comp;2729369..2729444;;gaa;;171;;
comp;2729616..2731157;;16s;;;;
;;;;;;;
comp;2785762..2785837;;atgi;;;;
;;;;;;;
comp;2817784..2817860;;cgt;+;198;« ;
comp;2818059..2818135;;cgt;4 cgt;62;« ;
comp;2818198..2818274;;cgt;;198;« ;
comp;2818473..2818549;;cgt;;3;opéron;
comp;2818553..2818645;;agc;;;serV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30013]
;;;;;;;
;2947387..2947463;;atgf;+;33;opéron;
;2947497..2947573;;atgf;3 atgf;33;metW;[https://biocyc.org/gene?orgid=ECOLI&id=EG31117]
;2947607..2947683;;atgf;;;« ;
;;;;;;;
comp;2998984..2999057;;ggg;;;;
;;;;;;;
;3110366..3110441;;ttc;;;;
;;;;;;;
;3215598..3215673;;atgi;;;;
;;;;;;;
comp;3318213..3318289;;atgf;;;;
;;;;;;;
comp;3322072..3322158;;ctc;;;;
;;;;;;;
comp;3423423..3423542;;5s;;37;« ;
comp;3423580..3423655;;acc;;12;« ;
comp;3423668..3423787;;5s;;92;« ;
comp;3423880..3426783;;23s;;174;« ;
comp;3426958..3427033;;gca;;42;« ;
comp;3427076..3427152;;atc;;68;ileU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30044]
comp;3427221..3428762;;16s;;;opéron;
;;;;;;;
comp;3708616..3708692;;ccg;;;;
;;;;;;;
;3836222..3836316;;tga;;;;
;;;;;;ecoliwiki;[https://ecoliwiki.org/colipedia/index.php/Category:rRNA_operons]
;3941808..3943349;;16s;;85;gltU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30033]
;3943435..3943510;;gaa;;193;opéron;
;3943704..3946607;;23s;;92;« ;
;3946700..3946819;;5s;;52;« ;
;3946872..3946948;;gac;;8;aspT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30023]
;3946957..3947032;;tgg;;;trpT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30105]
;;;;;;;
;3982375..3982451;;cgg;;57;argX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30017]
;3982509..3982585;;cac;;20;opéron;
;3982606..3982692;;ctg;;42;« ;
;3982735..3982811;;cca;;;« ;
;;;;;;;
;4035531..4037072;;16s;;68;opéron;
;4037141..4037217;;atc;;42;ileT;[https://biocyc.org/gene?orgid=ECOLI&id=EG30043]
;4037260..4037335;;gca;;183;« ;
;4037519..4040423;;23s;;93;« ;
;4040517..4040636;;5s;;;« ;
;;;;;;;
;4166659..4168200;;16s;;171;opéron;
;4168372..4168447;;gaa;;193;;
;4168641..4171544;;23s;;92;;
;4171637..4171756;;5s;;;;
;;;;;;;
;4175388..4175463;;aca;@3;8;thrU;[https://biocyc.org/gene?orgid=ECOLI&id=EG30101]
;4175472..4175556;;tac;;116;opéron;
;4175673..4175747;;gga;;6;« ;
;4175754..4175829;;acc;;114;« ;
;4175944..4177128;;tufb;cds 1185 pb;;« ;
;;;;;;;
;4208147..4209688;;16s;;85;opéron;
;4209774..4209849;;gaa;;193;;
;4210043..4212946;;23s;;93;;
;4213040..4213159;;5s;;;;
;;;;;;;
comp;4362551..4362626;;ttc;;;;
;;;;;;;
;4392360..4392435;;ggc;+;36;opéron;
;4392472..4392547;;ggc;3 ggc;35;glyX;[https://biocyc.org/gene?orgid=ECOLI&id=EG30040]
;4392583..4392658;;ggc;;;« ;
;;;;;;;
;4496405..4496489;;ttg;;;;
;;;;;;;
comp;4606079..4606165;;ctg;+;34;opéron;
comp;4606200..4606286;;ctg;3 ctg;28;leuV;[https://biocyc.org/gene?orgid=ECOLI&id=EG30051]
comp;4606315..4606401;;ctg;;;« ;

eco cumuls[modifier | modifier le wikicode]

eco cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;7;1;0;-;1;;1;;100;
;16 23 5s 0;0;20;11;;50;;20;;200;
;16 atc gca;3;40;10;;100;;40;;300;
;16 23 5s a;0;60;6;;150;;60;;400;
;max a;3;80;1;;200;;80;;500;
;a doubles;0;100;0;;250;;100;;600;
;spéciaux;4;120;1;;300;;120;;700;
;total aas;14;140;2;;350;;140;;800;
sans ;opérons;36;160;2;;400;;160;;900;
;1 aa;23;180;0;;450;;180;;1000;
;max a;7;200;2;;500;;200;;1100;
;a doubles;10;;1;;;;;;;
;total aas;72;;36;0;;0;;0;;0
total aas;;86;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;57;;;;;;;
;;;variance;60;;;;;;;
sans jaune;;;moyenne;;;;;;;;
;;;variance;;;;;;;;

eco cds[modifier | modifier le wikicode]

les CDS eco pour opérons;;;;;;;;;
clusters;6.8.19 Paris ;;;interca;cdsa;promoteur;terminateur;notes;
;222833..223408;;cds;362;192;sigma FIS;;;
;223771..225312;;16s;68;;;;;
;225381..225457;;atc;42;;;;;
;225500..225575;;gca;183;;;;;
;225759..228662;;23s;93;;;;;
;228756..228875;;5s;52;;;;;
;228928..229004;;gac;162;;Terminateur;+ sigma;;
;229167..229970;;cds;;268;;;;
;;;;;;;;;
comp;2724448..2725746;;cds;322;433;rien;début opéron ;rien;
comp;2726069..2726188;;5s;92;;;;;
comp;2726281..2729184;;23s;184;;;;;
comp;2729369..2729444;;gaa;171;;;;;
comp;2729616..2731157;;16s;442;;sigma FIS;;;
comp;2731600..2734173;;cds;;858;;;;
;;;;;;;;;
;3422436..3423194;;cds;228;253;Terminateur;fin opéron ;rien;
comp;3423423..3423542;;5s;37;;;;;
comp;3423580..3423655;;acc;12;;;;;
comp;3423668..3423787;;5s;92;;;;;
comp;3423880..3426783;;23s;174;;;;;
comp;3426958..3427033;;gca;42;;;;;
comp;3427076..3427152;;atc;68;;;;;
comp;3427221..3428762;;16s;473;;sigma FIS;;;
;3429236..3429790;;cds;;185;;;;
;;;;;;;;;
comp;3940635..3941327;;cds;480;231;sigma FIS;;;
;3941808..3943349;;16s;85;;;;;
;3943435..3943510;;gaa;193;;;;;
;3943704..3946607;;23s;92;;;;;
;3946700..3946819;;5s;52;;;;;
;3946872..3946948;;gac;8;;;;;
;3946957..3947032;;tgg;95;;Terminateur;fin opéron ;rien;
comp;3947128..3947967;;cds;;280;;;;
;;;;;;;;;
;4034608..4035153;;cds;377;182;Sigma Lrp-leu;;;
;4035531..4037072;;16s;68;;;;;
;4037141..4037217;;atc;42;;;;;
;4037260..4037335;;gca;183;;;;;
;4037519..4040423;;23s;93;;;;;
;4040517..4040636;;5s;228;;;;;
;4040865..4040900;;rprg;5;;pas de Term;fin opéron ;rien;
comp;4040906..4041433;;cds;;176;;;;
;;;;;;;;;
;4165428..4166285;;cds;373;286;Sigma Lrp-leu;;;
;4166659..4168200;;16s;171;;;;;
;4168372..4168447;;gaa;193;;;;;
;4168641..4171544;;23s;92;;;;;
;4171637..4171756;;5s;300;;Terminateur;début opéron ;rien;
;4172057..4173085;;cds;;343;;;;
;;;;;;;;;
comp;4205943..4207532;;cds;614;530;sigma FIS;;;
;4208147..4209688;;16s;85;;;;;
;4209774..4209849;;gaa;193;;;;;
;4210043..4212946;;23s;93;;;;;
;4213040..4213159;;5s;74;;Terminateur;début opéron ;rien;
;4213234..4213617;;cds;;128;;;;
;;;;;;;;;
;695101..696276;;cds;31;392;;;;
comp;696308..696378;;rprg;51;;Terminateur;fin opéron;rien;
comp;696430..696504;;cag;37;;;;;
comp;696542..696616;;cag;47;;;;;
comp;696664..696740;;atg;15;;;;;
comp;696756..696830;;caa;34;;;;;
comp;696865..696939;;caa;23;;;;;
comp;696963..697047;;cta;9;;;;;
comp;697057..697133;;atg;379;;sigma FIS;fin opéron;rien;
comp;697513..699177;;cds;;555;;;;
;;;;;;;;;
;779598..780389;;cds;164;264;sigma FIS;fin opéron;rien;
;780554..780629;;aaa;135;;;;;
;780765..780840;;gta;2;;;;;
;780843..780918;;aaa;149;;;;;
;781068..781143;;gta;3;;;;;
;781147..781222;;aaa;146;;;;;
;781369..781444;;aaa;132;;;;;
;781577..781652;;aaa;432;;Terminateur;début opéron;NadR pas sigma;
;782085..783128;;cds;;348;;;;
;;;;;;;;;
;1286709..1286984;;cds;81;92;Terminateur;;;
comp;1287066..1287236;;ncRNA;-150;;;;;
comp;1287087..1287176;;tpr ;67;30;;;;
comp;1287244..1287328;;tac;209;;;;;
comp;1287538..1287622;;tac;159;;sigma FIS;;;
comp;1287782..1288624;;cds;;281;;;;
;;;;;;;;;
solitaires;;;;promoteur;terminateur;interc avant;interc après;protéines;lien
;236931..237007;;gac;sigma FIS;Term 1;133;328;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=228513/245425]
;262871..262946;;acg;sigma FIS;rien;115;204;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=262297/263521]
;564723..564799;;aga;sigma FIS;rien;243;16;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=564149/565373]
comp;925884..925971;;InfA-tcc;sigma FIS;Term 1;344;254;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=EG30096&chromosome=COLI-K12]
comp;1031625..1031712;;tca;sigma FIS;Term 2;207;427;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1023213/1040125]
comp;1097565..1097652;;tcc;sigma FIS;Term 4;736;234;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=1089153/1106065]
comp;2043468..2043557;;tcg;sigma -;Term 1;570;94;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2035057/2051969]
;2044549..2044624;;aac;sigma -;Term 1;101;314;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2036131/2053043]
comp;2058027..2058102;;aac;sigma -;Term 1;453;101;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2049609/2066521]
; 2059851..2059926;;aac;sigma -;Term 1;5;38;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2051433/2068345]
;2062260..2062335;;aac;sigma NtrC;rien;327;56;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2053842/2070754]
;2286211..2286287;;ccc;sigma FIS;Term 1;75;103;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2277793/2294705]
;2466309..2466383;;agg;sigma -;Term 1;76;162;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2457890/2474802]
comp;2785762..2785837;;atgi;rien;rien;410;-37;évidence faible1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2777344/2794256]
comp;2998984..2999057;;ggg;sigma FIS;rien;156;79;évidence faible;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=2990565/3007477]
;3110366..3110441;;ttc;sigma FIS;Term 1;106;149;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3101948/3118860]
;3215598..3215673;;atgi;sigma -;Term 1;125;54;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3207180/3224092]
comp;3318213..3318289;;atgf;sigma FIS;Term 2;207;348;protéines1;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3309795/3326707]
comp;3322072..3322158;;ctc;sigma -;Term 1;459;15;protéine2;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3313659/3330571]
comp;3708616..3708692;;ccg;sigma FIS;Term 2;911;92;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3700198/3717110]
;3836222..3836316;;tga;sigma -;rien;293;109;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=3827813/3844725]
comp;4362551..4362626;;ttc;sigma FIS;Term 1;198;107;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4354133/4371045]
;4496405..4496489;;ttg;sigma FIS;Term 1;196;261;;[https://biocyc.org/ECOLI/NEW-IMAGE?type=LOCUS-POSITION&object=NIL&chromosome=COLI-K12&orgids=ECOLI&bp-range=4487991/4504903]

eco blocs[modifier | modifier le wikicode]

eco blocs;;;;
16s;68;16s;68;68
atc;42;atc;42;42
gca;174;gca;183;183
23s;92;23s;93;93
5s;12;5s;52;
acc;37;gac;;
5s;;;;
;;;;
16s;85;171;171;85
gaa;193;184;193;193
23s;92;92;92;93
5s;52;;;
gac;;;;

Escherichia coli Nissle 1917[modifier | modifier le wikicode]

ecoN opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Esch_coli_Nissle_1917/eschColi_NISSLE_1917-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP007799.1;ecoN;;genome;;;;;;;;;
50%GC;21.8.19 Paris;16s  10 ;123 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;;
Escherichia coli Nissle 1917 ;;;;;;;;;;;;
;231864..232436;;CDS;;365;365;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
;232802..234321;;16s;;73;;;;1520;;;
;234395..234471;;gaa;;12;;;12;;;;
;234484..234557;;gca;;174;;;;;;;
;234732..237319;;23s;;83;;;;2588;;;
;237403..237518;;5s;;54;;;;116;;;
;237573..237649;;gac;;162;162;;;;162;;
;237812..238615;;CDS;;;;;;268;;2,5-didehydrogluconate reductase DkgB;*
;;;;;;;;;;;;
;244934..245665;;CDS;;132;132;;;244;;DNA polymerase III subunit epsilon;*
;245798..245874;;gac;;120;120;;;;120;;
comp;245995..246852;;CDS;;;;;;286;;DUF4942 domain-containing protein;*
;;;;;;;;;;;;
;367329..368582;;CDS;;114;114;;;418;114;glutamate-5-semialdehyde dehydrogenase;*
;368697..368772;;acg;;154;154;;;;;;
;368927..369265;;CDS;;;;;;113;;DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;631149..632015;;CDS;;270;270;;;289;;bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD;*
;632286..632362;;aga;;15;15;;;;15;;
comp;632378..632997;;CDS;;;;;;207;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;733188..734363;;CDS;;153;153;;;392;153;2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;*
comp;734517..734591;;cag;+;37;;37;;;;;
comp;734629..734703;;cag;2 cag;48;;48;;;;;
comp;734752..734828;;atgj;2 atgj;15;;15;;;;;
comp;734844..734918;;caa;2 caa;34;;34;;;;;
comp;734953..735027;;caa;;23;;23;;;;;
comp;735051..735135;;cta;;10;;10;;;;;
comp;735146..735222;;atgj;;380;380;;;;;;
comp;735603..737267;;CDS;;;;;;555;;asparagine synthase B;*
;;;;;;;;;;;;
;807377..808169;;CDS;;164;164;;;264;164;Pseudo, cell division protein CpoB;*
;808334..808409;;aaa;+;35;;35;;;;;
;808445..808520;;gta;5 aaa;2;;2;;;;;
;808523..808598;;aaa;2 gta;51;;51;;;;;
;808650..808725;;gta;;3;;3;;;;;
;808729..808804;;aaa;;48;;48;;;;;
;808853..808928;;aaa;;33;;33;;;;;
;808962..809037;;aaa;;277;277;;;;;;
;809315..810358;;CDS;;;;;;348;;quinolinate synthase NadA;*
;;;;;;;;;;;;
;950069..952345;;CDS;;343;343;;;*759;343;ATP-dependent Clp protease ATP-binding subunit ClpA;*
comp;952689..952776;;tcc;;253;253;;;;;;
comp;953030..953248;;CDS;;;;;;73;;translation initiation factor IF-1;*
;;;;;;;;;;;;
comp;1047224..1047883;;CDS;;206;206;;;220;206;FtsH protease modulator YccA;*
comp;1048090..1048177;;tca;;426;*426;;;;;;
;1048604..1049722;;CDS;;;;;;373;;hydrogenase 1 small subunit;*
;;;;;;;;;;;;
;1183656..1184018;;CDS;;463;*463;;;121;;hp;*
;1184482..1184558;;aga;;278;278;;;;278;;
> comp;1184837..1185786;;CDS;;;;;;317;;Pseudo, IS4 family transposase;*
;;;;;;;;;;;;
;1213982..1214809;;CDS;;165;165;;;276;165;DUF4942 domain-containing protein;*
comp;1214975..1215062;;tcc;;233;233;;;;;;
;1215296..1216234;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1216817..1217098;;CDS;;165;165;;;94;165;DUF4942 domain-containing protein;*
comp;1217264..1217351;;tcc;;234;234;;;;;;
;1217586..1218524;;CDS;;;;;;313;;glyoxylate/hydroxypyruvate reductase GhrA;*
;;;;;;;;;;;;
;1457038..1458129;;CDS;;16;16;;;364;16;acyl-CoA desaturase;*
comp;1458146..1458277;;ncRNA;;46;;;;44;;RtT sRNA;
comp;1458324..1458408;;tac;+;33;;33;;;;;
comp;1458442..1458526;;tac;2 tac;159;159;;;;;;
comp;1458686..1459528;;CDS;;;;;;281;;formyltetrahydrofolate deformylase;*
;;;;;;;;;;;;
comp;1829066..1830322;;CDS;;307;307;;;419;;hp;*
;1830630..1830706;;gtc;+;4;;4;;;;;
;1830711..1830787;;gtc;2 gtc;6;6;;;;6;;
<;1830794..1831177;;CDS;@4;;;;;128;;Pseudo, multidrug efflux MATE transporter MdtK;*
;;;;;;;;;;;;
comp;1831218..1832474;;CDS;;307;307;;;419;;hp;*
;1832782..1832858;;gtc;+;4;;4;;;;;
;1832863..1832939;;gtc;2 gtc;8;8;;;;8;;
<;1832948..1833280;;CDS;;;;;;111;;Pseudo, MATE family efflux transporter;*
;;;;;;;;;;;;
comp;1833321..1834577;;CDS;;307;307;;;419;;hp;*
;1834885..1834961;;gtc;+;4;;4;;;;;
;1834966..1835042;;gtc;2 gtc;108;108;;;;108;;
;1835151..1835456;;CDS;;;;;;102;;monooxygenase;*
;;;;;;;;;;;;
comp;2115794..2116459;;CDS;;195;195;;;222;;UPF0149 family protein YecA;*
comp;2116655..2116741;;tta;;12;;12;;;;;
comp;2116754..2116827;;tgc;;53;;53;;;;;
comp;2116881..2116956;;ggc;;151;151;;;;151;;
comp;2117108..2117656;;CDS;;;;;;183;;CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase;*
;;;;;;;;;;;;
comp;2191451..2192287;;CDS;;278;278;;;279;;hp;*
comp;2192566..2192655;;tcg;;93;93;;;;93;;
;2192749..2193546;;CDS;;100;100;;;266;100;DgsA anti-repressor MtfA;*
;2193647..2193722;;aac;;161;161;;;;;;
;2193884..2195146;;CDS;;;;;;421;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2232607..2233323;;CDS;;453;*453;;;239;;YebC/PmpR family DNA-binding transcriptional regulator;*
comp;2233777..2233852;;acc;;326;326;;;;326;;
;2234179..2235096;;CDS;;;;;;306;;nitrogen assimilation transcriptional regulator;*
;;;;;;;;;;;;
;2235198..2236148;;CDS;;37;37;;;317;;HTH-type transcriptional regulator Cbl;*
comp;2236186..2236261;;aac;;4;4;;;;4;;
;2236266..2237909;;CDS;;100;100;;;548;100;toxic metabolite efflux MATE transporter YeeO;*
;2238010..2238085;;aac;;161;161;;;;;;
;2238247..2239518;;CDS;;;;;;424;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;
;2546968..2548728;;CDS;;74;74;;;587;74;cardiolipin transport protein PbgA;*
;2548803..2548879;;ccc;;101;101;;;;;;
comp;2548981..2549136;;CDS;;;;;;52;;autotransporter outer membrane beta-barrel domain-containing protein;*
;;;;;;;;;;;;
;2717780..2718712;;CDS;;75;75;;;311;75;formate/nitrite transporter family protein;*
;2718788..2718862;;agg;;437;*437;;;;;;
comp;2719300..2719830;;CDS;;;;;;177;;OmpH family outer membrane protein;*
;;;;;;;;;;;;
comp;2768744..2770933;;CDS;;206;206;;;*730;206;sensor domain-containing phosphodiesterase;*
comp;2771140..2771215;;gcc;+;39;;39;;;;;
comp;2771255..2771330;;gcc;2 gcc;220;220;;;;;;
;2771551..2771910;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;2772355..2773770;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;2774029..2774104;;gta;+;43;;43;;;;;
;2774148..2774223;;gta;3 gta;46;;46;;;;;
;2774270..2774345;;gta;;4;;4;;;;;
;2774350..2774425;;aaa;;110;110;;;;110;;
comp;2774536..2775420;;CDS;;;;;;295;;LysR family transcriptional regulator;*
;;;;;;;;;;;;
comp;2959205..2960503;;CDS;;323;323;;;433;323;alpha-ketoglutarate permease;*
comp;2960827..2960942;;5s;;83;;;;116;;;
comp;2961026..2965477;;23s;;184;;;;4452;;;
comp;2965662..2965737;;gaa;;431;;;;;;;
comp;2966169..2967720;;16s;;441;*441;;;1552;;;
comp;2968162..2970735;;CDS;;;;;;*858;;ATP-dependent chaperone ClpB;*
;;;;;;;;;;;;
comp;3027207..3027773;;CDS;;280;280;;;189;280;fructose-1-phosphate/6-phosphogluconate phosphatase;*
comp;3028054..3028130;;cgt;+;63;;63;;;;;
comp;3028194..3028270;;cgt;5 cgt;62;;62;;;;;
comp;3028333..3028409;;cgt;;62;;62;;;;;
comp;3028472..3028548;;cgt;;64;;64;;;;;
comp;3028613..3028689;;cgt;;3;;3;;;;;
comp;3028693..3028785;;agc;;315;315;;;;;;
comp;3029101..3029286;;CDS;;;;;;62;;carbon storage regulator CsrA;*
;;;;;;;;;;;;
comp;3157337..3158434;;CDS;;208;208;;;366;208;murein transglycosylase A;*
;3158643..3158719;;atgf;+;33;;33;;;;;
;3158753..3158829;;atgf;3 atgf;33;;33;;;;;
;3158863..3158939;;atgf;;635;*635;;;;;;
;3159575..3160075;;CDS;;;;;;167;;type VI secretion system contractile sheath small subunit;*
;;;;;;;;;;;;
;3230172..3231401;;CDS;;316;316;;;410;;HAAAP family serine/threonine permease;*
comp;3231718..3231791;;ggg;;78;78;;;;78;;
comp;3231870..3232625;;CDS;;;;;;252;;peptidoglycan DD-metalloendopeptidase family protein;*
;;;;;;;;;;;;
;3341048..3341755;;CDS;;105;105;;;236;105;DUF554 domain-containing protein;*
;3341861..3341936;;ttc;;197;197;;;;;;
;3342134..3343399;;CDS;;;;;;422;;integrase arm-type DNA-binding domain-containing protein;*
;;;;;;;;;;;;
comp;3569308..3569814;;CDS;;124;124;;;169;;G/U mismatch-specific DNA glycosylase;*
;3569939..3570014;;atgi;;53;53;;;;53;;
comp;3570068..3570832;;CDS;;;;;;255;;NADPH-dependent ferric chelate reductase;*
;;;;;;;;;;;;
comp;3670227..3670679;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3670886..3670962;;atgf;;347;347;;;;;;
>;3671310..3672155;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3673935..3674387;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3674594..3674670;;atgf;;347;347;;;;;;
>;3675018..3675869;;CDS;;;;;;284;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3677794..3678246;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3678453..3678529;;atgf;;347;347;;;;;;
>;3678877..3679722;;CDS;;;;;;282;;Pseudo, argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3681532..3681984;;CDS;;206;206;;;151;206;ribosome maturation factor RimP;*
comp;3682191..3682267;;atgf;;347;347;;;;;;
;3682615..3683958;;CDS;;;;;;448;;argininosuccinate synthase;*
;;;;;;;;;;;;
comp;3683966..3685591;;CDS;;456;*456;;;542;;phosphoethanolamine transferase;*
comp;3686048..3686134;;ctc;;14;14;;;;14;;
comp;3686149..3686481;;CDS;;;;;;111;;preprotein translocase subunit SecG;*
;;;;;;;;;;;;
;3784553..3785311;;CDS;;62;62;;;253;62;amino acid ABC transporter ATP-binding protein;*
comp;3785374..3785489;;5s;@3;39;;;;116;;;
comp;3785529..3785605;;acc;;14;;;;;;;
comp;3785620..3785735;;5s;;777;;;;116;;;
comp;3786513..3786588;;acc;;14;;;;;;;
comp;3786603..3786718;;5s;;1834;;;;116;;;
comp;3788553..3788628;;gaa;;1360;*1360;;;;;;
;3789989..3790543;;CDS;;;;;;185;;gamma carbonic anhydrase family protein;*
;;;;;;;;;;;;
comp;4078635..4080242;;CDS;;743;*743;;;536;;dipeptide ABC transporter substrate-binding protein DppA;*
comp;4080986..4081062;;ccg;;91;91;;;;91;;
comp;4081154..4082845;;CDS;;;;;;564;;kdo(2)-lipid A phosphoethanolamine 7''-transferase;*
;;;;;;;;;;;;
comp;4205966..4207348;;CDS;;292;292;;;461;292;glycoside-pentoside-hexuronide family transporter;*
;4207641..4207735;;tga;;300;300;;;;;;
>;4208036..4208857;;CDS;;;;;;274;;Pseudo, DUF4102 domain-containing protein;*
;;;;;;;;;;;;
comp;4338643..4339335;;CDS;;479;*479;;;231;;FadR family transcriptional regulator;*
;4339815..4341342;;16s;;73;;;;1528;;;
;4341416..4341491;;gaa;;184;;;;;;;
;4341676..4344286;;23s;;83;;;;2611;;;
;4344370..4344485;;5s;;53;;;;116;;;
;4344539..4344615;;gac;;8;;;;;;;
;4344624..4344699;;tgg;;95;95;;;;95;;
comp;4344795..4345634;;CDS;;;;;;280;;HTH-type transcriptional regulator HdfR;*
;;;;;;;;;;;;
;4377681..4379066;;CDS;;102;102;;;462;102;amino acid permease;*
;4379169..4379245;;cgg;;58;;58;;;;;
;4379304..4379379;;cac;;20;;20;;;;;
;4379400..4379486;;ctg;;42;;42;;;;;
;4379529..4379605;;cca;;146;146;;;;;;
;4379752..4380987;;CDS;;;;;;412;;anaerobic sulfatase maturase;*
;;;;;;;;;;;;
;4460971..4461516;;CDS;;377;377;;;182;;menaquinone-dependent protoporphyrinogen IX dehydrogenase;*
;4461894..4463631;;16s;;56;;;;1738;;;
;4463688..4463764;;atc;;42;;;42;;;;
;4463807..4463882;;gca;;165;;;;;;;
;4464048..4467338;;23s;;83;;;;3291;;;
;4467422..4467537;;5s;;104;104;;;116;104;;
comp;4467642..4468169;;CDS;;;;;;176;;molybdopterin-guanine dinucleotide biosynthesis protein B;*
;;;;;;;;;;;;
;4605577..4606434;;CDS;;374;374;;;286;;glutamate racemase;*
;4606809..4608362;;16s;;363;;;;1554;;;
;4608726..4608801;;gaa;;1112;;;;;;;
;4609914..4610029;;5s;;136;136;;;116;136;;
;4610166..4611194;;CDS;;;;;;343;;UDP-N-acetylenolpyruvoylglucosamine reductase;*
;;;;;;;;;;;;
comp;4612185..4613135;;CDS;;361;361;;;317;;type I pantothenate kinase;*
;4613497..4613572;;aca;;8;;8;;;;;
;4613581..4613665;;tac;;116;;*116;;;;;
;4613782..4613856;;gga;;6;;6;;;;;
;4613863..4613938;;acc;;114;114;;;;114;;
;4614053..4615237;;CDS;;;;;;395;;elongation factor Tu;*
;;;;;;;;;;;;
comp;4642984..4644573;;CDS;;616;*616;;;530;;bifunctional  phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ;*
;4645190..4646378;;16s’;@1;83;83;;;1189;83;;
;4646462..4648150;;CDS;;436;*436;;;563;;bifunctional isocitrate dehydrogenase kinase/phosphatase;*
;4648587..4648662;;gaa;;185;;;;;;;
;4648848..4651319;;23s;;83;;;;2472;;;
;4651403..4651518;;5s;;76;76;;;116;76;;
;4651595..4651978;;CDS;;;;;;128;;hypothetical protein;*
;;;;;;;;;;;;
< comp;4834504..4834961;;CDS;;197;197;;;153;;pseudo, integrase;*
comp;4835159..4835234;;ttc;;106;106;;;;106;;
comp;4835341..4835916;;CDS;;;;;;192;;transcriptional regulator;*
;;;;;;;;;;;;
;4864628..4865173;;CDS;;210;210;;;182;210;oligoribonuclease;*
;4865384..4865459;;ggc;+;36;;36;;;;;
;4865496..4865571;;ggc;3 ggc;35;;35;;;;;
;4865607..4865682;;ggc;;233;233;;;;;;
;4865916..4865969;;CDS;;;;;;18;;hp;*
;;;;;;;;;;;;
comp;4974178..4975197;;CDS;;195;195;;;340;;NADPH-dependent aldehyde reductase Ahr;*
;4975393..4975477;;ttg;;39;39;;;;39;;
<> comp;4975517..4976055;;CDS;;;;;;180;;pseudo, IS630 family transposase;*
;;;;;;;;;;;;
;5042527..5042763;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5042802..5042888;;ctg;+;34;;34;;;;;
comp;5042923..5043009;;ctg;3 ctg;28;;28;;;;;
comp;5043038..5043124;;ctg;;290;290;;;;;;
comp;5043415..5044446;;CDS;;;;;;344;;16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC;*
;;;;;;;;;;;;
comp;5079375..5079581;;CDS;;117;117;;;69;117;AlpA family transcriptional regulator;*
;5079699..5081218;;16s;;73;;;;1520;;;
;5081292..5081368;;gaa;;12;;;12;;;;
;5081381..5081454;;gca;;366;366;;;;;;
;5081821..5082018;;CDS;;524;*524;;;66;;hypothetical protein;*
comp;5082543..5082754;;CDS;;;;;;71;;hypothetical protein;*
;;;;;;;;;;;;
comp;5090325..5090876;;CDS;;1808;*1808;;;184;;MarR family transcriptional regulator;*
comp;5092685..5092760;;gaa;;588;*588;;;;*588;;
< comp ;5093349..5093474;;CDS;;592;*592;;;42;;sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB;*
;5094067..5094142;;gaa;+;1472;;;*1472;;;;
;5095615..5095691;;atc;3 gaa;42;;;42;;;;
;5095734..5095809;;atc;2 atc;1130;;;*1130;;;;
;5096940..5097015;;gaa;;1145;;;*1145;;;;
;5098161..5098236;;gaa;;185;;;;;;;
;5098422..5100893;;23s;;83;;;;2472;;;
;5100977..5101092;;5s;;76;76;;;116;76;;
;5101169..5101552;;CDS;;63;63;;;128;;hypothetical protein;*
comp;5101616..5102059;;CDS;;;;;;148;;acetyltransferase;*
;;;;;;;;;;;;
;5124754..5125197;;CDS;;63;63;;;148;;acetyltransferase;*
comp;5125261..5125644;;CDS;;76;76;;;128;;hypothetical protein;*
comp;5125721..5125836;;5s;;83;;;;116;;;
comp;5125920..5128366;;23s’;@2;-10;*-10;;;2447;*-10;;
<;5128357..5128479;;CDS;;;;;;41;;pilus assembly protein;*
;;;;;;;;;;;;
comp;5252659..5253870;;CDS;;300;300;;;404;;tyrosine-type recombinase/integrase;*
comp;5254171..5254249;;tga;;292;292;;;;292;;
>;5254542..5255171;;CDS;;;;;;210;;pseudo, glycoside-pentoside-hexuronide family transporter;*
;;;;;;;;;;;;
> comp;5305902..5306228;;CDS;;0;0;;;109;0;pseudo, hp;*
comp;5306229..5306302;;atc;;1096;*1096;;;;;;
;5307399..5308450;;CDS;;;;;;351;;pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada;*
;;;;;;;;;;;;
comp;5321144..5321869;;CDS;;206;206;;;242;206;pseudo, histidine kinase;*
comp;5322076..5322151;;gcc;+;39;;39;;;;;
comp;5322191..5322266;;gcc;3 gcc;39;;39;;;;;
comp;5322306..5322381;;gcc;;220;220;;;;;;
;5322602..5322961;;CDS;;;;;;120;;putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
comp;5323406..5324821;;CDS;;258;258;;;472;;glutamate--tRNA ligase;*
;5325080..5325155;;gta;+;44;;44;;;;;
;5325200..5325275;;gta;2 gta;0;0;;;;0;;
<;5325276..5325389;;CDS;;;;;;38;;pseudo, putative DNA-binding transcriptional regulator;*
;;;;;;;;;;;;
>;5375524..5376270;;CDS;;891;*891;;;249;*891;pseudo, AI-2E family transporter;*
;5377162..5377237;;gaa;;1047;*1047;;;;;;
comp;5378285..5379589;;CDS;;;;;;435;;isocitrate lyase;*
;;;;;;;;;;;;
comp >;5341397..5341492;;CDS;;-2;*-2;;;32;*-2;ABC transporter ATP-binding protein;*
comp;5341491..5344303;;23s;;174;;;;2813;;;
comp;5344478..5344553;;gca;;42;;;42;;;;
comp;5344596..5344672;;atc;;56;;;;;;;
comp;5344729..5346282;;16s;;1063;;;;1554;;;
comp;5347346..5347421;;gca;;42;;;42;;;;
comp;5347464..5347540;;atc;;56;;;;;;;
comp;5347597..5349150;;16s;;365;365;;;1554;;;
comp;5349516..5350088;;CDS;;187;187;;;191;;D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase;*
>;5350276..5350914;;CDS;;;;;;213;;methionine ABC transporter ATP-binding protein MetN;*
;;;;;;;;;;;;
> comp;5359583..5360512;;CDS;;120;120;;;310;;tyrosine-type recombinase/integrase;*
comp;5360633..5360708;;gca;;42;;;;;;;
comp;5360751..5360827;;atc;;56;;;;;;;
comp;5360884..5362138;;16s’;;1;1;;;1255;1;;
< comp;5362140..5363543;;CDS;;;;;;468;;IS66 family transposase;*
;;;;;;;;;;;;
;5425965..5426201;;CDS;;38;38;;;79;38;DUF1435 domain-containing protein;*
comp;5426240..5426325;;ctg;+;26;;26;;;;a disparu le 20.12.19;*
comp;5426352..5426438;;ctg;3 ctg;28;;28;;;;;
comp;5426467..5426553;;ctg;;63;63;;;;;;
< comp;5426617..5427150;;CDS;;;;;;178;;pseudo, IS630-like element IS630 family transposase;*
;;;;;;;;;;;;
>;5433568..5433687;;CDS;;39;39;;;40;39;pseudo, nicotinamide-nucleotide amidase;*
comp;5433727..5433814;;tcc;;253;253;;;;;;
comp;5434068..5434286;;CDS;;;;;;73;;translation initiation factor IF-1;*

ecoN cumuls[modifier | modifier le wikicode]

ecoN cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;12;1;0;;1;5;1;5;100;16;1;0
;16 23 5s;0;20;13;2;50;11;40;10;200;34;30;1
;16 atc gca;2;40;17;;100;17;80;7;300;29;60;6
;16 gaa 235;2;60;9;4;150;16;120;16;400;18;90;8
;max a;5;80;4;;200;15;160;3;500;18;120;8
;a doubles;1;100;0;;250;14;200;4;600;8;150;7
;spéciaux;8;120;1;;300;14;240;9;700;0;180;11
;total aas;27;140;0;;350;12;280;2;800;2;210;11
sans ;opérons;50;160;0;;400;7;320;2;900;1;240;6
;1 aa;32;180;0;;450;4;360;3;1000;0;270;9
;max a;7;200;0;;500;4;400;0;1100;0;300;12
;a doubles;15;;0;;;11;;2;;0;;0
;total aas;94;;44;6;;130;;63;;126;;79
total aas;;121;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;33;32;;253;;142;;272;;172
;;;variance;23;15;;258;;145;;162;;79
sans jaune;;;moyenne;31;;;178;;127;;260;;
;;;variance;19;;;109;;91;;142;;

ecoN blocs[modifier | modifier le wikicode]

ecoN blocs;;;;;;;;;;;;
gène;interca;pbs;cdsa;;;gène;interca;pbs;cdsa;;;rRNAs
cds;365;;191;D-glycero;;cds;374;;286;Glu race;;16s
16s;73;1520;;;;16s;363;1554;;;;1189
gaa;12;;;;;gaa;1112;;;;;1255
gca;174;;;;;5s;136;116;;;;1520
23s;83;2588;;;;cds;;;343;UDP-N;;1520
5s;54;116;;;;;;;;;;1528
gac;162;;;;;cds;117;;69;tr AlpA;;1552
cds;;;268;gluDkgB;;16s;73;1520;;;;1554
;;;;;;gaa;12;;;;;1554
cds;323;;433;glutarate pm;;gca;366;;;;;1554
5s;83;116;;;;cds;524;;66;hp-66;;1738
23s;184;4452;;;;cds;;;71;hp-71;;
gaa;431;;;;;;;;;;;
16s;441;1552;;;;cds;-2;;32;ABC 32;;23s
cds;;;858;ClpB dep;;23s;174;2813;;;;2447
;;;;;;gca;42;;;;;2472
cds;616;;530;AICAR2;;atc;56;;;;;2472
16s’;83;1189;;;;16s;1063;1554;;;;2588
cds;436;;563;kinase isocit;;gca;42;;;;;2611
gaa;185;;;;;atc;56;;;;;2813
23s;83;2472;;;;16s;365;1554;;;;3291
5s;76;116;;;;cds;187;;191;D-glycero;;4452
cds;;;128;hp-128;;cds;;;213;ABC MetN;;
;;;;;;;;;;;;5s
cds;62;;253;pu-ABC;;cds;120;;310;Tyr recb 310;;116 x 11
5s;39;116;;;;gca;42;;;;;
acc;14;;;;;atc;56;;;;;
5s;777;116;;;;16s’;1;1255;;;;
acc;14;;;;;cds;;;468;IS66;;
5s;1834;116;;;;;;;;;;
gaa;1360;;;;;cds;63;;148;transferase;;
cds;;;185;gc anhydrase;;cds;76;;128;hp-128;;
;;;;;;5s;83;116;;;;
cds;377;;182;porphyrine M;;23s’;-10;2447;;;;
16s;56;1738;;;;cds;;;41;pilus;;
atc;42;;;;;;;;;;;
gca;165;;;;;cds;1808;;184;MarR ;;
23s;83;3291;;;;gaa;588;;;;;
5s;104;116;;;;cds;592;;42;sn-glycerol;;
cds;;;176;Mlb pB;;gaa;1472;;;;;
;;;;;;atc;42;;;;;
cds;479;;231;FadR tr ;;atc;1130;;;;;
16s;73;1528;;;;gaa;1145;;;;;
gaa;184;;;;;gaa;185;;;;;
23s;83;2611;;;;23s;83;2472;;;;
5s;53;116;;;;5s;76;116;;;;
gac;8;;;;;cds;63;;128;hp-128;;
tgg;95;;;;;cds;;;148;transferase;;
cds;;;280;HdfR HTH;;;;;;;;

ecoN eco[modifier | modifier le wikicode]

ecoN eco tableaux[modifier | modifier le wikicode]
;;;;;;rouge;ff6600;$;jaune;ffff00;#;;;;;;;;;;;
;;eco ecoN;;;;orange;ffcc00;&;cyan;66ffff;°;gris2;dddddd;];;;;;;;;
;;;;;;jaunev;ccff66;@;turquoise;33ff99;%;Jaunev 5;669900;(;;;;;;;;
;19.12.19 Paris;;pour les cds;;;bleu;00ccff;§;gris1;eeeeee;[;;;;;;;;;;;
;Escherichia coli str. K-12 substr. MG1655;;;;;;;;;;;;;;;;;;;;;
;eco;;;;;;;;ecoN;;;;;;;;;;;;;
cluster;sens;;gènes;interca;cdsa;cds;;cluster;sens;;gènes;interca;cdsa;cds;;ecoN suite;sens;;gènes;interca;cdsa;cds
eco1;;222833..223408;cds;362;192;@D-glycero;;ecoN1;;231864..232436;CDS;365;191;@D-glycero;;EcoN 48;comp;5079375..5079581;CDS;117;69;tr AlpA
;;223771..225312;$16s;68;&1542;;;;;232802..234321;$16s;73;&1520;;;ok;;5079699..5081218;$16s;73;&1520;
;;225381..225457;atc;42;;;;;;234395..234471;gaa;12;;;;;;5081292..5081368;gaa;12;;
;;225500..225575;gca;183;;;;;;234484..234557;gca;174;;;;;;5081381..5081454;gca;366;;
;;225759..228662;$23s;93;&2904;;;;;234732..237319;$23s;83;&2588;;;;;5081821..5082018;CDS;524;66;hp-66
;;228756..228875;$5s;52;&120;;;;;237403..237518;$5s;54;&116;;;;comp;5082543..5082754;CDS;;71;hp-71
;;228928..229004;gac;162;;;;;;237573..237649;gac;162;;;;;;;;;;
;;229167..229970;cds;;268;@metDkgB;;;;237812..238615;CDS;;268;@gluDkgB;;eco1;;222833..223408;cds;[362;192;]D-glycero
;;;;;;;;;;;;;;;;;;223771..225312;$16s;[68;&1542;
eco2;;236067..236798;cds;132;244;@DNAIIIe;;ecoN2;;244934..245665;CDS;132;244;@DNAIIIe;;;;225381..225457;atc;[42;;
;;236931..237007;gac;327;;;;;;245798..245874;gac;120;;;;;;225500..225575;gca;[183;;
;;237335..238120;cds;;262;§lipo YafT;;;comp;245995..246852;CDS;;286;§DUF4942;;;;225759..228662;$23s;93;&2904;
;;;;;;;;;;;;;;;;;;228756..228875;$5s;52;&120;
eco3;;261503..262756;cds;114;418;@glu5dH;;ecoN3;;367329..368582;CDS;114;418;@glu5dH;;;;228928..229004;gac;162;;
;;262871..262946;acg;203;;;;;;368697..368772;acg;154;;;;;;229167..229970;cds;;268;@metDkgB
;comp;263150..263212;cds;;21;§YdiA;;;;368927..369265;CDS;;113;§DUF4102;;EcoN 56;comp >;5341397..5341492;CDS;-2;32;]ABC 32
;;262898..297205;#phage;;11436;pp CP4-6;;;;;;;;;;ok;comp;5341491..5344303;$23s;]174;&2813;
;;;;;;;;;;;;;;;;;comp;5344478..5344553;gca;]42;;
eco4;comp;563848..564480;cds;242;211;§put FimZ;;ecoN4;comp;631149..632015;CDS;270;289;§cyclo FolD;;;comp;5344596..5344672;atc;]56;;
;;564723..564799;aga;15;;;;;;632286..632362;aga;15;;;;;comp;5344729..5346282;$16s;]1063;&1554;
;comp;564815..565978;cds;;388;§put DLP12;;;comp;632378..632997;CDS;;207;§Tyr recb 207;;;comp;5347346..5347421;gca;[42;;
;;564755..586056;#phage;;7101;pp DLP12;;;;;;;;;;;comp;5347464..5347540;atc;[56;;
;;;;;;;;;;;;;;;;;comp;5347597..5349150;$16s;[365;&1554;
eco5;;695101..696276;cds;31;392;@octaprenyl;;ecoN5;;733188..734363;CDS;153;392;@octaprenyl;;;comp;5349516..5350088;CDS;[187;191;]D-glycero
;comp;696308..696378;rpr;51;&71;rpt71;;;comp;734517..734591;°cag;37;;;;;>;5350276..5350914;CDS;;213;ABC MetN
;comp;696430..696504;°cag;37;;;;;comp;734629..734703;°cag;48;;;;eco35;eco;3422436..3423194;cds;228;253;pu-YhdZ
;comp;696542..696616;°cag;47;;;;;comp;734752..734828;atgj;15;;;;;comp;3423423..3423542;$5s;]37;&120;
;comp;696664..696740;atg;15;;;;;comp;734844..734918;°caa;34;;;;;comp;3423580..3423655;acc;]12;;
;comp;696756..696830;°caa;34;;;;;comp;734953..735027;°caa;23;;;;;comp;3423668..3423787;$5s;]92;&120;
;comp;696865..696939;°caa;23;;;;;comp;735051..735135;cta;10;;;;;comp;3423880..3426783;$23s;]174;&2904;
;comp;696963..697047;cta;9;;;;;comp;735146..735222;°atgj;380;;;;;comp;3426958..3427033;gca;]42;;
;comp;697057..697133;°atg;379;;;;;comp;735603..737267;CDS;;555;@Asn B;;;comp;3427076..3427152;atc;]68;;
;comp;697513..699177;cds;;555;@Asn B;;;;;;;;;;;comp;3427221..3428762;$16s;]473;&1542;
;;;;;;;;;;;;;;;;;;3429236..3429790;cds;;185;%protein YrdA
eco6;;779598..780389;cds;164;264;@ cell CpoB;;ecoN6;;807377..808169;CDS;164;264;@ p-cell CpoB;;ecoN35;;3784553..3785311;CDS;62;253;]pu-ABC
;;780554..780629;°aaa;135;;;;;;808334..808409;°aaa;35;;;;;comp;3785374..3785489;$5s;]39;&116;
;;780765..780840;gta;2;;;;;;808445..808520;gta;2;;;;;comp;3785529..3785605;acc;]14;;
;;780843..780918;°aaa;149;;;;;;808523..808598;°aaa;51;;;;;comp;3785620..3785735;$5s;]777;&116;
;;781068..781143;gta;3;;;;;;808650..808725;gta;3;;;;;comp;3786513..3786588;acc;]14;;
;;781147..781222;°aaa;146;;;;;;808729..808804;°aaa;48;;;;;comp;3786603..3786718;$5s;]1834;&116;
;;781369..781444;°aaa;132;;;;;;808853..808928;°aaa;33;;;;;comp;3788553..3788628;gaa;1360;;
;;781577..781652;°aaa;432;;;;;;808962..809037;°aaa;277;;;;;;3789989..3790543;CDS;;185;%gc anhydrase
;;782085..783128;cds;;348;@quino;;;;809315..810358;CDS;;348;@quino NadA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco7;;923264..925540;cds;343;759;@ATP ClpA;;ecoN7;;950069..952345;CDS;343;759;@ATP ClpA;;EcoN 59;>;5433568..5433687;CDS;39;40;§p-Nam
;comp;925884..925971;tcc;253;;;;;comp;952689..952776;tcc;253;;;;ok;comp;5433727..5433814;tcc;253;;
;comp;926225..926443;cds;;73;@tif IF-1;;;comp;953030..953248;CDS;;73;@tif IF-1;;;comp;5434068..5434286;CDS;;73;@tif IF-1
;;;;;;;;;;;;;;;;;;;;;;
eco8;comp;1030759..1031418;cds;206;220;@FtsH;;ecoN8;comp;1047224..1047883;CDS;206;220;@FtsH YccA;;;;;;;;
;comp;1031625..1031712;tca;426;;;;;comp;1048090..1048177;tca;426;;;;;;;;;;
;;1032139..1033257;cds;;373;@Hnase1;;;;1048604..1049722;CDS;;373;@Hnase1;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco9;;;;;;;;ecoN9;;1183656..1184018;CDS;463;121;hp-121;;;;;;;;
;;;*****aga*****;;;;;;;1184482..1184558;aga;278;;;;;;;;;;
;;;;;;;;;> comp;1184837..1185786;CDS;;317;p-IS4;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco10;;1095843..1096829;cds;735;329;§un-YcdU;;ecoN10;;1213982..1214809;CDS;165;276;§DUF4942;;;;;;;;
;comp;1097565..1097652;tcc;233;;;;;comp;1214975..1215062;tcc;233;;;;;;;;;;
;;1097886..1098824;cds;;313;@glyoxylate A;;;;1215296..1216234;CDS;;313;@glyoxyl GhrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco11;;;;;;;;ecoN11;;1216817..1217098;CDS;165;94;§DUF4942;;;;;;;;
;;;*****tcc*****;;;;;;comp;1217264..1217351;tcc;234;;;;;;;;;;
;;;;;;;;;;1217586..1218524;CDS;;313;@glyoxyl GhrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco12;;1286709..1286984;cds;81;92;§p-un-YchS;;ecoN12;;1457038..1458129;CDS;16;364;§acyl-CoA ;;;;;;;;
;comp;1287066..1287236;ncRNA;-150;&171;§RttR sRNA;;;comp;1458146..1458277;ncRNA;46;44;§RtT sRNA;;;;;;;;
;comp;1287087..1287176;cds;67;30;§tpr;;;comp;1458324..1458408;°tac;33;;;;;;;;;;
;comp;1287244..1287328;°tac;209;;;;;comp;1458442..1458526;°tac;159;;;;;;;;;;
;comp;1287538..1287622;°tac;159;;;;;comp;1458686..1459528;CDS;;281;@fTHF;;;;;;;;
;comp;1287782..1288624;cds;;281;@fTHF;;;;;;;;;;;;;;;;
;;;;;;;;ecoN13;comp;1829066..1830322;CDS;307;419;%hp-419;;;;;;;;
eco13;;;;;;;;;;1830630..1830706;°gtc;4;;;;;;;;;;
;;*****;°gtc;*****;;;;;;1830711..1830787;°gtc;6;;;;;;;;;;
;;;°gtc;;;;;;<;1830794..1831177;CDS;;128;§p-MdtK;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;ecoN14;comp;1831218..1832474;CDS;307;419;%hp-419;;;;;;;;
eco14;;*****;°gtc;*****;;;;;;1832782..1832858;°gtc;4;;;;;;;;;;
;;;°gtc;;;;;;;1832863..1832939;°gtc;8;;;;;;;;;;
;;;;;;;;;<;1832948..1833280;CDS;;111;§p-MATE;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco15;comp;1744871..1746127;cds;307;419;%adhes YdhQ;;ecoN15;comp;1833321..1834577;CDS;307;419;%hp-419;;;;;;;;
;; 1746435..1746511;°gtc;4;;;;;;1834885..1834961;°gtc;4;;;;;;;;;;
;; 1746516..1746592;°gtc;107;;;;;;1834966..1835042;°gtc;108;;;;;;;;;;
;;1746700..1747005;cds;;102;@pu-YdhR;;;;1835151..1835456;CDS;;102;@mono-O2;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco16;comp;1990954..1991619;cds;195;222;@UPF0149 YecA;;ecoN16;comp;2115794..2116459;CDS;195;222;@UPF0149 YecA;;;;;;;;
;comp;1991815..1991901;tta;12;;;;;comp;2116655..2116741;tta;12;;;;;;;;;;
;comp;1991914..1991987;tgc;54;;;;;comp;2116754..2116827;tgc;53;;;;;;;;;;
;comp;1992042..1992117;ggc;151;;;;;comp;2116881..2116956;ggc;151;;;;;;;;;;
;comp;1992269..1992817;cds;;183;@glycerolP;;;comp;2117108..2117656;CDS;;183;@CDP-diacyl;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco17;;2042368..2042898;cds;569;177;§pu-cytochrom;;ecoN17;comp;2191451..2192287;CDS;278;279;§hp-279;;;;;;;;
;comp;2043468..2043557;tcg;93;;;;;comp;2192566..2192655;tcg;93;;;;;;;;;;
;;2043651..2044448;cds;100;266;%Mtf;;;;2192749..2193546;CDS;100;266;%MtfA;;;;;;;;
;;2044549..2044624;aac;313;;;;;;2193647..2193722;aac;161;;;;;;;;;;
;;2044938..2052014;cds;;2359;§Inv-adhesin;;;;2193884..2195146;CDS;;421;§Tyr recb-421;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco18;;2056858..2057574;cds;452;239;@pu-tr-YeeN;;ecoN18;;2232607..2233323;CDS;453;239;@tr-YebC;;;;;;;;
;comp;2058027..2058102;aac;[100;;;;;comp;2233777..2233852;acc;[326;;;;;;;;;;
;comp;2058203..2059846;cds;[4;548;@exporter;;;;2234179..2235096;CDS;[101;306;@tr-nitrogen;;;;;;;;
;; 2059851..2059926;aac;[37;;;;;;2235198..2236148;CDS;[37;317;@tr-Cbl;;;;;;;;
;comp;2059964..2060914;cds;[101;317;tact Cbl;;;comp;2236186..2236261;aac;[4;;;;;;;;;;
;comp;2061016..2061933;cds;[326;306;tr-Nac;;;;2236266..2237909;CDS;[100;548;trp-YeeO;;;;;;;;
;;2062260..2062335;aac;55;;;;;;2238010..2238085;aac;161;;;;;;;;;;
;comp;2062391..2063323;cds;;311;§ErfK;;;;2238247..2239518;CDS;;424;§Tyr recb 424;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco19;;2284376..2286136;cds;74;587;@pu-cardiolip;;ecoN19;;2546968..2548728;CDS;74;587;@cardiolipine;;;;;;;;
;;2286211..2286287;ccc;102;;;;;;2548803..2548879;ccc;101;;;;;;;;;;
;comp;2286390..2288914;cds;;842;§adhes YejO;;;comp;2548981..2549136;CDS;;52;§barrel;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco20;;2465301..2466233;cds;75;311;%YfdC;;ecoN20;;2717780..2718712;CDS;75;311;%nitrite;;;;;;;;
;;2466309..2466383;agg;161;;;;;;2718788..2718862;agg;437;;;;;;;;;;
;;2466545..2467702;cds;;386;§KpLE1;;;comp;2719300..2719830;CDS;;177;§OmpH;;;ecoN;;;;;
;;2466369..2476583;#phage;;3405;pp CPS-53;;;;;;;;;;EcoN 53;comp;5321144..5321869;CDS;206;242;§p-His kinase
;;;;;;;;ecoN21;comp;2768744..2770933;CDS;206;730;@sensor;;ok;comp;5322076..5322151;°gcc;39;;
eco21;comp;2515643..2517832;cds;208;730;@pu-sensor;;;comp;2771140..2771215;°gcc;39;;;;;comp;5322191..5322266;°gcc;39;;
;comp;2518041..2518116;°gcc;39;;;;;comp;2771255..2771330;°gcc;220;;;;;comp;5322306..5322381;°gcc;220;;
;comp;2518156..2518231;°gcc;235;;;;;;2771551..2771910;CDS;;120;%pu-tr 120;;;;5322602..5322961;CDS;;120;%pu-tr 120
;;2518467..2518811;cds;;115;%pu- YfeC;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco22;comp;2519257..2520672;cds;258;472;@Glu ligase;;ecoN22;comp;2772355..2773770;CDS;258;472;@Glu ligase;;;ecoN;;;;;
;;2520931..2521006;°gta;44;;;;;;2774029..2774104;°gta;43;;;;EcoN 54;comp;5323406..5324821;CDS;258;472;@Glu ligase
;;2521051..2521126;°gta;46;;;;;;2774148..2774223;°gta;46;;;;ok;;5325080..5325155;°gta;44;;
;;2521173..2521248;°gta;4;;;;;;2774270..2774345;°gta;4;;;;;;5325200..5325275;°gta;0;;
;;2521253..2521328;aaa;210;;;;;;2774350..2774425;aaa;110;;;;;<;5325276..5325389;CDS;;38;§p-pu-tr 38
;;2521539..2521567;rpr;25;&29;rpt-29;;;comp;2774536..2775420;CDS;;295;@LysR;;;;;;;;
;comp;2521593..2522477;cds;;295; @XapR;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco23;comp;2724448..2725746;cds;322;433;@glutarate sm;;ecoN23;comp;2959205..2960503;CDS;323;433;@glutarate pm;;;;;;;;
;comp;2726069..2726188;$5s;92;&120;;;;comp;2960827..2960942;$5s;83;&116;;;;;;;;;
;comp;2726281..2729184;$23s;184;&2904;;;;comp;2961026..2965477;$23s;184;&4452;;;;;;;;;
;comp;2729369..2729444;gaa;171;;;;;comp;2965662..2965737;gaa;431;;;;;;;;;;
;comp;2729616..2731157;$16s;442;&1542;;;;comp;2966169..2967720;$16s;441;&1552;;;;;;;;;
;comp;2731600..2734173;cds;;858;@ClpB;;;comp;2968162..2970735;CDS;;858;@ClpB dep;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco24;comp;2784529..2785011;cds;750;161;DUF5507;;ecoN24;;;;;;;;;;;;;;
;comp;2785762..2785837;atgi;559;;;;;;;****atgi*****;;;;;;;;;;;
;;2786397..2788649;cds;;751;pu-unYgaQ;;ecoN25;;;;;;;;;;;;;;
;;;;;;;;;comp;3027207..3027773;CDS;280;189;@fructose 6;;;;;;;;
eco25;comp;2816937..2817503;cds;280;189;@fructose;;;comp;3028054..3028130;°cgt;63;;;;;;;;;;
;comp;2817784..2817860;°cgt;198;;;;;comp;3028194..3028270;°cgt;62;;;;;;;;;;
;comp;2818059..2818135;°cgt;62;;;;;comp;3028333..3028409;°cgt;62;;;;;;;;;;
;comp;2818198..2818274;°cgt;198;;;;;comp;3028472..3028548;°cgt;64;;;;;;;;;;
;comp;2818473..2818549;°cgt;3;;;;;comp;3028613..3028689;°cgt;3;;;;;;;;;;
;comp;2818553..2818645;agc;315;;;;;comp;3028693..3028785;agc;315;;;;;;;;;;
;comp;2818961..2819146;cds;;62;@Csr;;;comp;3029101..3029286;CDS;;62;@CsrA;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco26;comp;2946081..2947178;cds;208;366;@murein lytic;;ecoN26;comp;3157337..3158434;CDS;208;366;@murein;;;;;;;;
;;2947387..2947463;°atgf;33;;;;;;3158643..3158719;°atgf;33;;;;;;;;;;
;;2947497..2947573;°atgf;33;;;;;;3158753..3158829;°atgf;33;;;;;;;;;;
;;2947607..2947683;°atgf;73;;;;;;3158863..3158939;°atgf;635;;;;;;;;;;
;comp;2947757..2949010;cds;;418;§Ala C;;;;3159575..3160075;CDS;;167;§sscs VI;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco27;comp;2998034..2998828;cds;155;265;§YgeQ;;ecoN27;;3230172..3231401;CDS;316;410;§HAAAP;;;;;;;;
;comp;2998984..2999057;ggg;78;;;;;comp;3231718..3231791;ggg;78;;;;;;;;;;
;comp;2999136..2999891;cds;;252;%pu-LysM;;;comp;3231870..3232625;CDS;;252;%glycan DD;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco28;;3109553..3110260;cds;105;236;@DUF554 ;;ecoN28;;3341048..3341755;CDS;105;236;@DUF554 ;;;;;;;;
;;3110366..3110441;ttc;148;;;;;;3341861..3341936;ttc;197;;;;;;;;;;
;comp;3110590..3111126;cds;;179;§pu-ssM;;;;3342134..3343399;CDS;;422;§arm-type;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco29;comp;3214967..3215473;cds;124;169;%G/U station;;ecoN29;comp;3569308..3569814;CDS;124;169;%G/U;;;;;;;;
;;3215598..3215673;atgi;53;;;;;;3569939..3570014;atgi;53;;;;;;;;;;
;comp;3215727..3216491;cds;;255;@ferric ;;;comp;3570068..3570832;CDS;;255;@ferric ;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco30;;;;;;;;ecoN30;comp;3670227..3670679;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3670886..3670962;atgf;347;;;;;;;;;;
;;;;;;;;;>;3671310..3672155;CDS;;282;§p-Arg-sc 282;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco31;;;;;;;;ecoN31;comp;3673935..3674387;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3674594..3674670;atgf;347;;;;;;;;;;
;;;;;;;;;>;3675018..3675869;CDS;;284;§p-Arg-sc 284;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco32;;;;;;;;ecoN32;comp;3677794..3678246;CDS;206;151;@RimP;;;;;;;;
;;;;;;;;;comp;3678453..3678529;atgf;347;;;;;;;;;;
;;;;;;;;;>;3678877..3679722;CDS;;282;§p-Arg-sc 282;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco33;comp;3317554..3318006;cds;206;151;@RimP;;ecoN33;comp;3681532..3681984;CDS;206;151;@RimP;;;;;;;;
;comp;3318213..3318289;atgf;347;;;;;comp;3682191..3682267;atgf;347;;;;;;;;;;
;;3318637..3319980;cds;;448;@Arg-suc;;;;3682615..3683958;CDS;;448;@Arg-suc;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco34;comp;3319988..3321613;cds;458;542;%pu-hydrolase;;ecoN34;comp;3683966..3685591;CDS;456;542;%Pet;;;;;;;;
;comp;3322072..3322158;ctc;14;;;;;comp;3686048..3686134;ctc;14;;;;;;;;;;
;comp;322173..3322505;cds;;111;@SecG-t;;;comp;3686149..3686481;CDS;;111;@SecG-p;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco35;;3422436..3423194;cds;228;253;@pu-YhdZ;;ecoN35;;3784553..3785311;CDS;62;253;@pu-ABC;;;;;;;;
;comp;3423423..3423542;$5s;37;&120;;;;comp;3785374..3785489;$5s;39;&116;;;;;;;;;
;comp;3423580..3423655;acc;12;;;;;comp;3785529..3785605;acc;14;;;;;;;;;;
;comp;3423668..3423787;$5s;92;&120;;;;comp;3785620..3785735;$5s;777;&116;;;;;;;;;
;comp;3423880..3426783;$23s;174;&2904;;;;comp;3786513..3786588;acc;14;;;;;;;;;;
;comp;3426958..3427033;gca;42;;;;;comp;3786603..3786718;$5s;1834;&116;;;;;;;;;
;comp;3427076..3427152;atc;68;;;;;comp;3788553..3788628;gaa;1360;;;;;;;;;;
;comp;3427221..3428762;$16s;473;&1542;;;;;3789989..3790543;CDS;;185;%gc anhydrase;;;;;;;;
;;3429236..3429790;cds;;185;%protein YrdA;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco36;comp;3706098..3707705;cds;567;536;@dip ABC;;;;;;;;;;;;;;;;
;comp;3708273..3708306;rpr;16;&34;rpt-34;;;;;;;;;;;;;;;;
;;3708323..3708358;rpr;257;&36;rpt-36;;ecoN36;comp;4078635..4080242;CDS;743;536;@DppA;;;;;;;;
;comp;3708616..3708692;ccg;91;;;;;comp;4080986..4081062;ccg;91;;;;;;;;;;
;comp;3708784..3710475;cds;;564;@kdo2;;;comp;4081154..4082845;CDS;;564;@kdo2;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco37;comp;3834547..3835929;cds;292;461;%pu-YicJ;;;;;;;;;;;;;;;;
;;3836222..3836316;tga;108;;;;ecoN37;comp;4205966..4207348;CDS;[292;461;%glycoside-p5;;EcoN 51;comp;5252659..5253870;CDS;[300;404;(Tyr recb 404
;;3836425..3836556;pseudo;396;&132;p-yicT;;;;4207641..4207735;tga;[300;;;;ok;comp;5254171..5254249;tga;[292;;
;;3836953..3838137;cds;;395;§pu-arabi;;;>;4208036..4208857;CDS;;274;§p-DUF4102;;;>;5254542..5255171;CDS;;210;p-glycoside
;;;;;;;;;;;;;;;;;;;;;;
eco38;comp;3940635..3941327;cds;480;231;%pu-tr YieP;;ecoN38;comp;4338643..4339335;CDS;479;231;%FadR tr ;;;;;;;;
;;3941808..3943349;$16s;85;&1542;;;;;4339815..4341342;$16s;73;&1528;;;;;;;;;
;;3943435..3943510;gaa;193;;;;;;4341416..4341491;gaa;184;;;;;;;;;;
;;3943704..3946607;$23s;92;&2904;;;;;4341676..4344286;$23s;83;&2611;;;;;;;;;
;;3946700..3946819;$5s;52;&120;;;;;4344370..4344485;$5s;53;&116;;;;;;;;;
;;3946872..3946948;gac;8;;;;;;4344539..4344615;gac;8;;;;;;;;;;
;;3946957..3947032;tgg;95;;;;;;4344624..4344699;tgg;95;;;;;;;;;;
;comp;3947128..3947967;cds;;280;@HdfR;;;comp;4344795..4345634;CDS;;280;@HdfR HTH;;;;;;;;
;;;;;;;;;;;;;;;;EcoN 52;> comp;5305902..5306228;CDS;0;109;p-hp
eco39;;3980887..3982272;cds;102;462;%pu-YifK;;ecoN39;;4377681..4379066;CDS;102;462;%aa permease;;;comp;5306229..5306302;atc;1096;;
;;3982375..3982451;cgg;57;;;;;;4379169..4379245;cgg;58;;;;ecoN ?;;5307399..5308450;CDS;;351;(p-Ada
;;3982509..3982585;cac;20;;;;;;4379304..4379379;cac;20;;;;;;;;;;
;;3982606..3982692;ctg;42;;;;;;4379400..4379486;ctg;42;;;;EcoN 57;> comp;5359583..5360512;CDS;120;310;(Tyr recb 310
;;3982735..3982811;cca;146;;;;;;4379529..4379605;cca;146;;;;;comp;5360633..5360708;gca;[42;;
;;3982958..3984193;cds;;412;%pu-AslB;;;;4379752..4380987;CDS;;412;%ans maturase;;ecoN40;comp;5360751..5360827;atc;[56;;
;;;;;;;;;;;;;;;;;comp;5360884..5362138;°16s’;1;&1255;
eco40;;4034608..4035153;cds;377;182;@porphyrine O;;ecoN40;;4460971..4461516;CDS;377;182;@porphyrine M;;;< comp;5362140..5363543;CDS;;468;(IS66
;;4035531..4037072;$16s;68;&1542;;;;;4461894..4463631;$16s;[56;&1738;;;;;;;;;
;;4037141..4037217;atc;42;;;;;;4463688..4463764;atc;[42;;;;EcoN 55;>;5375524..5376270;CDS;891;249;(p-AI-2E
;;4037260..4037335;gca;183;;;;;;4463807..4463882;gca;165;;;;;;5377162..5377237;gaa;1047;;eco 435
;;4037519..4040423;$23s;93;&2905;;;;;4464048..4467338;$23s;83;&3291;;;ecoN ?;comp;5378285..5379589;CDS;;435;isocitrate
;;4040517..4040636;$5s;228;&120;;;;;4467422..4467537;$5s;104;&116;;;;;;;;;
;;4040865..4040900;rpr;5;&36;rpt-36;;;comp;4467642..4468169;CDS;;176;@Mlb pB;;EcoN 49;comp;5090325..5090876;CDS;1808;184;(MarR
;comp;4040906..4041433;cds;;176;@Mlb adapt;;;;;;;;;;;comp;5092685..5092760;gaa;588;;
;;;;;;;;;;;;;;;;ecoN ?;< comp ;5093349..5093474;CDS;592;42;(sn-glycerol
eco41;;4165428..4166285;cds;373;286;@Glu race;;ecoN41;;4605577..4606434;CDS;374;286;@Glu race;;;;5094067..5094142;°gaa;1472;;
;;4166659..4168200;$16s;171;&1542;;;;;4606809..4608362;$16s;363;&1554;;;;;5095615..5095691;atc;42;;
;;4168372..4168447;gaa;193;;;;;;4608726..4608801;gaa;1112;;;;;;5095734..5095809;atc;1130;;
;;4168641..4171544;$23s;92;&2904;;;;;4609914..4610029;$5s;136;&116;;;;;5096940..5097015;°gaa;1145;;
;;4171637..4171756;$5s;300;&120;;;;;4610166..4611194;CDS;;343;@UDP-N;;ok ecoN43;;5098161..5098236;°gaa;]185;;
;;4172057..4173085;cds;;343;@UDP-N;;;;;;;;;;;;5098422..5100893;$23s;]83;&2472;
;;;;;;;;ecoN42;comp;4612185..4613135;CDS;361;317;@B5 kinase I;;;;5100977..5101092;$5s;]76;&116;
eco42;comp;4174076..4175026;cds;361;317;@B5 kinase;;;;4613497..4613572;aca;8;;;;;;5101169..5101552;CDS;63;128;hp-128
;;4175388..4175463;aca;8;;;;;;4613581..4613665;tac;116;;;;;comp;5101616..5102059;CDS;;148;transferase
;;4175472..4175556;tac;116;;;;;;4613782..4613856;gga;6;;;;;;;;;;
;;4175673..4175747;gga;6;;;;;;4613863..4613938;acc;114;;;;EcoN 50;;5124754..5125197;CDS;63;148;transferase
;;4175754..4175829;acc;114;;;;;;4614053..4615237;CDS;;395;@tuf;;;comp;5125261..5125644;CDS;76;128;hp-128
;;4175944..4177128;cds;229;395;@tufb;;;;;;;;;;ecoN40;comp;5125721..5125836;$5s;83;&116;
;;4177358..4177741;cds;;128;SecE;;ecoN43;comp;4642984..4644573;CDS;616;530;@AICAR2;;;comp;5125920..5128366;°23s’;-10;&2447;
;;;;;;;;;;4645190..4646378;°16s’;83;&1189;;;;<;5128357..5128479;CDS;;41;(pilus
eco43;comp;4205943..4207532;cds;614;530;@AICAR1;;;;4646462..4648150;CDS;436;563;§kinase isocit;;;;;;;;
;;4208147..4209688;$16s;85;&1542;;;;;4648587..4648662;gaa;]185;;;;;;;;;;
;;4209774..4209849;gaa;193;;;;;;4648848..4651319;$23s;]83;&2472;;;;;;;;;
;;4210043..4212946;$23s;93;&2904;;;;;4651403..4651518;$5s;]76;&116;;;;;;;;;
;;4213040..4213159;$5s;74;&120;;;;;4651595..4651978;CDS;;128;%hp-128;;;;;;;;
;;4213234..4213617;cds;;128;%stress;;;;;;;;;;;;;;;;
;;;;;;;;ecoN44;;;;;;;;;;;;;;
eco44;comp;4360396..4361934;cds;256;513;§CadC;;;< comp;4834504..4834961;CDS;197;153;§pu-integrase;;;;;;;;
;comp;4362191..4362353;pseudo;197;&163;yjdQ;;;comp;4835159..4835234;ttc;106;;;;;;;;;;
;comp;4362551..4362626;ttc;106;;;;;comp;4835341..4835916;CDS;;192;@tr 192;;;;;;;;
;comp;4362733..4363308;cds;;192;@pu-tr YjdC;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco45;;4391604..4392149;cds;210;182;@oligo-rnase;;ecoN45;;4864628..4865173;CDS;210;182;@oligo-rnase;;;;;;;;
;;4392360..4392435;°ggc;36;;;;;;4865384..4865459;°ggc;36;;;;;;;;;;
;;4392472..4392547;°ggc;35;;;;;;4865496..4865571;°ggc;35;;;;;;;;;;
;;4392583..4392658;°ggc;233;;;;;;4865607..4865682;°ggc;233;;;;;;;;;;
;;4392892..4392945;cds;;18;@un-YjeV;;;;4865916..4865969;CDS;;18;@hp-18;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco46;comp;4495190..4496209;cds;195;340;@NADPH- Ah;;ecoN46;comp;4974178..4975197;CDS;195;340;@NADPH- Ahr;;;;;;;;
;;4496405..4496489;ttg;260;;;;;;4975393..4975477;ttg;39;;;;;;;;;;
;;4496750..4497940;cds;;397;§pu-KpLE2;;;<> comp;4975517..4976055;CDS;;180;§p-IS630 ;;;;;;;;
;;4496675..4497940;#phage;;422;pp PR-Y;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;
eco47;;4605804..4606040;cds;38;79;%protein YjjZ;;;;;;;;;;;;;;;;
;comp;4606079..4606165;°ctg;34;;;;;;;;;;;;;;;;;;
;comp;4606200..4606286;°ctg;28;;;;ecoN47;;5042527..5042763;CDS;38;79;%DUF1435;;EcoN 58;;5425965..5426201;CDS;38;79;%DUF1435
;comp;4606315..4606401;°ctg;157;;;;;comp;5042802..5042888;°ctg;34;;;;ok;comp;5426240..5426325;°ctg;26;;
;;4606559..4606594;rpr;22;&36;rpt 36;;;comp;5042923..5043009;°ctg;28;;;;;comp;5426352..5426438;°ctg;28;;
;comp;4606617..4606650;rpr;18;&34;rpt 34;;;comp;5043038..5043124;°ctg;290;;;;;comp;5426467..5426553;°ctg;63;;
;comp;4606669..4607700;cds;;344;@G1207;;;comp;5043415..5044446;CDS;;344;@G1207 RsmC;;;< comp;5426617..5427150;CDS;;178;p-IS630
ecoN eco noms cds[modifier | modifier le wikicode]
fonction;Noms courts;Noms longs;;;;;
tr-regulator; XapR;DNA-binding transcriptional activator XapR;;;;;*
permease;aa permease;amino acid permease;;;;;*
ABC bind;ABC 32;ABC transporter ATP-binding protein;;;;;*
ABC bind;ABC MetN;methionine ABC transporter ATP-binding protein MetN;;;;;*
desaturase;acyl-CoA ;acyl-CoA desaturase;;;;;*
adhesin;adhes YdhQ;adhesin-like autotransporter YdhQ;;;;;*
adhesin;adhes YejO;adhesin-like autotransporter YejO, gene fragment 2 of yejO,  misc_feature ;;;;;*
hydrolase ;AICAR1;bifunctional AICAR transformylase/IMP cyclohydrolase;;;;;*
hydrolase ;AICAR2;bifunctional  phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase ;;;;;*
amidase;Ala C;N-acetylmuramoyl-L-alanine amidase C;;;;;*
maturase;ans maturase;anaerobic sulfatase maturase;;;;;*
synthetase;Arg-suc;argininosuccinate synthetase;;;;;*
integrase;arm-type;integrase arm-type DNA-binding domain-containing protein;;;;;*
synthetase;Asn B;asparagine synthetase B;;;;;*
protease b;ATP ClpA;ATP-dependent Clp protease ATP-binding subunit ClpA;;;;;*
kinase;B5 kinase;pantothenate kinase;;;;;*
kinase;B5 kinase I;type I pantothenate kinase;;;;;*
transporter;barrel;autotransporter outer membrane beta-barrel domain-containing protein;;;;;*
tr-regulator;CadC;DNA-binding transcriptional activator CadC;;;;;*
cardiolipin ;cardiolipine;cardiolipin transport protein PbgA;;;;;*
transferase;CDP-diacyl;CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase;;;;;*
division;cell CpoB;cell division coordinator CpoB;;;;;*
chaperone;ClpB;ClpB chaperone;;;;;*
chaperone;ClpB dep;ATP-dependent chaperone ClpB;;;;;*
storage;Csr;carbon storage regulator;;;;;*
storage;CsrA;carbon storage regulator CsrA;;;;;*
hydrolase ;cyclo FolD;bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD;;;;;*
phosphatase;D-glycero;D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase;;;;;*
ABC bind;dip ABC;dipeptide ABC transporter periplasmic binding protein;;;;;*
polymerase;DNAIIIe;DNA polymerase III subunit epsilon;;;;;*
ABC bind;DppA;dipeptide ABC transporter substrate-binding protein DppA;;;;;*
DUF;DUF1435;DUF1435 domain-containing protein;;;;;*
DUF;DUF4102;DUF4102 domain-containing protein;;;;;*
DUF;DUF4942;DUF4942 domain-containing protein;;;;;*
DUF;DUF5507;DUF5507 domain-containing protein YpjC;;;;;*
DUF;DUF554 ;DUF554 domain-containing protein;;;;;*
DUF;DUF554 Yqg;DUF554 domain-containing protein YqgA;;;;;*
peptidase;ErfK;L,D-transpeptidase ErfK;;;;;*
exporter;exporter;FMN/FAD exporter;;;;;*
tr-regulator;FadR tr ;FadR family transcriptional regulator;;;;;*
reductase;ferric ;NADPH-dependent ferric chelate reductase;;;;;*
phosphatase;fructose;fructose-1-phosphatase;;;;;*
phosphatase;fructose 6;fructose-1-phosphate/6-phosphogluconate phosphatase;;;;;*
deformylase;fTHF;formyltetrahydrofolate deformylase;;;;;*
protase;FtsH;modulator of FtsH protease;;;;;*
protease;FtsH YccA;FtsH protease modulator YccA;;;;;*
glycosylase;G/U;G/U mismatch-specific DNA glycosylase;;;;;*
glycosylase;G/U station;stationary phase mismatch/uracil DNA glycosylase;;;;;*
transferase;G1207;16S rRNA m(2)G1207 methyltransferase;;;;;*
transferase;G1207 RsmC;16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC;;;;;*
anhydrase;gc anhydrase;gamma carbonic anhydrase family protein;;;;;*
ligase;Glu ligase;glutamate--tRNA ligase;;;;;*
racemase;Glu race;glutamate racemase;;;;;*
dehydrogenase;glu5dH;glutamate-5-semialdehyde dehydrogenase;;;;;*
reductase;gluDkgB;2,5-didehydrogluconate reductase DkgB;;;;;*
permease;glutarate pm;alpha-ketoglutarate permease;;;;;*
symporter;glutarate sm;alpha-ketoglutarate:H(+) symporter;;;;;*
peptidase;glycan DD;peptidoglycan DD-metalloendopeptidase family protein;;;;;*
synthetase;glycerolP;phosphatidylglycerophosphate synthase;;;;;*
transporter;glycoside-p5;glycoside-pentoside-hexuronide family transporter;;;;;*
reductase;glyoxyl A;glyoxylate/hydroxypyruvate reductase A;;;;;*
reductase;glyoxyl GhrA;glyoxylate/hydroxypyruvate reductase GhrA;;;;;*
permease;HAAAP;HAAAP family serine/threonine permease;;;;;*
tr-regulator;HdfR;DNA-binding transcriptional dual regulator HdfR;;;;;*
tr-regulator;HdfR HTH;HTH-type transcriptional regulator HdfR;;;;;*
hydrogenase;Hnase1;hydrogenase 1 small subunit;;;;;*
hp;hp-121;hp-121;;;;;
hp;hp-128;hypothetical protein;;;;;*
hp;hp-18;hp-18;;;;;*
adhesin;Inv-adhesin;inverse autotransporter adhesin;;;;;*
transposase;IS66;IS66 family transposase;;;;;*
lyase;isocitrate;isocitrate lyase;;;;;*
transferase;kdo2;kdo(2)-lipid A phosphoethanolamine 7''-transferase;;;;;*
kinase/Pase;kinase isocit;bifunctional isocitrate dehydrogenase kinase/phosphatase;;;;;*
prophage;KpLE1;CPS-53 (KpLE1) prophage, prophage CPS-53 integrase;;;;;*
lipoprotein;lipo YafT;lipoprotein YafT;;;;;*
tr-regulator;LysR;LysR family transcriptional regulator;;;;;*
tr-regulator;MarR;MarR family transcriptional regulator;;;;;*
reductase;metDkgB;methylglyoxal reductase DkgB;;;;;*
GDP;Mlb adapt;molybdopterin-guanine dinucleotide biosynthesis adaptor protein;;;;;*
GDP;Mlb pB;molybdopterin-guanine dinucleotide biosynthesis protein B;;;;;*
oxygenase;mono-O2;monooxygenase;;;;;*
titration;Mtf;Mlc titration factor;;;;;*
tr-regulator;MtfA;DgsA anti-repressor MtfA;;;;;*
glycosylase;murein;murein transglycosylase A;;;;;*
glycosylase;murein lytic;membrane-bound lytic murein transglycosylase A;;;;;*
reductase;NADPH- Ah;aldehyde reductase, NADPH-dependent;;;;;*
reductase;NADPH- Ahr;NADPH-dependent aldehyde reductase Ahr;;;;;*
transporter;nitrite;formate/nitrite transporter family protein;;;;;*
hydroxylase;octaprenyl;2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;;;;;*
rnase;oligo-rnase;oligoribonuclease;;;;;*
protein;OmpH;OmpH family outer membrane protein;;;;;*
transferase;p-Ada;pseudo, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada;;;;;*
transporter;p-AI-2E;pseudo, AI-2E family transporter;;;;;*
synthetase;p-Arg-sc 282;Pseudo, argininosuccinate synthase;;;;;*
synthetase;p-Arg-sc 284;Pseudo, argininosuccinate synthase;;;;;*
division;p-cell CpoB;Pseudo, cell division protein CpoB;;;;;*
DUF;p-DUF4102;Pseudo, DUF4102 domain-containing protein;;;;;*
transporter;p-glycoside;pseudo, glycoside-pentoside-hexuronide family transporter;;;;;*
kinase;p-His kinase;pseudo, histidine kinase;;;;;*
hp;p-hp;pseudo, hp 109;;;;;*
integrase;p-integrase;pseudo, integrase;;;;;*
transposase;p-IS4;Pseudo, IS4 family transposase;;;;;*
transposase;p-IS630 ;pseudo, IS630 family transposase;;;;;*
transporter;p-MATE;Pseudo, MATE family efflux transporter;;;;;*
transporter;p-MdtK;Pseudo, multidrug efflux MATE transporter MdtK;;;;;*
amidase;p-Nam;pseudo, nicotinamide-nucleotide amidase;;;;;*
tr-regulator;p-pu-tr 38;pseudo, putative DNA-binding transcriptional regulator;;;;;*
protein;p-un-YchS;putative uncharacterized protein YchS;;;;;*
gene;p-yicT;p-yicT;;;;;*
transferase;Pet;phosphoethanolamine transferase;;;;;*
protein;pilus;pilus assembly protein;;;;;*
dehydrogenase;porphyrine M;menaquinone-dependent protoporphyrinogen IX dehydrogenase;;;;;*
oxidase;porphyrine O;protoporphyrinogen oxidase;;;;;*
prophage;pp CP4-6;note="cryptic prophage CP4-6"     misc_feature;;;;;*
prophage;pp CPS-53;cryptic prophage CPS-53, misc_feature;;;;;*
prophage;pp DLP12;note="cryptic prophage DLP12"     misc_feature;;;;;*
prophage;pp PR-Y;cryptic prophage PR-Y;;;;;*
protein;protein YjjZ;protein YjjZ;;;;;*
protein;protein YrdA;protein YrdA;;;;;*
tr-regulator;pu- YfeC;putative DNA-binding transcriptional regulator YfeC;;;;;*
ABC bind;pu-ABC;amino acid ABC transporter ATP-binding protein;;;;;*
exporter;pu-arabi;putative arabinose exporter;;;;;*
sulfatase;pu-AslB;putative anaerobic sulfatase maturation enzyme AslB;;;;;*
cardiolipin ;pu-cardiolip;putative cardiolipin transport protein;;;;;*
cytochrome;pu-cytochrom;putative cytochrome;;;;;*
hydrolase;pu-hydrolase;putative hydrolase, inner membrane;;;;;*
integrase;pu-KpLE2;KpLE2 phage-like element putative integrase;;;;;*
peptidase;pu-LysM;LysM domain-containing putative peptidase lipoprotein YgeR;;;;;*
GMP;pu-sensor;putative c-di-GMP phosphodiesterase PdeA;;;;;*
protein;Pu-ssM;putative type II secretion system M-type protein;;;;;*
tr-regulator;pu-tr 120;putative DNA-binding transcriptional regulator;;;;;*
tr-regulator;pu-tr YieP;putative transcriptional regulator YieP;;;;;*
tr-regulator;pu-tr YjdC;putative DNA-binding transcriptional regulator YjdC;;;;;*
tr-regulator;pu-tr-YeeN;putative transcriptional regulator YeeN;;;;;*
protein;pu-unYgaQ;putative uncharacterized protein YgaQ;;;;;*
oxygenase;pu-YdhR;putative monooxygenase YdhR;;;;;*
ABC bind;pu-YhdZ;putative ABC transporter ATP-binding subunit YhdZ;;;;;*
transporter;pu-YicJ;putative xyloside transporter YicJ;;;;;*
transporter;pu-YifK;putative transporter YifK;;;;;*
prophage;put DLP12;DLP12 prophage putative integrase;;;;;*
tr-regulator;put FimZ;putative LuxR family transcriptional regulator FimZ;;;;;*
synthetase;quino;quinolinate synthase;;;;;*
synthetase;quino NadA;quinolinate synthase NadA;;;;;*
ribosome;RimP;ribosome maturation factor RimP;;;;;*
rpt;rpt-29;rpt-29;;;;;
rpt;rpt-34;rpt_type=other;;;;;*
rpt;rpt-36;rpt_type=other;;;;;*
rpt;rpt71;rpt_type=other  71;;;;;*
sRNA;RttR sRNA;small RNA RttR;;;;;*
translocase;SecE;Sec translocon subunit SecE;;;;;*
translocase;SecG-p;preprotein translocase subunit SecG;;;;;*
translocase;SecG-t;Sec translocon subunit SecG;;;;;*
esterase;sensor;sensor domain-containing phosphodiesterase;;;;;*
ABC bind;sn-glycerol;sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB;;;;;*
protein;sscs VI;type VI secretion system contractile sheath small subunit;;;;;*
protein;stress;stress response protein;;;;;*
tr-regulator;tact Cbl;DNA-binding transcriptional activator Cbl;;;;;*
translation;tif IF-1;translation initiation factor IF-1;;;;;*
protein;tpr;protamine-like protein;;;;;*
tr-regulator;tr 192;transcriptional regulator;;;;;*
tr-regulator;tr AlpA;AlpA family transcriptional regulator;;;;;*
tr-regulator;tr-Cbl;HTH-type transcriptional regulator Cbl;;;;;*
tr-regulator;tr-Nac;DNA-binding transcriptional dual regulator Nac;;;;;*
tr-regulator;tr-nitrogen;nitrogen assimilation transcriptional regulator;;;;;*
tr-regulator;tr-YebC;YebC/PmpR family DNA-binding transcriptional regulator;;;;;*
transferase;transferase;acetyltransferase;;;;;*
transporter;trp-YeeO;toxic metabolite efflux MATE transporter YeeO;;;;;*
translation;tuf;elongation factor Tu;;;;;*
translation;tufb;tufb, translation elongation factor Tu 2;;;;;*
integrase;Tyr recb 207;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 404;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 421;tyrosine-type recombinase/integrase;;;;;*
integrase;Tyr recb 424;tyrosine-type recombinase/integrase;;;;;*
reductase;UDP-N;UDP-N-acetylenolpyruvoylglucosamine reductase;;;;;*
protein;un-YcdU;uncharacterized protein YcdU;;;;;*
protein;un-YjeV;uncharacterized protein YjeV;;;;;*
protein;UPF0149 YecA;UPF0149 family protein YecA;;;;;*
protein;YdiA;YdiA family protein;;;;;*
protein;YfdC;inner membrane protein YfdC;;;;;*
protein;YgeQ;protein YgeQ;;;;;*
gene;yjdQ;gene="yjdQ";;;;;*
DUF;DUF1435;DUF1435 domain-containing protein;;;;;*
transposase;p-IS630;pseudo, IS630-like element IS630 family transposase;;;;;*

Vibrio campbellii[modifier | modifier le wikicode]

vha opérons[modifier | modifier le wikicode]

45.4%GC;26.7.19 Paris;16s 10;121;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd
Vibrio campbellii ATCC BAA-1116;;;;;;;;;;
comp;1..1384;;16s;@1;103;103;;;;
comp;1488..1604;;CDS;;102507;;;;39;
;;;;;;;;;;
;104112..105239;;CDS;;529;*529;;;*376;*529
comp;105769..105845;;atg;+;158;;*158;;;
comp;106004..106079;;ggc;7 ggc;35;;35;;;
comp;106115..106190;;ggc;5 atg;35;;35;;;
comp;106226..106301;;ggc;;18;;18;;;
comp;106320..106396;;atg;;39;;39;;;
comp;106436..106511;;ggc;;90;;90;;;
comp;106602..106678;;atg;;39;;39;;;
comp;106718..106793;;ggc;;18;;18;;;
comp;106812..106888;;atg;;39;;39;;;
comp;106928..107003;;ggc;;18;;18;;;
comp;107022..107098;;atg;;39;;39;;;
comp;107138..107213;;ggc;;156;156;;;;156
comp;107370..107915;;CDS;;81764;;;;182;
;;;;;;;;;;
;189680..190715;;CDS;;101;101;;;345;101
comp;190817..190933;;5s;;107;;;;;
comp;191041..193955;;23s;;290;;;;;
comp;194246..194321;;gca;;43;;;43;;
comp;194365..194441;;atc;;97;;;;;
comp;194539..196096;;16s;@2;371;;;;;
comp;196468..196584;;5s;;77;;;;;
comp;196662..199576;;23s;;290;;;;;
comp;199867..199942;;gca;;43;;;43;;
comp;199986..200062;;atc;;97;;;;;
comp;200160..201717;;16s;;853;*853;;;;*853
comp;202571..204706;;CDS;;29595;;;;*712;
;;;;;;;;;;
comp;234302..235486;;CDS;;101;101;;;395;101
comp;235588..235663;;acc;;13;;13;;;
comp;235677..235751;;gga;;35;;35;;;
comp;235787..235871;;tac;;52;;52;;;
comp;235924..235999;;aca;;206;206;;;;
;236206..237129;;CDS;;4144;;;;308;
;;;;;;;;;;
comp;241274..242467;;CDS;;546;*546;;;*398;*546
comp;243014..243090;;tgg;;68;;;68;;
comp;243159..243235;;gac;;32;;;;;
comp;243268..243384;;5s;;117;;;;;
comp;243502..246404;;23s;;310;;;;;
comp;246715..246790;;gta;;30;;;30;;
comp;246821..246896;;aaa;;2;;;2;;
comp;246899..246974;;gaa;;122;;;;;
comp;247097..248654;;16s;;554;*554;;;;*554
;249209..249664;;CDS;;60596;;;;*152;
;;;;;;;;;;
;310261..311296;;CDS;;121;121;;;345;121
comp;311418..311508;;tca;;91;;;;;
comp;311600..311716;;5s;;108;;;;;
comp;311825..314739;;23s;;289;;;;;
comp;315029..315104;;gca;;43;;;43;;
comp;315148..315224;;atc;;56;;;;;
comp;315281..316842;;16s;;471;*471;;;;*471
comp;317314..318027;;CDS;;40242;;;;*238;
;;;;;;;;;;
;358270..359305;;CDS;;147;147;;;345;
comp;359453..359529;;gac;;31;;;;;
comp;359561..359677;;5s;;108;;;;;
comp;359786..362700;;23s;;310;;;;;
comp;363011..363086;;gta;;30;;;30;;
comp;363117..363192;;aaa;;2;;;2;;
comp;363195..363270;;gaa;;82;;;;;
comp;363353..364914;;16s;;83;83;;;;83
comp;364998..365133;;CDS;;84252;;;;45;
;;;;;;;;;;
;449386..449521;;CDS;;83;83;;;45;83
;449605..451162;;16s;;122;;;;;
;451285..451360;;gaa;;2;;;2;;
;451363..451438;;aaa;;9;;;9;;
;451448..451523;;gca;;37;;;37;;
;451561..451636;;gta;;51;51;;;;51
comp;451688..451873;;CDS;;16;16;;;62;16
;451890..454804;;23s;;77;;;;;
;454882..454998;;5s;;32;;;;;
;455031..455107;;gac;;162;162;;;;
comp;455270..455533;;CDS;;11718;;;;88;
;;;;;;;;;;
comp;467252..467665;;CDS;;361;361;;;138;
;468027..468103;;cgg;;35;;35;;;
;468139..468214;;cac;;76;;76;;;
;468291..468367;;cca;;46;;46;;;
;468414..468489;;cac;;64;;64;;;
;468554..468630;;cca;;194;194;;;;194
comp;468825..469550;;CDS;;365688;;;;242;
;;;;;;;;;;
comp;835239..835550;;CDS;;138;138;;;104;138
comp;835689..835764;;atg;;145;145;;;;
comp;835910..837772;;CDS;;182191;;;;621;
;;;;;;;;;;
;1019964..1020128;;CDS;;119;119;;;55;
;1020248..1021805;;16s;;129;;;;;
;1021935..1022010;;gcc;;41;;;41;;
;1022052..1022127;;gaa;;55;55;;;;55
comp;1022183..1022368;;CDS;;16;16;;;62;16
;1022385..1025299;;23s;;111;;;;;
;1025411..1025527;;5s;;31;;;;;
;1025559..1025635;;gac;;35;;;35;;
;1025671..1025747;;tgg;;3;3;;;;3
comp;1025751..1025933;;CDS;;225465;;;;61;
;;;;;;;;;;
;1251399..1252574;;CDS;;158;158;;;392;
comp;1252733..1252817;;cta;+;54;;54;;;
comp;1252872..1252946;;caa;5 cta;46;;46;;;
comp;1252993..1253077;;cta;3 atg;21;;21;;;
comp;1253099..1253183;;cta;2 caa;18;;18;;;
comp;1253202..1253278;;atg;;23;;23;;;
comp;1253302..1253386;;cta;;70;;70;;;
comp;1253457..1253533;;atg;;79;;79;;;
comp;1253613..1253687;;caa;;31;;31;;;
comp;1253719..1253803;;cta;;39;;39;;;
comp;1253843..1253919;;atg;;26;26;;;;26
comp;1253946..1254157;;CDS;;14564;;;;71;
;;;;;;;;;;
comp;1268722..1268862;;CDS;;260;260;;;47;
;1269123..1269199;;cca;;243;243;;;;*243
comp;1269443..1269628;;CDS;;16361;;;;62;
;;;;;;;;;;
;1285990..1286571;;CDS;;88;88;;;194;
comp;1286660..1286736;;agg;;68;68;;;;68
comp;1286805..1287938;;CDS;;116753;;;;378;
;;;;;;;;;;
comp;1404692..1405552;;CDS;;204;204;;;287;*204
;1405757..1405833;;aga;;244;244;;;;
;1406078..1407685;;CDS;;49950;;;;536;
;;;;;;;;;;
;1457636..1458508;;CDS;;407;407;;;291;
comp;1458916..1459000;;tac;+;100;;100;;;
comp;1459101..1459185;;tac;4 tac;100;;100;;;
comp;1459286..1459370;;tac;@7;100;;100;;;
comp;1459471..1459555;;tac;;282;282;;;;*282
;1459838..1460935;;CDS;;170368;;;;366;
;;;;;;;;;;
;1631304..1631753;;CDS;;144;144;;;150;144
;1631898..1631985;;tcc;;312;312;;;;
;1632298..1632684;;CDS;;550413;;;;129;
;;;;;;;;;;
;2183098..2183436;;CDS;;179;179;;;113;
;2183616..2183692;;gtc;+;46;;46;;;
;2183739..2183815;;gtc;2 gtc;149;149;;;;149
;2183965..2185344;;CDS;;578546;;;;460;
;;;;;;;;;;
comp;2763891..2766782;;CDS;;763;*763;;;*964;*763
comp;2767546..2767621;;ggc;+;11;;11;;;
comp;2767633..2767719;;tta;2 ggc;78;;78;;;
comp;2767798..2767873;;ggc;;37;;37;;;
comp;2767911..2767984;;tgc;;400;400;;;;*400
comp;2768385..2768942;;CDS;;82481;;;;186;
;;;;;;;;;;
;2851424..2851855;;CDS;;62;62;;;144;62
;2851918..2851992;;gga;;333;333;;;;
;2852326..2852970;;CDS;;133282;;;;215;
;;;;;;;;;;
comp;2986253..2986402;;CDS;;1;*1;;;50;1
;2986404..2986479;;aac;;372;372;;;;
;2986852..2989149;;CDS;;60873;;;;766;
;;;;;;;;;;
;3050023..3051831;;CDS;;139;139;;;603;139
;3051971..3052061;;tca;;321;321;;;;
;3052383..3053693;;CDS;;384243;;;;437;
;;;;;;;;;;
comp;3437937..3438392;;CDS;;233;233;;;152;
comp;3438626..3438702;;atg;;56;;56;;;
comp;3438759..3438842;;ctc;;18;18;;;;18
comp;3438861..3439199;;CDS;;113972;;;;113;
;;;;;;;;;;
comp;3553172..3554167;;CDS;;189;189;;;332;189
comp;3554357..3554433;;cgt;+;59;;59;;;
comp;3554493..3554569;;cgt;7 cgt;57;;57;;;
comp;3554627..3554703;;cgt;2 agc;57;;57;;;
comp;3554761..3554837;;cgt;;57;;57;;;
comp;3554895..3554971;;cgt;;57;;57;;;
comp;3555029..3555105;;cgt;;85;;85;;;
comp;3555191..3555282;;agc;;29;;29;;;
comp;3555312..3555388;;cgt;;31;;31;;;
comp;3555420..3555511;;agc;;243;243;;;;
comp;3555755..3555952;;CDS;;83212;;;;66;
;;;;;;;;;;
;3639165..3640295;;CDS;;108;108;;;377;108
;3640404..3640479;;ttc;+;51;;51;;;
;3640531..3640606;;aca;3 ttc;7;;7;;;
;3640614..3640689;;ttc;2 aca;43;;43;;;
;3640733..3640808;;aac;2 aac;69;;69;;;
;3640878..3640953;;aca;;10;;10;;;
;3640964..3641039;;ttc;;42;;42;;;
;3641082..3641158;;aac;;292;292;;;;
;3641451..3643076;;CDS;;233;233;;;542;
;3643310..3643385;;ttc;;51;;51;;;
;3643437..3643512;;aca;+;21;;21;;;
;3643534..3643609;;aac;2 aca;39;;39;;;
;3643649..3643724;;aca;2 aac;15;;15;;;
;3643740..3643815;;aac;;156;156;;;;156
comp;3643972..3645405;;CDS;;561;*561;;;*478;*561
comp;3645967..3646043;;gac;;31;;;;;
comp;3646075..3646191;;5s;;57;;;;;
comp;3646249..3646324;;acc;;100;;;;;
comp;3646425..3646541;;5s;;111;;;;;
comp;3646653..3649567;;23s;;-13;*-13;;;;*-13
comp;3649555..3649797;;CDS;@3;35;35;;;81;35
comp;3649833..3649908;;gca;;43;;;43;;
comp;3649952..3650028;;atc;;97;;;;;
comp;3650126..3651683;;16s;;557;*557;;;;*557
comp;3652241..3653491;;CDS;;9514;;;;*417;
;;;;;;;;;;
comp;3663006..3663598;;CDS;;181;181;;;198;
comp;3663780..3663864;;ttg;;177;177;;;;177
comp;3664042..3664707;;CDS;;93515;;;;222;
;;;;;;;;;;
;3758223..3759258;;CDS;;578;*578;;;*345;*578
comp;3759837..3759913;;gac;;68;;;;;
comp;3759982..3760098;;5s;;111;;;;;
comp;3760210..3763124;;23s;;290;;;;;
comp;3763415..3763490;;gca;;43;;;43;;
comp;3763534..3763610;;atc;;97;;;;;
comp;3763708..3765265;;16s;;86;;;;;
comp;3765351;;16s;début;;;;;;
Chromosome II;;;;;;;;;;
comp;673782..674186;;CDS;;358;358;;;135;
comp;674545..674635;;tca;;329;329;;;;*329
;674965..675645;;CDS;;205537;;;;227;
;;;;;;;;;;
;881183..882640;;CDS;;244;244;;;486;*244
;882885..882958;;tgc;;302;302;;;;
;883261..883725;;CDS;;1229;;;;155;
;;;;;;;;;;
;884955..886649;;CDS;;245;245;;;565;*245
;886895..886981;;tta;;97;;97;;;
;887079..887154;;ggc;;5;;5;;;
;887160..887233;;tgc;;317;317;;;;
;887551..889074;;CDS;;465;;;;508;
;;;;;;;;;;
comp;889540..890328;;CDS;;386;386;;;263;
;890715..890801;;tta;+;53;;53;;;
;890855..890928;;tgc;2 tgc;181;;*181;;;
;891110..891183;;tgc;;366;366;;;;*366
;891550..891891;;CDS;;443950;;;;114;
;;;;;;;;;;
;1335842..1336042;;CDS;;17;17;;;;17
;1336060..1336134;;gga;;272;272;;;;
comp;1336407..1337222;;CDS;;505333;;;;272;
;;;;;;;;;;
;1842556..1842741;;CDS;;-36;*-36;;;62;*-36
;1842706..1842789;;ctc;;29;29;;;;29
;1842819..1843430;;CDS;;77699;;;;204;
;;;;;;;;;;
;1921130..1921561;;CDS;;62;62;;;144;62
;1921624..1921698;;gga;;337;337;;;;
comp;1922036..1922209;;CDS;;15660;;;;58;
;;;;;;;;;;
comp;1937870..1939129;;CDS;;84;84;;;420;
comp;1939214..1939304;;tca;;90;;;;;
comp;1939395..1939511;;5s;;77;;;;;
comp;1939589..1942503;;23s;;306;;;;;
comp;1942810..1942885;;gta;;35;;;35;;
comp;1942921..1942996;;gca;;24;;;24;;
comp;1943021..1943096;;aaa;;2;;;2;;
comp;1943099..1943174;;gaa;;114;;;;;
comp;1943289..1944850;;16s;;83;83;;;;83
comp;1944934..1945071;;CDS;;;;;;46;

vha cumuls[modifier | modifier le wikicode]

vha cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;11;1;0;0;1;3;1;1;100;17
;16 aas 23 5s ;3;20;10;5;50;8;20;5;200;17
;16 atc gca;4;40;17;6;100;10;40;3;300;10
;16 cds 23 5s ;3;60;16;6;150;12;60;2;400;13
;max a;5;80;6;1;200;9;80;3;500;6
;a doubles;0;100;6;0;250;9;100;3;600;4
;spéciaux;1;120;0;0;300;4;120;3;700;2
;total aas;37;140;0;0;350;7;140;3;800;2
sans ;opérons;27;160;1;0;400;6;160;4;900;0
;1 aa;14;180;0;0;450;1;180;1;1000;1
;max a;12;200;1;0;500;1;200;2;1100;0
;a doubles;10;;0;0;;8;;8;;0
;total aas;84;;57;18;;78;;38;;72
total aas;;121;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;;30;;;;;;266
;;;variance;;19;;;;;;199
sans jaune;;;moyenne;46;;;183;;86;;240
;;;variance;25;;;114;;59;;178

vha blocs[modifier | modifier le wikicode]

vha blocs;;;;;;;
;;;;cds;103;;
cds;853;cds;471;16s;86;;
16s;97;16s;56;16s;97;;
atc;43;atc;43;atc;43;;
gca;290;gca;289;gca;290;;
23s;77;23s;108;23s;111;;
5s;371;5s;91;5s;68;;
16s;97;tca;;gac;;;
atc;43;;;;;;
gca;290;;;;;;
23s;107;;;;;;
5s;101;;;;;;
cds;;;;;;;
;;;;;;;
cds;554;cds;83;cds;119;cds;557
16s;122;16s;82;16s;129;16s;97
gaa;2;gaa;2;gcc;41;atc;43
aaa;30;aaa;30;gaa;55;gca;35
gta;310;gta;310;cds;16;cds;-13
23s;117;23s;108;23s;111;23s;111
5s;32;5s;31;5s;31;5s;100
gac;;gac;;gac;;acc;57
;;;;;;5s;31
;;;;;;gac;
;;;;;;;
cds;83;cds;83;;;;
16s;114;16s;122;;;;
gaa;2;gaa;2;;;;
aaa;24;aaa;9;;;;
gca;35;gca;37;;;;
gta;306;gta;51;;;;
23s;77;cds;16;;;;
5s;90;23s;77;;;;
tca;;5s;32;;;;
;;gac;;;;;

Aeromonas media WS[modifier | modifier le wikicode]

amed opérons[modifier | modifier le wikicode]

61.2%GC;25.7.19 Paris;16s ;126;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd
Aeromonas media WS;;;;;;;;;;
;6590..7159;;CDS;;3;;;;190;
;;;;;;;;;;
comp;7163..8359;;CDS;;512;*512;;;399;
;8872..10421;;16s;;66;;;;;
;10488..10564;;atc;;10;;;10;;
;10575..10650;;gca;;231;;;;;
;10882..13800;;23s;;98;;;;;
;13899..14013;;5s;;386;*386;;;;*386
;14400..14717;;CDS;;102422;;;;106;
;;;;;;;;;;
;117140..117850;;CDS;;47;47;;;237;47
;117898..117973;;ttc;;52;;52;;;
;118026..118101;;aca;;3;;3;;;
;118105..118180;;ttc;;45;;45;;;
;118226..118301;;aac;;252;252;;;;
;118554..119573;;CDS;;50489;;;;340;
;;;;;;;;;;
comp;170063..170329;;CDS;;103;103;;;89;103
comp;170433..170518;;ctg;+;71;;71;;;
comp;170590..170675;;ctg;5 ctg;46;;46;;;
comp;170722..170807;;ctg;;46;;46;;;
comp;170854..170939;;ctg;;51;;51;;;
comp;170991..171076;;ctg;;116;116;;;;
comp;171193..172653;;CDS;;146173;;;;487;
;;;;;;;;;;
;318827..320692;;CDS;;190;190;;;622;190
;320883..320959;;atgi;;244;244;;;;
comp;321204..323780;;CDS;;62601;;;;*859;
;;;;;;;;;;
;386382..386732;;CDS;;514;*514;;;117;
;387247..388802;;16s;;268;;;;;
;389071..389146;;gaa;;245;;;;;
;389392..392312;;23s;;104;;;;;
;392417..392531;;5s;;268;268;;;;268
comp;392800..394413;;CDS;;81847;;;;538;
;;;;;;;;;;
;476261..476482;;CDS;;64;64;;;74;64
comp;476547..476622;;aac;;5;;5;;;
comp;476628..476703;;ttc;;622;*622;;;;
;477326..477547;;CDS;;22721;;;;*74;
;;;;;;;;;;
;500269..500814;;CDS;;177;177;;;182;177
;500992..501067;;ggc;+;24;;24;;;
;501092..501167;;ggc;6 ggc;29;;29;;;
;501197..501272;;ggc;;38;;38;;;
;501311..501386;;ggc;;25;;25;;;
;501412..501487;;ggc;;23;;23;;;
;501511..501586;;ggc;;363;*363;;;;
comp;501950..502159;;CDS;;4810;;;;70;
;;;;;;;;;;
;506970..507110;;CDS;;236;236;;;47;236
;507347..507422;;gcc;+;28;;28;;;
;507451..507526;;gcc;5 gcc;66;;66;;;
;507593..507668;;gcc;;58;;58;;;
;507727..507802;;gcc;;40;;40;;;
;507843..507918;;gcc;;471;*471;;;;
;508390..508473;;riboswitch;@1;134002;;;;28;
;;;;;;;;;;
;642476..642802;;CDS;;9;9;;;109;9
;642812..642896;;ctc;;91;;91;;;
;642988..643064;;atgf;;166;166;;;;
;643231..643689;;CDS;;128528;;;;153;
;;;;;;;;;;
;772218..774050;;CDS;;195;195;;;611;195
comp;774246..774329;;cta;+;8;;8;;;
comp;774338..774414;;atg;3 atg;38;;38;;;
comp;774453..774527;;caa;4 caa;47;;47;;;
comp;774575..774649;;caa;;17;;17;;;
comp;774667..774743;;atg;;35;;35;;;
comp;774779..774853;;caa;;47;;47;;;
comp;774901..774975;;caa;;13;;13;;;
comp;774989..775065;;atg;;235;235;;;;
comp;775301..776392;;CDS;;3148;;;;364;
;;;;;;;;;;
comp;779541..780557;;CDS;;104;104;;;339;104
comp;780662..780736;;caa;;-21;*-21;;;;*-21
comp;780716..781612;;CDS;;373301;;;;299;
;;;;;;;;;;
comp;1154914..1155384;;CDS;;131;131;;;157;131
comp;1155516..1155592;;ccc;;226;226;;;;
comp;1155819..1157162;;CDS;;67691;;;;448;
;;;;;;;;;;
comp;1224854..1226290;;CDS;;301;301;;;479;
comp;1226592..1226667;;aac;;2;;2;;;
comp;1226670..1226744;;gga;;164;164;;;;164
comp;1226909..1227181;;CDS;;13604;;;;91;
;;;;;;;;;;
comp;1240786..1241733;;CDS;;350;*350;;;316;
comp;1242084..1242156;;aac;+;2;;2;;;
comp;1242159..1242234;;aac;2 aac;49;49;;;;49
;1242284..1242496;;CDS;;294;;;;71;
;;;;;;;;;;
;1242791..1244527;;CDS;;181;181;;;579;181
;1244709..1244796;;tcc;;407;*407;;;;
;1245204..1246064;;CDS;;161293;;;;287;
;;;;;;;;;;
comp;1407358..1408338;;CDS;;410;*410;;;327;
comp;1408749..1408836;;tcc;;177;177;;;;177
comp;1409014..1409631;;CDS;;34595;;;;206;
;;;;;;;;;;
;1444227..1444688;;CDS;;146;146;;;154;
;1444835..1444922;;tcc;;127;127;;;;127
;1445050..1446834;;CDS;;14349;;;;595;
;;;;;;;;;;
comp;1461184..1462401;;CDS;;163;163;;;406;163
comp;1462565..1462640;;cac;;124;;124;;;
comp;1462765..1462838;;aga;;240;240;;;;
comp;1463079..1464389;;CDS;;61984;;;;437;
;;;;;;;;;;
comp;1526374..1527606;;CDS;;151;151;;;411;151
comp;1527758..1527833;;cac;;123;;123;;;
comp;1527957..1528033;;aga;;36;;36;;;
comp;1528070..1528146;;cca;;203;203;;;;
;1528350..1529207;;CDS;;60230;;;;286;
;;;;;;;;;;
;1589438..1589644;;CDS;;138;138;;;69;
comp;1589783..1589858;;aac;;132;132;;;;132
;1589991..1592003;;CDS;;57434;;;;671;
;;;;;;;;;;
;1649438..1651867;;CDS;;104;104;;;*810;104
comp;1651972..1652048;;gtc;+;36;;36;;;
comp;1652085..1652161;;gtc;5 gtc;26;;26;;;
comp;1652188..1652264;;gtc;;15;;15;;;
comp;1652280..1652356;;gtc;;11;;11;;;
comp;1652368..1652444;;gtc;;170;170;;;;
comp;1652615..1653994;;CDS;;277443;;;;460;
;;;;;;;;;;
comp;1931438..1932934;;CDS;;145;145;;;499;145
comp;1933080..1933156;;atgf;+;110;;110;;;
comp;1933267..1933343;;atgf;9 atgf;102;;102;;;
comp;1933446..1933522;;atgf;@2;101;;101;;;
comp;1933624..1933700;;atgf;;101;;101;;;
comp;1933802..1933877;;atgf;;103;;103;;;
comp;1933981..1934057;;atgf;;102;;102;;;
comp;1934160..1934236;;atgf;;102;;102;;;
comp;1934339..1934415;;atgf;;92;;92;;;
comp;1934508..1934584;;atgf;;268;268;;;;
comp;1934853..1935572;;CDS;;490897;;;;240;
;;;;;;;;;;
comp;2426470..2427675;;CDS;;350;350;;;402;
comp;2428026..2428112;;tta;;40;;40;;;
comp;2428153..2428226;;tgc;;35;;35;;;
comp;2428262..2428337;;ggc;;181;181;;;;181
comp;2428519..2429073;;CDS;;117921;;;;185;
;;;;;;;;;;
comp;2546995..2547534;;CDS;;271;271;;;180;271
;2547806..2547882;;ccc;;1103;*1103;;;;
;2548986..2550593;;CDS;;107760;;;;*536;
;;;;;;;;;;
;2658354..2659094;;CDS;;87;87;;;247;87
;2659182..2659257;;acg;;108;108;;;;
<  comp;2659366..2659705;;CDS;;198821;;;;113;
;;;;;;;;;;
comp;2858527..2859036;;CDS;;126;126;;;170;
;2859163..2859247;;tac;+;30;;30;;;
;2859278..2859362;;tac;2 tac;121;121;;;;121
comp;2859484..2863335;;CDS;;115303;;;;*1284;
;;;;;;;;;;
;2978639..2979358;;CDS;;119;119;;;240;119
comp;2979478..2979552;;gga;;104;;104;;;
comp;2979657..2979730;;ggg;;201;201;;;;
;2979932..2981701;;CDS;;41492;;;;590;
;;;;;;;;;;
;3023194..3023487;;CDS;;75;75;;;98;75
comp;3023563..3023636;;tgc;;57;;57;;;
comp;3023694..3023769;;ggc;;248;248;;;;
;3024018..3027455;;CDS;;17375;;;;*1146;
;;;;;;;;;;
;3044831..3045361;;CDS;;133;133;;;177;133
comp;3045495..3045584;;tcg;;380;*380;;;;
;3045965..3046882;;CDS;;221147;;;;306;
;;;;;;;;;;
comp;3268030..3268398;;CDS;;318;318;;;123;
comp;3268717..3268804;;tca;;198;198;;;;198
;3269003..3269752;;CDS;;20717;;;;250;
;;;;;;;;;;
;3290470..3291624;;CDS;;50;50;;;385;50
;3291675..3291751;;agg;;126;126;;;;
comp;3291878..3292804;;CDS;;41865;;;;309;
;;;;;;;;;;
;3334670..3335758;;CDS;;230;230;;;363;
;3335989..3336073;;tac;+;32;;32;;;
;3336106..3336190;;tac;3 tac;45;;45;;;
;3336236..3336320;;tac;;135;135;;;;135
;3336456..3336731;;CDS;;169091;;;;92;
;;;;;;;;;;
comp;3505823..3506272;;CDS;;275;275;;;150;275
comp;3506548..3506662;;5s;;101;;;;;
comp;3506764..3509682;;23s;;229;;;;;
comp;3509912..3509987;;gaa;;218;;;;;
comp;3510206..3511760;;16s;;592;*592;;;;
;3512353..3515220;;CDS;;161083;;;;*956;
;;;;;;;;;;
comp;3676304..3677323;;CDS;;113;113;;;340;
comp;3677437..3677521;;ttg;;49;49;;;;49
;3677571..3678182;;CDS;;9862;;;;204;
;;;;;;;;;;
;3688045..3688872;;CDS;;369;*369;;;276;
comp;3689242..3689318;;cgt;+;25;;25;;;
comp;3689344..3689420;;cgt;5 cgt;25;;25;;;
comp;3689446..3689522;;cgt;;26;;26;;;
comp;3689549..3689625;;cgt;;98;;98;;;
comp;3689724..3689800;;cgt;;4;;4;;;
comp;3689805..3689897;;agc;;213;213;;;;213
comp;3690111..3690299;;CDS;;196546;;;;63;
;;;;;;;;;;
;3886846..3887601;;CDS;;302;302;;;252;302
comp;3887904..3887980;;gac;;98;;;;;
comp;3888079..3888193;;5s;;105;;;;;
comp;3888299..3891217;;23s;;231;;;;;
comp;3891449..3891524;;gca;;10;;;10;;
comp;3891535..3891611;;atc;;66;;;;;
comp;3891678..3893232;;16s;;420;*420;;;;
comp;3893653..3894195;;CDS;;18750;;;;181;
;;;;;;;;;;
comp;3912946..3913317;;CDS;;60;60;;;124;
comp;3913378..3913454;;tgg;;52;52;;;;52
comp;3913507..3914691;;CDS;@3;171;171;;;395;171
comp;3914863..3914937;;gga;;38;;38;;;
comp;3914976..3915060;;tac;;263;263;;;;
;3915324..3916262;;CDS;;45900;;;;313;
;;;;;;;;;;
comp;3962163..3963533;;CDS;;306;306;;;457;
comp;3963840..3963916;;tgg;;202;202;;;;202
;3964119..3964703;;CDS;;59641;;;;195;
;;;;;;;;;;
comp;4024345..4026816;;CDS;;658;*658;;;*824;
comp;4027475..4027551;;ccg;;140;140;;;;140
comp;4027692..4028417;;CDS;;80995;;;;242;
;;;;;;;;;;
;4109413..4111986;;CDS;;99;99;;;*858;
comp;4112086..4112200;;5s;;101;;;;;
comp;4112302..4115220;;23s;;231;;;;;
comp;4115452..4115527;;gaa;;192;;;;;
comp;4115720..4117273;;16s;;94;94;;;;94
comp;4117368..4117547;;CDS;;32227;;;;60;
;;;;;;;;;;
comp;4149775..4150248;;CDS;;204;204;;;158;204
comp;4150453..4150529;;cca;;58;;58;;;
comp;4150588..4150673;;ctg;;20;;20;;;
comp;4150694..4150769;;cac;;49;;49;;;
comp;4150819..4150895;;cgg;;258;258;;;;
;4151154..4151744;;CDS;;74862;;;;197;
;;;;;;;;;;
;4226607..4227725;;CDS;;428;*428;;;373;
;4228154..4229708;;16s;;192;;;;;
;4229901..4229976;;gaa;;229;;;;;
;4230206..4233124;;23s;;104;;;;;
;4233229..4233343;;5s;;106;;;;;
;4233450..4233525;;acc;;23;;;;;
;4233549..4233663;;5s;;164;164;;;;164
;4233828..4234793;;CDS;;119351;;;;322;
;;;;;;;;;;
comp;4354145..4355686;;CDS;;622;*622;;;*514;
;4356309..4357863;;16s;;268;;;;;
;4358132..4358207;;gaa;;230;;;;;
;4358438..4361364;;23s;;102;;;;;
;4361467..4361581;;5s;;106;;;;;
;4361688..4361763;;acc;;233;233;;;;233
;4361997..4363241;;CDS;;71363;;;;415;
;;;;;;;;;;
;4434605..4435198;;CDS;;465;*465;;;198;
;4435664..4437217;;16s;;219;;;;;
;4437437..4437512;;gaa;;229;;;;;
;4437742..4440657;;23s;;103;;;;;
;4440761..4440875;;5s;;98;;;;;
;4440974..4441050;;gac;;167;167;;;;167
;4441218..4442054;;CDS;;39919;;;;279;
;;;;;;;;;;
comp;4481974..4482513;;CDS;;477;*477;;;180;
;4482991..4484545;;16s;;513;;;;;
;4485059..4485549;;23s°;;37;;;;;
comp;4485587..4486115;;23s°;;229;;;;;
comp;4486345..4486419;;gaa;;218;;;;;
comp;4486638..4488193;;16s;;94;94;;;;94
comp;4488288..4488509;;CDS;;72132;;;;74;
;;;;;;;;;;
comp;4560642..4561676;;CDS;;192;192;;;345;
comp;4561869..4561944;;gta;+;18;;18;;;
comp;4561963..4562038;;aaa;7 gta;34;;34;;;
comp;4562073..4562148;;gta;5 aaa;18;;18;;;
comp;4562167..4562242;;aaa;2 aag;23;;23;;;
comp;4562266..4562341;;gta;;18;;18;;;
comp;4562360..4562435;;aaa;;23;;23;;;
comp;4562459..4562534;;gta;;18;;18;;;
comp;4562553..4562628;;aaa;;34;;34;;;
comp;4562663..4562738;;gta;;22;;22;;;
comp;4562761..4562836;;aag;;46;;46;;;
comp;4562883..4562958;;gta;;22;;22;;;
comp;4562981..4563056;;aag;;46;;46;;;
comp;4563103..4563178;;gta;;32;;32;;;
comp;4563211..4563286;;aaa;;174;174;;;;174
comp;4563461..4564276;;CDS;;70895;;;;272;
;;;;;;;;;;
comp;4635172..4636173;;CDS;;275;275;;;334;275
comp;4636449..4636525;;gac;;95;;;;;
comp;4636621..4636735;;5s;;101;;;;;
comp;4636837..4639756;;23s;;231;;;;;
comp;4639988..4640063;;gca;;10;;;10;;
comp;4640074..4640150;;atc;;66;;;;;
comp;4640217..4641771;;16s;;512;*512;;;;
;4642284..4643480;;CDS;;3;;;;399;
;;;;;;;;;;
comp;4643484..4644053;;CDS;;;;;;190;

amed cumuls[modifier | modifier le wikicode]

amed cumuls;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa
avec rRNA;opérons;10;1;0;-;1;1;40;1;100;14
;16 gaa 23 5s ;6;20;15;;50;5;60;5;200;21
;16 atc gca;3;40;27;;100;8;80;2;300;15
;16 23 5s ;0;60;14;;150;19;100;3;400;18
;max a;3;80;2;;200;17;120;4;500;11
;a doubles;0;100;3;;250;13;140;7;600;6
;spéciaux;1;120;8;;300;8;160;2;700;3
;total aas;17;140;2;;350;6;180;8;800;0
sans ;opérons;38;160;0;;400;4;200;5;900;4
;1 aa;16;180;0;;450;4;220;3;1000;1
;max a;14;200;0;;500;3;240;2;1100;0
;a doubles;12;;0;;;8;;6;;2
;total aas;109;;71;0;;96;;48;;95
total aas;;126;;;;;;;;;
remarques;;3;;;;;;;;;
avec jaune;;;moyenne;49;;;;;156;;
;;;variance;34;;;;;77;;
sans jaune;;;moyenne;;;;214;;;;274
;;;variance;;;;122;;;;157

amed blocs[modifier | modifier le wikicode]

amed blocs;;;;;
cds;512;cds;302;cds;275
16s;66;gac;98;gac;95
atc;10;5s;105;5s;101
gca;231;23s;231;23s;231
23s;98;gca;10;gca;10
5s;386;atc;66;atc;66
;;16s;420;16s;512
;;;;;
cds;514;275;99;;
16s;268;101;101;;
gaa;245;229;231;;
23s;104;218;192;;
5s;268;592;94;;
;;;;;
cds;428;CDS;622;cds;465
16s;192;16s;268;16s;219
gaa;229;gaa;230;gaa;229
23s;104;23s;102;23s;103
5s;106;5s;106;5s;98
acc;23;acc;233;gac;167
5s;164;;;;

alpha[modifier | modifier le wikicode]

rtb[modifier | modifier le wikicode]

rtb opérons[modifier | modifier le wikicode]

29.0%GC;31.12.19 Paris;16s  1 ;33 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rickettsia typhi str. B9991CWPP ;;;;;;;;;;;;
comp;7429..8469;;cds;;381;381;;;347;;UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase;*
comp;8851..8926;;ttc;;368;368;;;;;;*
;9295..10278;;cds;;;;;;328;;tRNA dihydrouridine synthase DusB;*
;;;;;;;;;;;;*
;14663..18055;;cds;;108;108;;;1131;;autotransporter outer membrane beta-barrel domain-containing protein;*
;18164..18238;;gaa;;1394;*1394;;;;;;*
comp;19633..20106;;cds;;;;;;158;;crossover junction endodeoxyribonuclease RuvC;*
;;;;;;;;;;;;*
comp;48065..48709;;cds;;278;278;;;215;;YihA family ribosome biogenesis GTP-binding protein;*
comp;48988..49064;;atgf;;110;110;;;;;;*
comp;49175..49411;;cds;;;;;;79;;50S ribosomal protein L31;*
;;;;;;;;;;;;*
comp;73627..73929;;cds;;17;17;;;101;;preprotein translocase subunit SecG;*
comp;73947..74021;;acc;;139;139;;;;;;*
comp;74161..75417;;cds;;;;;;419;;MFS transporter;*
;;;;;;;;;;;;*
;155064..157163;;cds;;143;143;;;700;;elongation factor G;*
;157307..157382;;tgg;;167;167;;;;;;*
;157550..157750;;cds;;;;;;67;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
;189197..189400;;cds;;889;*889;;;68;;DUF2674 domain-containing protein;*
comp;190290..190365;;acg;;142;142;;;;;;*
comp;190508..192814;;cds;;;;;;769;;outer membrane protein assembly factor BamA;*
;;;;;;;;;;;;*
;255010..255921;;cds;;732;*732;;;304;;methionyl-tRNA formyltransferase;*
;256654..259439;;23s;;206;;;;2786;;;*
;259646..259760;;5s;;173;173;;;115;;;*
comp;259934..261007;;cds;;;;;;358;;cell division protein ZapE;*
;;;;;;;;;;;;*
;291358..291843;;cds;;35;35;;;162;;30S ribosomal protein S9;*
;291879..291955;;atgj;;1364;*1364;;;;;;*
comp;293320..293805;;cds;;;;;;162;;RNA pyrophosphohydrolase;*
;;;;;;;;;;;;*
;335194..336996;;cds;;402;402;;;601;;elongation factor 4;*
;337399..337473;;aac;;633;*633;;;;;;*
comp;338107..338793;;cds;;;;;;229;;hp;*
;;;;;;;;;;;;*
comp;440466..440933;;cds;;496;496;;;156;;DUF2155 domain-containing protein;*
;441430..441504;;tgc;;31;31;;;;;;*
;441536..442456;;cds;;;;;;307;;site-specific tyrosine recombinase XerD;*
;;;;;;;;;;;;*
comp;469056..469781;;cds;;218;218;;;242;;3-deoxy-manno-octulosonate cytidylyltransferase;*
;470000..470075;;aaa;;15;;15;;;;;*
;470091..470167;;atc;;1922;*1922;;;;;;*
;472090..472662;;cds;;;;;;191;;GTP cyclohydrolase I FolE;*
;;;;;;;;;;;;*
comp;564534..565562;;cds;;1530;*1530;;;343;;type 2 isopentenyl-diphosphate Delta-isomerase;*
comp;567093..567180;;tcc;;218;218;;;;;;*
comp;567399..568145;;cds;;;;;;249;;NTP transferase domain-containing protein;*
;;;;;;;;;;;;*
;583250..584149;;cds;;1278;*1278;;;300;;hydroxymethylbilane synthase;*
comp;585428..585518;;tca;;58;58;;;;;;*
comp;585577..586569;;cds;;;;;;331;;tryptophan--tRNA ligase;*
;;;;;;;;;;;;*
;598723..599706;;cds;;26;26;;;328;;polyprenyl synthetase family protein;*
;599733..599809;;cgg;;60;;60;;;;;*
comp;599870..599944;;caa;;62;62;;;;;;*
comp;600007..601779;;cds;;;;;;591;;aminopeptidase P family protein;*
;;;;;;;;;;;;*
comp;644357..644745;;cds;;499;499;;;130;;p-ribosome-associated translation inhibitor RaiA;*
;645245..645321;;gac;@1;1051;;1051;;;;;*
comp;646373..646448;;gcc;;222;222;;;;;;*
comp;646671..647276;;cds;;;;;;202;;ATP-dependent Clp endopeptidase proteolytic subunit ClpP;*
;;;;;;;;;;;;*
comp;649389..650048;;cds;;452;452;;;220;;(d)CMP kinase;*
;650501..650577;;gtc;;1274;*1274;;;;;;*
comp;651852..652094;;cds;;;;;;81;;HU family DNA-binding protein;*
;;;;;;;;;;;;*
comp;696163..697398;;cds;;1535;*1535;;;412;;tyrosine--tRNA ligase;*
;698934..699010;;cgt;;1028;*1028;;;;;;*
;700039..705720;;cds;;;;;;1894;;alpha-2-macroglobulin family protein;*
;;;;;;;;;;;;*
comp;727560..728087;;cds;;1164;*1164;;;176;;copper chaperone Pcu(A)C;*
comp;729252..729326;;gca;;32;32;;;;;;*
comp;729359..729574;;cds;;;;;;72;;hp;*
;;;;;;;;;;;;*
;739215..740075;;cds;;181;181;;;287;;TIGR01459 family HAD-type hydrolase;*
;740257..740343;;ctc;;246;246;;;;;;*
;740590..741960;;cds;;1199;*1199;;;457;;magnesium transporter;*
;743160..743234;;ggc;;1090;*1090;;;;;;*
;744325..744753;;cds;;;;;;143;;preprotein translocase subunit YajC;*
;;;;;;;;;;;;*
comp;775944..777866;;cds;;2465;*2465;;;641;;hp;*
comp;780332..781831;;16s;;1854;*1854;;;1500;;;*
comp;783686..785485;;cds;;;;;;600;;PAS domain-containing sensor histidine kinase;*
;;;;;;;;;;;;*
comp;814590..814823;;cds;;349;349;;;78;;hp;*
comp;815173..815248;;gta;;68;68;;;;;;*
comp;815317..815589;;cds;;;;;;91;;30S ribosomal protein S20;*
;;;;;;;;;;;;*
comp;829300..830484;;cds;;82;82;;;395;;elongation factor Tu;*
comp;830567..830640;;gga;;95;;95;;;;;*
comp;830736..830821;;tac;;183;183;;;;;;*
;831005..831733;;cds;;;;;;243;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
;839841..839969;;cds;;145;145;;;43;;dimethyladenosine transferase;*
;840115..840200;;tta;;2009;*2009;;;;;;*
;842210..842446;;cds;;;;;;79;;hp;*
;;;;;;;;;;;;*
comp;876906..877589;;cds;;401;401;;;228;;7-cyano-7-deazaguanine synthase QueC;*
;877991..878067;;cac;;145;145;;;;;;*
;878213..879943;;cds;;;;;;577;;ATP-binding cassette domain-containing protein;*
;;;;;;;;;;;;*
;918938..919882;;cds;;951;*951;;;315;;ACP S-malonyltransferase;*
;920834..920925;;agc;;1945;*1945;;;;;;*
comp;922871..924049;;cds;;;;;;393;;acetyl-CoA C-acetyltransferase;*
;;;;;;;;;;;;*
comp;961209..962297;;cds;;41;41;;;363;;YjgP/YjgQ family permease;*
comp;962339..962415;;atgi;;390;390;;;;;;*
comp;962806..963273;;cds;;;;;;156;;peptidoglycan-associated lipoprotein Pal;*
;;;;;;;;;;;;*
;1023375..1023626;;cds;;1585;*1585;;;84;;BolA family transcriptional regulator;*
;1025212..1025288;;cca;;17;17;;;;;;*
;1025306..1025521;;cds;;;;;;72;;translation initiation factor IF-1;*
;;;;;;;;;;;;*
;1053321..1054139;;cds;;2191;*2191;;;273;;alpha/beta hydrolase;*
comp;1056331..1056407;;aga;;98;98;;;;;;*
;1056506..1056823;;cds;;;;;;106;;DUF167 domain-containing protein;*
;;;;;;;;;;;;*
comp;1098776..1099240;;cds;;40;40;;;155;;DNA polymerase III subunit chi;*
comp;1099281..1099365;;cta;;145;145;;;;;;*
comp;1099511..1100662;;cds;;;;;;384;;succinyl-diaminopimelate desuccinylase;*
;;;;;;;;;;;;*
comp;1102351..1102980;;cds;;475;475;;;210;;lipoyl(octanoyl) transferase LipB;*
comp;1103456..1103530;;aca;;130;130;;;;;;*
comp;1103661..1103996;;cds;;;;;;112;;30S ribosomal protein S16;*

rtb cumuls[modifier | modifier le wikicode]

rtb cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;;cdsa;gammes;cdsa 300
avec rRNA;opérons;2;1;;-;1;0;1;;100;11;30;0
;23s5s;1;20;1;;50;8;40;;200;13;60;1
;16s;1;40;;;100;5;80;;300;12;90;9
;16s23s;0;60;1;;150;9;120;;400;13;120;4
;max a;0;80;;;200;4;160;;500;3;150;2
;a doubles;0;100;1;;250;4;200;;600;3;180;7
;spéciaux;0;120;;;300;1;240;;700;3;210;3
;total aas;0;140;;;350;1;280;;800;1;240;4
sans ;opérons;29;160;;;400;3;320;;900;0;270;3
;1 aa;25;180;;;450;2;360;;1000;0;300;3
;max a;2;200;;;500;4;400;;1100;0;330;5
;a doubles;0;;1;;;21;;;;2;;20
;total aas;33;;4;0;;62;;0;;61;;61
total aas;;33;;;;21;1430;;;;;;
remarques;;1;;;;;491;;;;;;
avec jaune;;;moyenne;;;;612;;;;310;;
;;;variance;;;;665;;;;291;;
sans jaune;;;moyenne;57;;;193;;;;269;;176
;;;variance;40;;;148;;;;176;;86

rtb blocs[modifier | modifier le wikicode]

rpl[modifier | modifier le wikicode]

rpl opérons[modifier | modifier le wikicode]

29.0%GC;30.12.19 Paris;16s  1 ;33 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rickettsia prowazekii str. Breinl ;;;;;;;;;;;;
comp;31462..31892;;cds;;263;263;;;144;;p-preprotein translocase subunit YajC;*
comp;32156..32181;;rpr;;870;870;;;26;;tandem;*
comp;33052..33126;;ggc;;1253;1253;;;;;;*
comp;34380..35750;;cds;;256;256;;;;;magnesium transporter;*
comp;36007..36093;;ctc;;190;190;;;;;;*
comp;36284..37144;;cds;;;;;;287;;TIGR01459 family HAD-type hydrolase;*
;;;;;;;;;;;;*
;46825..47040;;cds;;31;31;;;72;;hp;*
;47072..47146;;gca;;1964;1964;;;;;;*
;49111..49650;;cds;;;;;;180;;copper chaperone Pcu(A)C;*
;;;;;;;;;;;;*
comp;71150..76816;;cds;;933;933;;;1889;;alpha-2-macroglobulin family protein;*
comp;77750..77826;;cgt;;1179;1179;;;;;;*
;79006..80241;;cds;;;;;;412;;tyrosine--tRNA ligase;*
;;;;;;;;;;;;*
;121704..121946;;cds;;984;984;;;81;;HU family DNA-binding protein;*
comp;122931..123007;;gtc;;446;446;;;;;;*
;123454..124113;;cds;;;;;;220;;(d)CMP kinase;*
;;;;;;;;;;;;*
;126222..126827;;cds;;236;236;;;202;;ATP-dependent Clp endopeptidase proteolytic subunit ClpP;*
;127064..127139;;gcc;@1;830;;830;;;;;*
comp;127970..128046;;gac;;365;365;;;;;;*
;128412..128843;;cds;;;;;;144;;ribosome-associated translation inhibitor RaiA;*
;;;;;;;;;;;;*
;171237..173012;;cds;;50;50;;;592;;aminopeptidase P family protein;*
;173063..173137;;caa;;49;;49;;;;;*
comp;173187..173263;;cgg;;18;18;;;;;;*
comp;173282..174265;;cds;;;;;;328;;polyprenyl synthetase family protein;*
;;;;;;;;;;;;*
;186344..187336;;cds;;58;58;;;331;;tryptophan--tRNA ligase;*
;187395..187484;;tca;;354;354;;;;;;*
comp;187839..188738;;cds;;;;;;300;;hydroxymethylbilane synthase;*
;;;;;;;;;;;;*
;203097..203846;;cds;;219;219;;;250;;bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase;*
;204066..204153;;tcc;;1457;1457;;;;;;*
;205611..206639;;cds;;;;;;343;;type 2 isopentenyl-diphosphate Delta-isomerase;*
;;;;;;;;;;;;*
comp;299321..300853;;cds;;419;419;;;511;;hp;*
comp;301273..301349;;atc;;15;;15;;;;;*
comp;301365..301440;;aaa;;219;219;;;;;;*
;301660..302400;;cds;;;;;;247;;3-deoxy-manno-octulosonate cytidylyltransferase;*
;;;;;;;;;;;;*
comp;328700..329635;;cds;;22;22;;;312;;site-specific tyrosine recombinase XerD;*
comp;329658..329732;;tgc;;499;499;;;;;;*
;330232..330699;;cds;;;;;;156;;DUF2155 domain-containing protein;*
;;;;;;;;;;;;*
;429121..429807;;cds;;723;723;;;229;;hp;*
comp;430531..430605;;aac;;359;359;;;;;;*
comp;430965..432767;;cds;;;;;;601;;elongation factor 4;*
;;;;;;;;;;;;*
;473867..474352;;cds;;928;928;;;162;;RNA pyrophosphohydrolase;*
comp;475281..475357;;atgj;;40;40;;;;;;*
comp;475398..475883;;cds;;;;;;162;;30S ribosomal protein S9;*
;;;;;;;;;;;;*
;506934..508007;;cds;;183;183;;;358;;cell division protein ZapE;*
comp;508191..508305;;5s;;240;;;;115;;;*
comp;508546..511330;;23s;;716;716;;;2785;;;*
comp;512047..512958;;cds;;;;;;304;;methionyl-tRNA formyltransferase;*
;;;;;;;;;;;;*
;577419..579725;;cds;;138;138;;;769;;outer membrane protein assembly factor BamA;*
;579864..579939;;acg;;1026;1026;;;;;;*
comp;580966..581169;;cds;;;;;;68;;DUF2674 domain-containing protein;*
;;;;;;;;;;;;*
comp;612439..612639;;cds;;143;143;;;67;;preprotein translocase subunit SecE;*
comp;612783..612858;;tgg;;143;143;;;;;;*
comp;613002..615101;;cds;;;;;;700;;elongation factor G;*
;;;;;;;;;;;;*
comp;656226..656870;;cds;;296;296;;;215;;YihA family ribosome biogenesis GTP-binding protein;*
comp;657167..657243;;atgf;;119;119;;;;;;*
comp;657363..657599;;cds;;;;;;79;;50S ribosomal protein L31;*
;;;;;;;;;;;;*
comp;678911..679213;;cds;;19;19;;;101;;preprotein translocase subunit SecG;*
comp;679233..679307;;acc;;159;159;;;;;;*
comp;679467..680723;;cds;;;;;;419;;MFS transporter;*
;;;;;;;;;;;;*
comp;746326..746529;;cds;;1664;1664;;;68;;hp;*
comp;748194..748268;;gaa;;109;109;;;;;;*
comp;748378..749421;;cds;;;;;;348;;autotransporter outer membrane beta-barrel domain-containing protein;*
;;;;;;;;;;;;*
comp;756703..757686;;cds;;363;363;;;328;;tRNA dihydrouridine synthase DusB;*
;758050..758125;;ttc;;564;564;;;;;;*
;758690..759730;;cds;;;;;;347;;UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase;*
;;;;;;;;;;;;*
;776202..776537;;cds;;154;154;;;112;;30S ribosomal protein S16;*
;776692..776766;;aca;;467;467;;;;;;*
;777234..777863;;cds;;;;;;210;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;779197..780348;;cds;;140;140;;;384;;succinyl-diaminopimelate desuccinylase;*
;780489..780573;;cta;;37;37;;;;;;*
;780611..781075;;cds;;;;;;155;;DNA polymerase III subunit chi;*
;;;;;;;;;;;;*
comp;823242..823559;;cds;;98;98;;;106;;DUF167 domain-containing protein;*
;823658..823734;;aga;;1364;1364;;;;;;*
comp;825099..825230;;cds;;;;;;44;;hp;*
;;;;;;;;;;;;*
comp;854241..854456;;cds;;17;17;;;72;;translation initiation factor IF-1;*
comp;854474..854550;;cca;;1573;1573;;;;;;*
comp;856124..856357;;cds;;;;;;78;;BolA family transcriptional regulator;*
;;;;;;;;;;;;*
;915034..915501;;cds;;391;391;;;156;;peptidoglycan-associated lipoprotein Pal;*
;915893..915969;;atgi;;41;41;;;;;;*
;916011..917099;;cds;;;;;;363;;YjgP/YjgQ family permease;*
;;;;;;;;;;;;*
;953564..954742;;cds;;696;696;;;393;;acetyl-CoA C-acetyltransferase;*
comp;955439..955530;;agc;;898;898;;;;;;*
comp;956429..957373;;cds;;;;;;315;;ACP S-malonyltransferase;*
;;;;;;;;;;;;*
comp;1009435..1011165;;cds;;142;142;;;577;;ATP-binding cassette domain-containing protein;*
comp;1011308..1011384;;cac;;346;346;;;;;;*
;1011731..1012414;;cds;;;;;;228;;7-cyano-7-deazaguanine synthase QueC;*
;;;;;;;;;;;;*
comp;1045414..1045656;;cds;;2381;2381;;;81;;hp;*
comp;1048038..1048123;;tta;;135;135;;;;;;*
comp;1048259..1048387;;cds;;;;;;43;;hp;*
;;;;;;;;;;;;*
comp;1056245..1056973;;cds;;188;188;;;243;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;1057162..1057247;;tac;;105;;105;;;;;*
;1057353..1057426;;gga;;82;82;;;;;;*
;1057509..1058693;;cds;;;;;;395;;elongation factor Tu;*
;;;;;;;;;;;;*
;1072391..1072663;;cds;;62;62;;;91;;30S ribosomal protein S20;*
;1072726..1072801;;gta;;1181;1181;;;;;;*
comp;1073983..1074648;;cds;;;;;;222;;hp;*
;;;;;;;;;;;;*
;1102136..1103935;;cds;;1458;1462;;;600;;PAS domain-containing sensor histidine kinase;*
;1105394..1106893;;16s;;1462;1462;;;1500;;;*
;1108356..1109301,1..184;;cds;;;;;;377;;P-hp;*

rpl cumuls[modifier | modifier le wikicode]

rpl cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;2;1;;-;1;0;1;;100;12;30;0
;23s5s;1;20;1;;50;9;40;;200;11;60;2
;16s;1;40;;;100;4;80;;300;12;90;9
;16s23s;0;60;1;;150;8;120;;400;15;120;4
;max a;0;80;;;200;5;160;;500;2;150;2
;a doubles;0;100;;;250;3;200;;600;4;180;6
;spéciaux;0;120;1;;300;3;240;;700;2;210;2
;total aas;0;140;;;350;1;280;;800;1;240;5
sans ;opérons;29;160;;;400;5;320;;900;0;270;3
;1 aa;25;180;;;450;2;360;;1000;0;300;2
;max a;2;200;;;500;2;400;;1100;0;330;5
;a doubles;0;;1;;;21;;;;1;;20
;total aas;33;;4;0;;63;;0;;60;;60
total aas;;33;;;;21;1204;;;;;;
remarques;;1;;;;;453;;;;;;
avec jaune;;;moyenne;;;;528;;;;293;;
;;;variance;;;;558;;;;271;;
sans jaune;;;moyenne;56;;;191;;;;243;;172
;;;variance;45;;;140;;;;145;;89

rpl blocs[modifier | modifier le wikicode]

rpm[modifier | modifier le wikicode]

rpm opérons[modifier | modifier le wikicode]

;20   m23s;17  m16s;;;;;;;;;;
;;9 m16s seuls;;;;;;;;;;
http://gtrnadb.ucsc.edu/genomes/bacteria/Rhod_phot_DSM_122/rhodPhot_DSM122-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_017059.1;rpm;;genome;24.12.19;;;;;;;;
64.7%GC;26.12.19 Paris;16s  7;95 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rhodospirillum photometricum DSM 122;;;;;;;;;;;;
comp;3322..4194;;cds;;30;30;;;291;;LysM peptidoglycan-binding domain-containing protein;*
comp;4225..4821;;23s°;@1;196;;;;595;;;*
comp;5018..5093;;gca;;182;;;;;;;*
comp;5276..5684;;16s°;;38;38;;;407;;;*
;5723..6664;;cds;;;;;;314;;SEL1-like repeat protein;*
;;;;;;;;;;;;*
comp <;12458..13198;;cds;;242;242;;;247;;p-transposase;*
comp;13441..13555;;5s;@2;72;;;;113;;;*
comp;13628..13880;;23s°;;-7;*-7;;;251;;;*
comp;13874..15127;;cds;;;;;;418;;hp;*
;;;;;;;;;;;;*
;21325..22362;;cds;;586;*586;;;346;;hp;*
;22949..23237;;16s°;;85;85;;;287;;;*
comp;23323..23490;;cds;;;;;;56;;hp;*
;;;;;;;;;;;;*
comp;24015..24287;;cds;;250;250;;;91;;TraYdomain-containingprotein;*
comp;24538..24652;;5s;;71;;;;113;;;*
comp;24724..27490;;23s;;212;;;;2765;;;*
comp;27703..27779;;atc;;112;;;;;;;*
comp;27892..28378;;16s°;;18;18;;;485;;;*
<>;28397..29119;;cds;;;;;;241;;p-EscV/YscV/HrcVfamilytypeIIIsecretionsystemexportapparatusprotein;*
;;;;;;;;;;;;*
comp;32782..33759;;cds;;190;190;;;326;;glycosyltransferase;*
;33950..34357;;16s°;;112;;;;406;;;*
;34470..34546;;atc;;216;;;;;;;*
;34763..35591;;23s°;;44;;;;827;;;*
comp;35636..35750;;5s;;72;;;;113;;;*
comp;35823..38589;;23s;;215;;;;2765;;;*
comp;38805..38881;;atc;;112;;;;;;;*
comp;38994..40502;;16s;;260;;;;1507;;;*
comp;40763..42629;;23s°;;-15;;;;1865;;;*
;42615..42903;;16s°;;112;;;;287;;;*
;43016..43092;;atc;;213;;;;;;;*
;43306..44132;;23s°;;-1;;;;825;;;*
comp;44132..44835;;23s°;;-5;*-5;;;702;;;*
;44831..45121;;cds;;;;;;97;;hp;*
;;;;;;;;;;;;*
<;45496..45768;;cds;;553;*553;;;91;;p-glycosyl transferase family 1;*
;46322..47040;;16s°;;0;*0;;;717;;;*
comp;47041..47433;;cds;;;;;;131;;winged helix-turn-helix domain-containing protein;*
;;;;;;;;;;;;*
comp;49761..51017;;cds;;128;128;;;419;;glycosyltransferase;*
comp;51146..51221;;23s°;;214;;;;74;;;*
comp;51436..51512;;atc;;112;;;;;;;*
comp;51625..52017;;16s°;;-7;;;;391;;;*
;52011..52881;;23s°;;106;106;;;869;;;*
;52988..53464;;cds;;-37;*-37;;;159;;hp;*
>;53428..53694;;cds;;86;86;;;89;;p-glycosyltransferase;*
comp;53781..54709;;23s°;;26;;;;927;;;*
;54736..54898;;16s°;;112;;;;161;;;*
;55011..55087;;atc;;216;;;;;;;*
;55304..55741;;23s°;;438;*438;;;436;;;*
;56180..56440;;cds;;;;;;87;;hp;*
;;;;;;;;;;;;*
comp;82891..83088;;cds;;116;116;;;66;;preprotein translocase subunit SecE;*
comp;83205..83280;;tgg;;199;199;;;;;;*
>comp;83480..84178;;cds;;;;;;233;;p-elongation factor Tu;*
;;;;;;;;;;;;*
;417242..417412;;cds;;142;142;;;57;;tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase;*
;417555..417631;;atgj;+;24;;24;;;;;*
;417656..417732;;atgj;2 atgj;38;38;;;;;;*
comp;417771..418796;;cds;;;;;;342;;tRNA epoxyqueuosine(34) reductase QueG;*
;;;;;;;;;;;;*
;434306..435142;;cds;;512;*512;;;279;;CDP-diacylglycerol--serine O-phosphatidyltransferase;*
;435655..435842;;16s°;;-6;;;;186;;;*
;435837..436075;;23s°;;72;;;;237;;;*
;436148..436262;;5s;;51;;;;113;;;*
;436314..436390;;atgf;;196;196;;;;;;*
;436587..436883;;cds;;;;;;99;;hp;*
;;;;;;;;;;;;*
comp;467261..468370;;cds;;167;167;;;370;;3-isopropylmalate dehydrogenase;*
;468538..468667;;23s°;;72;;;;128;;;*
;468740..468854;;5s;;51;;;;113;;;*
;468906..468982;;atgf;;125;125;;;;;;*
;469108..469863;;cds;;;;;;252;;SAM-dependent chlorinase/fluorinase;*
;;;;;;;;;;;;*
comp;534521..536161;;cds;;367;367;;;547;;glucose-6-phosphate isomerase;*
;536529..536603;;acg;;92;92;;;;;;*
comp;536696..537778;;cds;;;;;;361;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
comp;658467..658931;;cds;;110;110;;;155;;GNAT family N-acetyltransferase;*
comp;659042..659116;;gtc;;155;155;;;;;;*
;659272..660159;;cds;;106;106;;;296;;N-formylglutamate amidohydrolase;*
;660266..660340;;gtc;;648;*648;;;;;;*
comp;660989..661800;;cds;;;;;;271;;p-N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;684188..685141;;cds;;323;323;;;318;;cation transporter;*
comp;685465..685539;;gtg;+;25;;25;;;;;*
comp;685565..685639;;gtg;2 gtg;195;195;;;;;;*
;685835..686251;;cds;;;;;;139;;NUDIX hydrolase;*
;;;;;;;;;;;;*
comp;691078..691773;;cds;;4;4;;;232;;ComF family protein;*
;691778..691897;;23s°;;72;;;;118;;;*
;691970..692084;;5s;;114;114;;;113;;;*
comp;692199..694505;;cds;;;;;;769;;VWA domain-containing protein;*
;;;;;;;;;;;;*
;750262..751398;;cds;;161;161;;;379;;[FeFe] hydrogenase H-cluster radical SAM maturase HydE;*
comp;751560..751674;;5s;;72;;;;113;;;*
comp;751747..752005;;23s°;;597;*597;;;257;;;*
;752603..752814;;rpr;@4;388;*388;;;21;;CRISPR;*
;753203..753760;;cds;;;;;;186;;hp;*
;;;;;;;;;;;;*
comp;839981..840214;;cds;;4;4;;;78;;hp;*
comp;840219..840478;;16s°;;568;*568;;;258;;;*
comp;841047..844388;;cds;;;;;;1114;;response regulator;*
;;;;;;;;;;;;*
;874585..875391;;cds;;88;88;;;269;;phosphoadenylyl-sulfate reductase;*
;875480..875556;;cac;;81;81;;;;;;*
;875638..876117;;cds;;;;;;160;;CreA family protein;*
;;;;;;;;;;;;*
;885688..886299;;cds;;176;176;;;204;;LysE family translocator;*
;886476..886552;;ccc;;144;144;;;;;;*
comp;886697..887233;;cds;;;;;;179;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;932708..934243;;cds;;93;93;;;512;;Fic family protein;*
comp;934337..934413;;cgt;+;35;;35;;;;;*
comp;934449..934525;;cgt;3 cgt;44;;44;;;;;*
comp;934570..934646;;cgt;;449;*449;;;;;;*
;935096..936175;;cds;;;;;;360;;hp;*
;;;;;;;;;;;;*
comp;978995..979396;;cds;;138;138;;;134;;MFS transporter;*
comp;979535..979609;;ggc;+;23;;23;;;;;*
comp;979633..979707;;ggc;4 ggc;45;;45;;;;;*
comp;979753..979827;;ggc;;29;;29;;;;;*
comp;979857..979931;;ggc;;206;206;;;;;;*
;980138..981679;;cds;;;;;;514;;murein biosynthesis integral membrane protein MurJ;*
;;;;;;;;;;;;*
;997575..997898;;cds;;95;95;;;108;;DUF1476 domain-containing protein;*
comp;997994..998067;;cag;+;54;;54;;;;;*
comp;998122..998195;;cag;2 cag;168;168;;;;;;*
;998364..999509;;cds;;;;;;382;;Ppx/GppA family phosphatase;*
;;;;;;;;;;;;*
;1050081..1051028;;cds;;60;60;;;316;;NnrS family protein;*
comp;1051089..1051163;;acc;+;16;;16;;;;;*
comp;1051180..1051254;;acc;3 acc;18;;18;;;;;*
comp;1051273..1051347;;acc;;170;170;;;;;;*
comp;1051518..1053305;;cds;;;;;;596;;EAL domain-containing protein;*
;;;;;;;;;;;;*
;1197836..1199341;;cds;;197;197;;;502;;aldehyde dehydrogenase;*
;1199539..1199623;;cta;;126;126;;;;;;*
;1199750..1201090;;cds;;;;;;447;;trigger factor;*
;;;;;;;;;;;;*
;1206196..1206501;;cds;;93;93;;;102;;HU family DNA-binding protein;*
;1206595..1206670;;gta;;50;50;;;;;;*
;1206721..1207092;;cds;;;;;;124;;hp;*
;;;;;;;;;;;;*
;1213113..1214459;;cds;;210;210;;;449;;acetyl-CoA carboxylase biotin carboxylase subunit;*
comp;1214670..1214874;;16s°;;600;*600;;;203;;;*
comp;1215475..1216716;;cds;;;;;;414;;polyphosphate kinase;*
;;;;;;;;;;;;*
comp;1349719..1350132;;cds;;109;109;;;138;;NAD(P) transhydrogenase subunit alpha;*
comp;1350242..1350608;;23s°;;212;;;;365;;;*
comp;1350821..1350897;;atc;;115;;;;;;;*
comp;1351013..1351438;;16s°;;23;23;;;424;;;*
< comp;1351462..1352160;;cds;;;;;;233;;p-tetratricopeptide repeat protein;*
;;;;;;;;;;;;*
;1359745..1360302;;cds;;176;176;;;186;;hp;*
;1360479..1360555;;gac;+;37;;37;;;;;*
;1360593..1360669;;gac;2 gac;274;274;;;;;;*
;1360944..1361204;;cds;;;;;;87;;hp;*
;;;;;;;;;;;;*
;1416615..1417769;;cds;;214;214;;;385;;glycosyltransferase family 61 protein;*
;1417984..1418074;;tcc;;154;154;;;;;;*
comp;1418229..1419095;;cds;;;;;;289;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
comp;1472421..1473403;;cds;;250;250;;;328;;biotin synthase BioB;*
comp;1473654..1473740;;ttg;;77;77;;;;;;*
comp;1473818..1474678;;cds;;;;;;287;;homocysteine S-methyltransferase family protein;*
;;;;;;;;;;;;*
comp;1735298..1736380;;cds;;209;209;;;361;;DUF262 domain-containing protein;*
;1736590..1736859;;23s°;;72;;;;268;;;*
;1736932..1737046;;5s;;52;;;;113;;;*
;1737099..1737175;;atgf;;93;93;;;;;;*
comp;1737269..1737694;;cds;;;;;;142;;type II toxin-antitoxin system VapC family toxin;*
;;;;;;;;;;;;*
comp;1812365..1813924;;cds;;894;*894;;;520;;peptidoglycan DD-metalloendopeptidase family protein;*
;1814819..1815040;;16s°;;-7;*-7;;;222;;;*
<comp;1815034..1815837;;cds;;80;80;;;268;;p-elongation factor Tu;*
comp;1815918..1815991;;gga;;34;;34;;;;;*
comp;1816026..1816111;;tac;;144;144;;;;;;*
;1816256..1817143;;cds;;;;;;296;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
comp;1833109..1833603;;cds;;83;83;;;165;;MBL fold metallo-hydrolase;*
comp;1833687..1833762;;aag;+;24;;24;;;;;*
comp;1833787..1833862;;aag;2 aag;198;198;;;;;;*
comp;1834061..1835224;;cds;;;;;;388;;rod shape-determining protein RodA;*
;;;;;;;;;;;;*
>;1941413..1943059;;cds;;-30;*-30;;;549;;p-recombinase family protein;*
comp;1943030..1943121;;agc;;160;160;;;;;;*
comp;1943282..1944133;;cds;;;;;;284;;FAD-dependent thymidylate synthase;*
;;;;;;;;;;;;*
comp;2087696..2090938;;cds;;705;*705;;;1081;;PAS domain-containing protein;*
;2091644..2091826;;16s°;;7;7;;;181;;;*
;2091834..2092247;;cds;;;;;;138;;hp;*
;;;;;;;;;;;;*
comp;2095044..2095490;;cds;;48;48;;;149;;hp;*
comp;2095539..2095733;;16s°;;614;*614;;;193;;;*
comp;2096348..2097337;;cds;;;;;;330;;trypsin-like serine protease;*
;;;;;;;;;;;;*
comp;2113248..2114603;;cds;;219;219;;;452;;hp;*
comp;2114823..2114899;;aga;;55;55;;;;;;*
comp;2114955..2115251;;cds;;71;71;;;99;;ETC complex I subunit;*
comp;2115323..2115399;;cca;;261;261;;;;;;*
comp;2115661..2115960;;cds;;;;;;100;;hp;*
;;;;;;;;;;;;*
comp;2144042..2146288;;cds;;308;308;;;749;;HAMP domain-containing protein;*
;2146597..2147256;;23s°;;72;;;;658;;;*
;2147329..2147443;;5s;;52;;;;113;;;*
;2147496..2147572;;atgf;;645;*645;;;;;;*
comp;2148218..2148664;;cds;;;;;;149;;hp;*
;;;;;;;;;;;;*
;2268003..2268461;;cds;;87;87;;;153;;23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH;*
comp;2268549..2268625;;ccg;+;165;;*165;;;;;*
comp;2268791..2268867;;ccg;2 ccg;56;56;;;;;;*
comp;2268924..2269910;;cds;;;;;;329;;farnesyltranstransferase;*
;;;;;;;;;;;;*
comp;2321621..2322145;;cds;;332;332;;;175;;hp;*
;2322478..2322554;;ccc;;225;225;;;;;;*
;2322780..2322974;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;2393295..2396009;;cds;@3;1003;*1003;;;905;;CRISPR-associated helicase/endonuclease Cas3;*
;2397013..2397919;;16s°;;2;2;;;905;;;*
;2397922..2400888;;cds;;;;;;989;;hp;*
;;;;;;;;;;;;*
comp;2517845..2520559;;cds;;229;229;;;905;;phosphoenolpyruvate carboxylase;*
comp;2520789..2520903;;5s;;72;;;;113;;;*
comp;2520976..2521339;;23s°;;189;189;;;362;;;*
comp;2521529..2522152;;cds;;;;;;208;;3-isopropylmalate dehydratase small subunit;*
;;;;;;;;;;;;*
comp;2596508..2596738;;cds;;989;989;;;77;;motility twitching protein PilT;*
comp;2597728..2597815;;tca;;194;194;;;;;;*
;2598010..2599204;;cds;;;;;;398;;hp;*
;;;;;;;;;;;;*
comp;2621435..2622058;;cds;;106;106;;;208;;helix-turn-helix transcriptional regulator;*
comp;2622165..2622251;;ctc;;202;202;;;;;;*
;2622454..2623107;;cds;;;;;;218;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;2631201..2631554;;cds;;192;192;;;118;;hp;*
;2631747..2631822;;gcc;+;70;;70;;;;;*
;2631893..2631968;;gcc;4 gcc;69;;69;;;;;*
;2632038..2632113;;gcc;;57;;57;;;;;*
;2632171..2632246;;gcc;;166;166;;;;;;*
<;2632413..2632965;;cds;;-41;*-41;;;184;;p-IS256 family transposase;*
;2632925..2633473;;cds;;30;30;;;183;;hp;*
comp;2633504..2633579;;aca;;93;93;;;;;;*
comp;2633673..2634200;;cds;;271;271;;;176;;N-acetyltransferase;*
comp;2634472..2634561;;tcg;;155;155;;;;;;*
;2634717..2635742;;cds;;;;;;342;;hp;*
;;;;;;;;;;;;*
comp;2655872..2656489;;cds;;182;182;;;206;;YitT family protein;*
comp;2656672..2656747;;gag;;141;141;;;;;;*
comp;2656889..2657674;;cds;;;;;;262;;MetQ/NlpA family ABC transporter substrate-binding protein;*
;;;;;;;;;;;;*
;2758160..2758312;;cds;;110;110;;;51;;light-harvesting protein;*
comp;2758423..2758509;;tta;;94;94;;;;;;*
comp;2758604..2759899;;cds;;;;;;432;;bifunctional folylpolyglutamate synthase/dihydrofolate synthase;*
;;;;;;;;;;;;*
>;2768823..2769518;;cds;;-12;*-12;;;232;;methyltransferase;*
;2769507..2769776;;23s°;;71;;;;268;;;*
;2769848..2769962;;5s;;118;118;;;113;;;*
comp;2770081..2771016;;cds;;;;;;312;;tetratricopeptide repeat protein;*
;;;;;;;;;;;;*
;2792922..2794778;;cds;;129;129;;;619;;glutathione-regulated potassium-efflux system protein KefB;*
;2794908..2794982;;caa;;92;92;;;;;;*
comp;2795075..2795686;;cds;;;;;;204;;hp;*
;;;;;;;;;;;;*
;2862755..2862982;;cds;;123;123;;;76;;hp;*
;2863106..2863182;;cca;;117;;*117;;;;;*
;2863300..2863374;;atgi;;373;;*373;;;;;*
;2863748..2863823;;gca;;157;;*157;;;;;*
;2863981..2864056;;aca;;15;;;;;;;*
;2864072..2864317;;cds;;8;;;;82;;DUF2829 domain-containing protein;*
;2864326..2864401;;aaa;;250;250;;;;;;*
>;2864652..2865041;;cds;;;;;;130;;p-hp;*
;;;;;;;;;;;;*
;2867066..2868112;;cds;;76;76;;;349;;tyrosine-type recombinase/integrase;*
comp;2868189..2868264;;aaa;;99;99;;;;;;*
comp;2868364..2868870;;cds;;;;;;169;;peptidylprolyl isomerase;*
;;;;;;;;;;;;*
;2893891..2894430;;cds;;25;25;;;180;;phage portal protein;*
;2894456..2894570;;5s;;51;;;;113;;;*
;2894622..2894698;;atgf;;285;285;;;;;;*
;2894984..2895400;;cds;;;;;;139;;p-hp;*
;;;;;;;;;;;;*
comp;3034652..3035092;;cds;;250;250;;;147;;hp;*
comp;3035343..3035418;;aaa;;8;8;;;;;;*
comp;3035427..3035986;;cds;;;;;;187;;DUF2829 domain-containing protein;*
;;;;;;;;;;;;*
comp;3305068..3306534;;cds;;379;*379;;;489;;S8 family serine peptidase;*
comp;3306914..3306989;;ttc;+;29;;29;;;;;*
comp;3307019..3307094;;ttc;4 ttc;34;;34;;;;;*
comp;3307129..3307204;;ttc;;33;;33;;;;;*
comp;3307238..3307313;;ttc;;60;60;;;;;;*
comp;3307374..3308864;;cds;;;;;;497;;RimK family protein;*
;;;;;;;;;;;;*
comp;3332977..3334356;;cds;;54;54;;;460;;type II secretion system protein;*
;3334411..3334487;;cgg;;176;176;;;;;;*
< comp;3334664..3335983;;cds;;;;;;440;;p-hp;*
;;;;;;;;;;;;*
;3408217..3409026;;cds;;91;91;;;270;;hp;*
comp;3409118..3409232;;5s;;71;;;;113;;;*
comp;3409304..3409410;;23s°;;1;*1;;;105;;;*
<;3409412..3409711;;cds;;;;;;100;;p-IS5/IS1182 family transposase;*
;;;;;;;;;;;;*
comp;3456276..3461666;;cds;;387;*387;;;1797;;alpha-2-macroglobulin family protein;*
;3462054..3462130;;agg;;29;29;;;;;;*
;3462160..3462951;;cds;;;;;;264;;amino acid ABC transporter substrate-binding protein;*
;;;;;;;;;;;;*
comp;3500025..3500675;;cds;;210;210;;;217;;protein-L-isoaspartate O-methyltransferase;*
;3500886..3500959;;tgc;+;27;;27;;;;;*
;3500987..3501061;;aac;2 aac;31;;31;;;;;*
;3501093..3501167;;aac;;84;84;;;;;;*
comp;3501252..3501659;;cds;;;;;;136;;hp;*
;;;;;;;;;;;;*
;3639978..3641276;;cds;;172;172;;;433;;outer membrane efflux protein;*
;3641449..3641525;;gcg;+;70;;70;;;;;*
;3641596..3641671;;gcg;3 gcg;33;;33;;;;;*
;3641705..3641780;;gcg;;389;*389;;;;;;*
;3642170..3644392;;cds;;;;;;741;;sigma-54-dependent Fis family transcriptional regulator;*
;;;;;;;;;;;;*
;3651524..3652711;;cds;;55;55;;;396;;aminotransferase;*
;3652767..3652843;;cac;;202;202;;;;;;*
<comp;3653046..3653543;;cds;;;;;;166;;arsenical-resistance protein;*
;;;;;;;;;;;;*
;3710072..3710840;;cds;;126;126;;;256;;TonB family protein;*
comp;3710967..3711042;;gaa;+;214;;*214;;;;;*
comp;3711257..3711332;;gaa;2 gaa;125;125;;;;;;*
comp;3711458..3711664;;cds;;;;;;69;;cold-shock protein;*
;;;;;;;;;;;;*
comp;3727874..3729085;;cds;;828;*828;;;404;;hp;*
;3729914..3730068;;16s°;;87;87;;;153;;;*
;3730156..3730545;;cds;;;;;;130;;hp;*
;;;;;;;;;;;;*
comp;3804728..3805231;;cds;;118;118;;;168;;response regulator;*
comp;3805350..3805425;;gag;;241;241;;;;;;*
comp;3805667..3806140;;cds;;;;;;158;;transcription elongation factor GreA;*
;;;;;;;;;;;;*
;3813820..3815895;;cds;;138;138;;;692;;RNA polymerase sigma factor RpoD;*
;3816034..3816109;;atgi;;94;94;;;;;;*
;3816204..3818993;;cds;;;;;;930;;diguanylate cyclase;*
;;;;;;;;;;;;*
comp;3827982..3828878;;cds;;90;90;;;299;;phosphoserine phosphatase SerB;*
comp;3828969..3829042;;ggg;@5;292;292;;;;;;*
;3829335..3830670;;cds;;;;;;445;;chemotaxis protein;*
;;;;;;;;;;;;*
comp;3832305..3833264;;cds;;311;311;;;320;;complex I NDUFA9 subunit family protein;*
;3833576..3833662;;ctg;+;47;;47;;;;;*
;3833710..3833796;;ctg;5 ctg;153;;*153;;;;;*
;3833950..3834036;;ctg;;48;;48;;;;;*
;3834085..3834171;;ctg;;47;;47;;;;;*
;3834219..3834305;;ctg;;113;113;;;;;;*
;3834419..3835039;;cds;;;;;;207;;ribonuclease D;*

rpm cumuls[modifier | modifier le wikicode]

rpm cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cds 300
avec rRNA;opérons;27;1;0;;1;9;1;;100;20;1;0
;16s°atc23s°;7;20;2;;50;15;40;;200;35;30;0
;16s°gca23s°;1;40;14;;100;30;80;;300;30;60;3
;16s°23s°;1;60;7;;150;24;120;;400;23;90;10
;max a;1;80;3;;200;23;160;;500;14;120;10
;a doubles;0;100;0;;250;16;200;;600;7;150;14
;spéciaux;18;120;1;;300;5;240;;700;2;180;13
;total aas;13;140;0;;350;4;280;;800;3;210;11
sans ;opérons;47;160;2;;400;5;320;;900;0;240;6
;1 aa;30;180;1;;450;2;360;;1000;4;270;9
;max a;5;200;0;;500;0;400;;1100;1;300;9
;a doubles;15;;2;;;14;;;;2;;56
;total aas;79;;32;0;;147;;0;;141;;141
total aas;;92;;;;;;;;;;;
remarques;;5;;;;;;;;;;;
avec jaune;;;moyenne;69;;;194;;;;310;;
;;;variance;75;;;197;;;;248;;
sans jaune;;;moyenne;39;;;147;;;;252;;170
;;;variance;16;;;112;;;;134;;71

rpm blocs[modifier | modifier le wikicode]

rpm blocs protéines[modifier | modifier le wikicode]

23s;23s rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB
3-isop;3-isopropylmalate dehydrogenase
3-isop-sub;3-isopropylmalate dehydratase small subunit
acetyl;acetyl-CoA carboxylase biotin carboxylase subunit
cas3;CRISPR-associated helicase/endonuclease Cas3
CDP;CDP-diacylglycerol--serine O-phosphatidyltransferase
ComF;ComF family protein
CRISPR;CRISPR
DUF262;DUF262 domain-containing protein
FeFe;[FeFe] hydrogenase H-cluster radical SAM maturase HydE
glyco;glycosyltransferase
HAMP;HAMP domain-containing protein
LysM ;LysM peptidoglycan-binding domain-containing protein
methyl;methyltransferase
NAD;NAD(P) transhydrogenase subunit alpha
p-elon;p-elongation factor Tu
p-EscV;p-EscV/YscV/HrcVfamilytypeIIIsecretionsystemexportapparatusprotein
p-glyco;p-glycosyltransferase
P-glyco1;p-glycosyl transferase family 1
p-IS5;p-IS5/IS1182 family transposase
p-tetra;p-tetratricopeptide repeat protein
p-trans;p-transposase
PAS;PAS domain-containing protein
peptido;peptidoglycan DD-metalloendopeptidase family protein
phage;phage portal protein
phospho;phosphoenolpyruvate carboxylase
polypho;polyphosphate kinase
respons;response regulator
SAM;SAM-dependent chlorinase/fluorinase
SEL1;SEL1-like repeat protein
tetra;tetratricopeptide repeat protein
TraY;TraY domain-containing protein
trypsin;trypsin-like serine protease
type II;type II toxin-antitoxin system VapC family toxin
VWA;VWA domain-containing protein
winged ;winged helix-turn-helix domain-containing protein

rpm blocs construits[modifier | modifier le wikicode]

  • Lien tableau: rpm blocs construits
  • Notes: J'ai gardé les symboles de coloration. Il suffit de les rechercher et les remplacer et sans désélectionner colorer comme suite:
    - * jaune, ffff00
    - $ orange, ff6600
    - ? cyan, 66ffff
    - § vert, 99ff33
    - & bleu, 00ccff
    - ( gris, dddddd
    - enlever le gras, et surligne.
rpm blocs;;;;;;;;;;;;;;;;;;
;;9 blocs 16s° solitaires, 6 blocs atc gca;;;;;;;;;;9 blocs 23s°5s, 3 blocs complets;;;;;;
sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait;;sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait
;21325..22362;;cds;586;346;hp;1493;;;comp;13874..15127;;cds;-7;418;hp;1505;
;22949..23237;;*16s°;85;§287;;;;;comp;13628..13880;;*23s°;?72;§251;;;
comp;23323..23490;;cds;;56;hp;;b3;;comp;13441..13555;;$5s;242;§113;;;
;;;;;;;;;;comp <;12458..13198;;cds;;247;p-trans;;b5
<;45496..45768;;cds;553;91;p-glyco1;1383;;;;;;;;;;;
;46322..47040;;*16s°;0;§717;;;;;comp;691078..691773;;cds;4;232;ComF;814;
comp;47041..47433;;cds;;131;winged ;;b4;;;691778..691897;;*23s°;?72;§118;;;
;;;;;;;;;;;691970..692084;;$5s;114;§113;;;
comp;839981..840214;;cds;4;78;hp;492;;;comp;692199..694505;;cds;;769;VWA;;b9
comp;840219..840478;;*16s°;568;§258;;;;;;;;;;;;;
comp;841047..844388;;cds;;1114;&respons;;b7;;;753203..753760;;cds;388;186;hp;1028;
;;;;;;;;;;;752603..752814;;rpr;597;71;CRISPR;;
;1213113..1214459;;cds;210;449;&acetyl;'''1445;;;comp;751747..752005;;*23s°;?72;§257;;;
comp;1214670..1214874;;*16s°;600;§203;;;;;comp;751560..751674;;$5s;161;§113;;;
comp;1215475..1216716;;cds;;414;&polypho;;;;;750262..751398;;cds;;379;&FeFe;;b8
;;;;;;;;;;;;;;;;;;
comp;1812365..1813924;;cds;894;520;&peptido;1026;;;comp;2521529..2522152;;cds;189;208;&3-isop-sub;986;
;1814819..1815040;;*16s°;-7;§222;;;;;comp;2520976..2521339;;*23s°;?72;§362;;;
<comp;1815034..1815837;;cds;;268;p-elon;;b5;;comp;2520789..2520903;;$5s;229;§113;;;
;;;;;;;;;;comp;2517845..2520559;;cds;;905;&phospho;;b7
comp;2087696..2090938;;cds;705;1081;PAS;595;;;;;;;;;;;
;2091644..2091826;;*16s°;7;§181;;;;;>;2768823..2769518;;cds;-12;232;&methyl;964;
;2091834..2092247;;cds;;138;hp;;b9;;;2769507..2769776;;*23s°;?71;§268;;;
;;;;;;;;;;;2769848..2769962;;$5s;118;§113;;;
comp;2095044..2095490;;cds;48;149;hp;640;;;comp;2770081..2771016;;cds;;312;tetra;;b6
comp;2095539..2095733;;*16s°;614;§193;;;;;;;;;;;;;
comp;2096348..2097337;;cds;;330;&trypsin;;b8;;<;3409412..3409711;;cds;1;100;p-IS5;405;
;;;;;;;;;;comp;3409304..3409410;;*23s°;?71;§105;;;
comp;2393295..2396009;;cds;1003;905;&cas3;;;;comp;3409118..3409232;;$5s;91;§113;;;
;2397013..2397919;;*16s°;2;§905;;905;;;;3408217..3409026;;cds;;270;hp;;b4
;2397922..2400888;;cds;;989;hp;;b10;;;;;;;;;;
;;;;;;;;;;comp;467261..468370;;cds;167;370;&3-isop;'''1238;
comp;3727874..3729085;;cds;828;404;hp;1755;;;;468538..468667;;*23s°;?72;§128;;;
;3729914..3730068;;*16s°;87;§153;;;;;;468740..468854;;$5s;?51;§113;;;
;3730156..3730545;;cds;;130;hp;;b2;;;468906..468982;;atgf;125;;;;
;;;;;;;;;;;469108..469863;;cds;;252;&SAM;;
;434306..435142;;cds;512;279;&CDP;;;;;;;;;;;;
;435655..435842;;*16s°;-6;§186;;'''1023;;;comp;1735298..1736380;;cds;209;361;DUF262;1351;
;;;;;;;;;;;1736590..1736859;;*23s°;?72;§268;;;
comp;3322..4194;;cds;30;291;LysM ;;;;;1736932..1737046;;$5s;?52;§113;;;
comp;4225..4821;;*23s°;?196;§595;;1468;;;;1737099..1737175;;atgf;93;;;;
comp;5018..5093;;gca;?182;;;;;;comp;1737269..1737694;;cds;;142;type II;;b10
comp;5276..5684;;*16s°;38;§407;;;;;;;;;;;;;
;5723..6664;;cds;;314;SEL1;;b6;;comp;2144042..2146288;;cds;308;749;HAMP;2905;
;;;;;;;;;;;2146597..2147256;;*23s°;?72;§658;;;
comp;32782..33759;;cds;190;326;&glyco;;;;;2147329..2147443;;$5s;?52;§113;;;
;33950..34357;;*16s°;?112;§406;;;;;;2147496..2147572;;atgf;645;;;;
;34470..34546;;atc;?216;;;;;;comp;2148218..2148664;;cds;;149;hp;;b2
;34763..35591;;*23s°;44;§827;;827;b7;;;;;;;;;;
comp;35636..35750;;$5s;72;§113;;;;;comp;24015..24287;;cds;250;91;TraY;;
comp;35823..38589;;$23s;?215;§2765;;;;;comp;24538..24652;;$5s;?71;§113;;;
comp;38805..38881;;atc;?112;;;;;;comp;24724..27490;;$23s;?212;§2765;;;
comp;38994..40502;;$16s;260;§1507;;;b0;;comp;27703..27779;;atc;?112;;;;
comp;40763..42629;;*23s°;-15;§1865;;1865;b4;;comp;27892..28378;;*16s°;18;§485;;;
;42615..42903;;*16s°;?112;§287;;;;;<>;28397..29119;;cds;;241;p-EscV;;b1
;43016..43092;;atc;?213;;;;;;;;;;;;;;
;43306..44132;;*23s°;-1;§825;;825;b8;;comp;35636..35750;;$5s;?72;§113;;;
comp;44132..44835;;*23s°;-5;§702;;993;;;comp;35823..38589;;$23s;?215;§2765;;;
;44831..45121;;cds;;97;hp;;b5;;comp;38805..38881;;atc;?112;;;;
;;;;;;;;;;comp;38994..40502;;$16s;260;§1507;;;b0
comp;49761..51017;;cds;128;419;&glyco;1331;;;;;;;;;;;
comp;51146..51221;;*23s°;?214;§74;;;;;;434306..435142;;cds;512;279;&CDP;;
comp;51436..51512;;atc;?112;;;;;;;435655..435842;;*16s°;-6;§186;;'''1023;
comp;51625..52017;;*16s°;-7;§391;;;b9;;;435837..436075;;*23s°;?72;§237;;;
;52011..52881;;*23s°;106;§869;;1346;;;;436148..436262;;$5s;?51;§113;;237;
;52988..53464;;cds;-37;159;hp;;;;;436314..436390;;atgf;196;;;;
>;53428..53694;;cds;86;89;p-glyco;;;;;436587..436883;;cds;;99;hp;;b3
comp;53781..54709;;*23s°;26;§927;;1194;b3;;;;;;;;;;
;54736..54898;;*16s°;?112;§161;;;;;;2893891..2894430;;cds;25;180;&phage;;
;55011..55087;;atc;?216;;;697;;;;2894456..2894570;;$5s;?51;§113;;'''540;
;55304..55741;;*23s°;438;§436;;;;;;2894622..2894698;;atgf;285;;;;
;56180..56440;;cds;;87;hp;;b10;;;2894984..2895400;;cds;;139;p-hp;;
;;;Fait: 4 blocs sans aas;;;;;;;;;;;Fait: 5 blocs atc, gca;;;;
sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait;;sens;adresse;;bloc;interca;cdsa;protéine;rRNA°;ordre fait
comp;35636..35750;;$5s;?72;§113;;;b0;;;5723..6664;;cds;;314;SEL1;'''1349;b6
comp;35823..38589;;$23s;?215;§2765;;'''2765;;;comp;5276..5684;;*16s°;38;§407;;;
comp;38805..38881;;atc;?112;;;;;;comp;5018..5093;;gca;?182;;;;
comp;38994..40502;;$16s;260;§1507;;'''1507;;;comp;4225..4821;;*23s°;?196;§595;;;
;;;;;;;;;;comp;3322..4194;;cds;30;291;LysM ;1468;
comp;24015..24287;;cds;250;91;TraY;;b1;;>;2768823..2769518;;cds;-12;(232;&methyl;964;
comp;24538..24652;;$5s;?71;§113;;;;;;2769507..2769776;;*23s°;?71;§268;;;
comp;24724..27490;;$23s;?212;§2765;;'''2765;;;;2769848..2769962;;$5s;118;§113;;;
comp;27703..27779;;atc;?112;;;;;;comp;2770081..2771016;;cds;;312;tetra;'''2432;
comp;27892..28378;;*16s°;18;§485;;'''1208;;;;;;;;;;;
<>;28397..29119;;cds;;241;p-EscV;;;;comp;841047..844388;;cds;;1114;&respons;'''898;b7
;;;;;;;;;;comp;840219..840478;;*16s°;568;§258;;492;
comp;3727874..3729085;;cds;828;404;hp;'''1755;b2;;comp;839981..840214;;cds;4;78;hp;;
;3729914..3730068;;*16s°;87;§153;;<u>1365;;;comp;32782..33759;;cds;190;326;&glyco;;
;3730156..3730545;;cds;;130;hp;;;;;33950..34357;;*16s°;?112;§406;;406;
comp;2144042..2146288;;cds;308;749;HAMP;;;;;34470..34546;;atc;?216;;;;
;2146597..2147256;;*23s°;?72;§658;;;;;;34763..35591;;*23s°;44;§827;;827;
;2147329..2147443;;$5s;?52;§113;;;;;comp;2521529..2522152;;cds;189;(208;&3-isop-sub;986;
;2147496..2147572;;atgf;645;;;;;;comp;2520976..2521339;;*23s°;?72;§362;;;
comp;2148218..2148664;;cds;;149;hp;'''2905;;;comp;2520789..2520903;;$5s;229;§113;;<u>1238;
;;;;;;;;;;comp;2517845..2520559;;cds;;905;&phospho;'''1813;
;21325..22362;;cds;586;346;hp;'''1493;b3;;;;;;;;;;
;22949..23237;;*16s°;85;§287;;<u>1325;;;;;;;;;;;
comp;23323..23490;;cds;;56;hp;;;;comp;2096348..2097337;;cds;;330;&trypsin;'''927;b8
;52011..52881;;*23s°;106;§869;;1346;;;comp;2095539..2095733;;*16s°;614;§193;;640;
;52988..53464;;cds;-37;159;hp;;;;comp;2095044..2095490;;cds;48;149;hp;;
>;53428..53694;;cds;86;89;p-glyco;;;;;42615..42903;;*16s°;?112;§287;;287;
comp;53781..54709;;*23s°;26;§927;;1194;;;;43016..43092;;atc;?213;;;;
;435837..436075;;*23s°;?72;§237;;237;;;;43306..44132;;*23s°;-1;§825;;825;
;436148..436262;;$5s;?51;§113;;;;;;753203..753760;;cds;388;186;hp;;
;436314..436390;;atgf;196;;;;;;;752603..752814;;rpr;597;71;CRISPR;1028;
;436587..436883;;cds;;99;hp;'''2777;;;comp;751747..752005;;*23s°;?72;§257;;;
;;;;;;;;;;comp;751560..751674;;$5s;161;§113;;;
<;45496..45768;;cds;553;91;p-glyco1;'''1383;b4;;;750262..751398;;cds;;379;&FeFe;'''1853;
;46322..47040;;*16s°;0;§717;;;;;;;;;;;;;
comp;47041..47433;;cds;;131;winged ;;;;comp;2087696..2090938;;cds;705;1081;PAS;'''986;b9
comp;40763..42629;;*23s°;-15;§1865;;1865;;;;2091644..2091826;;*16s°;7;§181;;595;
<;3409412..3409711;;cds;1;100;p-IS5;;;;;2091834..2092247;;cds;;138;hp;;
comp;3409304..3409410;;*23s°;?71;§105;;405;;;comp;51625..52017;;*16s°;-7;§391;;391;
comp;3409118..3409232;;$5s;91;§113;;;;;comp;51436..51512;;atc;?112;;;;
;3408217..3409026;;cds;;270;hp;'''2270;;;comp;51146..51221;;*23s°;?214;§74;;;
;;;;;;;;;;comp;49761..51017;;cds;128;(419;&glyco;1331;
comp;1812365..1813924;;cds;894;520;&peptido;;b5;;comp;691078..691773;;cds;4;232;ComF;;
;1814819..1815040;;*16s°;-7;§222;;'''1026;;;;691778..691897;;*23s°;?72;§118;;814;
<comp;1815034..1815837;;cds;;268;p-elon;;;;;691970..692084;;$5s;114;§113;;;
comp;44132..44835;;*23s°;-5;§702;;993;;;comp;692199..694505;;cds;;769;VWA;'''2145;
;44831..45121;;cds;;97;hp;;;;;;;;;;;;
comp;13874..15127;;cds;-7;418;hp;1505;;;comp;2393295..2396009;;cds;1003;905;&cas3;'''1066;b10
comp;13628..13880;;*23s°;?72;§251;;;;;;2397013..2397919;;*16s°;2;§905;;905;
comp;13441..13555;;$5s;242;§113;;;;;;2397922..2400888;;cds;;989;hp;;
comp <;12458..13198;;cds;;247;p-trans;'''2498;;;;54736..54898;;*16s°;?112;§161;;161;
;;;;;;;;;;;55011..55087;;atc;?216;;;;
;;;;;;;;;;;55304..55741;;*23s°;438;§436;;;
;2893891..2894430;;cds;25;180;&phage;;;;;56180..56440;;cds;;87;hp;697;
;2894456..2894570;;$5s;?51;§113;;(540;;;comp;1735298..1736380;;cds;209;361;DUF262;1351;
;2894622..2894698;;atgf;285;;;;;;;1736590..1736859;;*23s°;?72;§268;;;
;2894984..2895400;;cds;;139;p-hp;;;;;1736932..1737046;;$5s;?52;§113;;;
;;;;;;;;;;;1737099..1737175;;atgf;93;;;;
;1213113..1214459;;cds;210;449;&acetyl;(1445;;;comp;1737269..1737694;;cds;;142;type II;'''2048;
comp;1214670..1214874;;*16s°;600;§203;;;;;;;;;;;;;
comp;1215475..1216716;;cds;;414;&polypho;;;;;;;;;;;;
;;;;;;;;;;;434306..435142;;cds;512;279;&CDP;;
comp;467261..468370;;cds;167;370;&3-isop;(1238;;;;435655..435842;;*16s°;-6;§186;;(1023;
;468538..468667;;*23s°;?72;§128;;;;;;435837..436075;;*23s°;?72;§237;;;
;468740..468854;;$5s;?51;§113;;;;;;436148..436262;;$5s;?51;§113;;237;
;468906..468982;;atgf;125;;;;;;;436314..436390;;atgf;196;;;;
;469108..469863;;cds;;252;&SAM;;;;;436587..436883;;cds;;99;hp;;

rpm remarques[modifier | modifier le wikicode]

rpm remarques texte[modifier | modifier le wikicode]
rpm listes[modifier | modifier le wikicode]
alpha codes[modifier | modifier le wikicode]
rpm;25;;;;;95;88;;rru;12;;;;;55;51;;rpl;2;;;;;33;31
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;1;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;4;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;7;acc;3;aac;2;agc;1;;atc;4;acc;2;aac;1;agc;1;;atc;1;acc;1;aac;1;agc;1
ctc;1;ccc;2;cac;2;cgt;3;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;1;ccc;0;cac;1;cgt;1
gtc;2;gcc;4;gac;2;ggc;4;;gtc;1;gcc;2;gac;1;ggc;1;;gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;2;aca;2;aaa;4;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;2;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;2;gaa;2;gga;1;;gta;1;gca;4;gaa;1;gga;1;;gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1;;ttg;1;tcg;1;tag;;tgg;1;;ttg;0;tcg;0;tag;;tgg;1
atg;5/2;acg;1;aag;3;agg;1;;atg;3/1;acg;1;aag;1;agg;1;;atg;1/1;acg;1;aag;0;agg;0
ctg;5;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;0;ccg;0;cag;0;cgg;1
gtg;2;gcg;3;gag;2;ggg;1;;gtg;1;gcg;1;gag;1;ggg;1;;gtg;0;gcg;0;gag;0;ggg;0
;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;
abq;20;;;;;88;83;;oan;11;;;;;61;52;;rtb;2;;;;;33;31
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;8;acc;2;aac;3;agc;1;;atc;4;acc;1;aac;1;agc;1;;atc;1;acc;1;aac;1;agc;1
ctc;2;ccc;1;cac;2;cgt;2;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;1;ccc;0;cac;1;cgt;1
gtc;2;gcc;3;gac;4;ggc;4;;gtc;1;gcc;1;gac;2;ggc;2;;gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;1;;tta;1;tca;1;taa;;tga;
ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;8;gaa;1;gga;1;;gta;1;gca;4;gaa;2;gga;1;;gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;1;tcg;1;tag;;tgg;1;;ttg;0;tcg;0;tag;;tgg;1
atg;3/1;acg;1;aag;2;agg;1;;atg;5/2;acg;1;aag;1;agg;1;;atg;1/1;acg;1;aag;0;agg;0
ctg;3;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;0;ccg;0;cag;0;cgg;1
gtg;2;gcg;2;gag;2;ggg;1;;gtg;1;gcg;0;gag;1;ggg;1;;gtg;0;gcg;0;gag;0;ggg;0
;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;
abs;20;;;;;85;76;;agr;9;;;;;58;51;;aua;12;;;;;55;55
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;1;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1;;ttc;1;tcc;1;tac;1;tgc;1
atc;4;acc;2;aac;3;agc;1;;atc;5;acc;1;aac;1;agc;1;;atc;1;acc;1;aac;2;agc;1
ctc;2;ccc;1;cac;2;cgt;2;;ctc;1;ccc;1;cac;1;cgt;1;;ctc;2;ccc;1;cac;1;cgt;2
gtc;2;gcc;3;gac;4;ggc;4;;gtc;1;gcc;1;gac;2;ggc;2;;gtc;3;gcc;1;gac;2;ggc;2
tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1;;ata;1;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0;;cta;1;cca;1;caa;1;cga;0
gta;1;gca;4;gaa;1;gga;2;;gta;1;gca;5;gaa;2;gga;1;;gta;1;gca;1;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;2;;ttg;1;tcg;1;tag;;tgg;1;;ttg;1;tcg;1;tag;;tgg;1
atg;5/1;acg;1;aag;2;agg;1;;atg;6/1;acg;1;aag;1;agg;0;;atg;4;acg;1;aag;1;agg;1
ctg;3;ccg;2;cag;2;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1;;ctg;1;ccg;1;cag;1;cgg;1
gtg;2;gcg;2;gag;2;ggg;1;;gtg;0;gcg;0;gag;0;ggg;1;;gtg;1;gcg;1;gag;1;ggg;1
gamma codes[modifier | modifier le wikicode]
19/01/20;Paris;;;;;;
gamma;10500;1161;;;;88462;86720
ttt;18;tct;20;tat;15;tgt;2
att;1;act;6;aat;2;agt;0
ctt;11;cct;1;cat;3;cgc;0
gtt;6;gct;0;gat;0;ggt;6
ttc;2,075;tcc;1,795;tac;2,687;tgc;1,345
atc;3,369;acc;1,829;aac;3,679;agc;1,256
ctc;1,204;ccc;1,012;cac;1,369;cgt;3,520
gtc;2,046;gcc;1,973;gac;3,421;ggc;4,151
tta;1,422;tca;1,662;taa;12;tga;762
ata;10;aca;1,666;aaa;4,457;aga;1,784
cta;1,516;cca;1,671;caa;2,239;cga;156
gta;3,798;gca;3,342;gaa;3,829;gga;1,347
ttg;1,214;tcg;984;tag;32;tgg;1,340
atg;7,009;acg;845;aag;282;agg;1,298
ctg;2,977;ccg;729;cag;1,208;cgg;1,182
gtg;98;gcg;82;gag;90;ggg;855
;;;;;;;
indices;;;;;;;
gamma;904;1161;;;;88462;7469
ttt;1.55;tct;1.72;tat;1.29;tgt;0.17
att;0.09;act;0.52;aat;0.17;agt;0
ctt;0.95;cct;0.09;cat;0.26;cgc;0
gtt;0.52;gct;0;gat;0;ggt;0.52
ttc;179;tcc;155;tac;231;tgc;116
atc;290;acc;158;aac;317;agc;108
ctc;104;ccc;87;cac;118;cgt;303
gtc;176;gcc;170;gac;295;ggc;358
tta;122;tca;143;taa;1.03;tga;66
ata;0.86;aca;143;aaa;384;aga;154
cta;131;cca;144;caa;193;cga;13.4
gta;327;gca;288;gaa;330;gga;116
ttg;105;tcg;85;tag;2.76;tgg;115
atg;604;acg;73;aag;24.3;agg;112
ctg;256;ccg;63;cag;104;cgg;102
gtg;8.4;gcg;7.1;gag;7.8;ggg;74

rru[modifier | modifier le wikicode]

rru opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Rhod_rubr_ATCC_11170/rhodRubr_ATCC11170-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_007643.1;rru;;genome;3.8.16;;;;;;;;
64.97%GC;26.12.19 Paris;16s  4 ;55 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Rhodospirillum rubrum ATCC 11170;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
comp;16232..16852;;cds;;163;163;;;207;;3'-5' exonuclease;*
comp;17016..17102;;ctg;;253;253;;;;;;*
;17356..18378;;cds;;;;;;341;;3-beta-hydroxy-delta(5)-steroid dehydrogenase;*
;;;;;;;;;;;;*
;117072..117287;;cds;;37;37;;;72;;slyX;*
comp;117325..117401;;agg;;341;341;;;;;;*
;117743..123022;;cds;;;;;;*1760;;alpha-2-macroglobulin-like protein;*
;;;;;;;;;;;;*
comp;149921..151015;;cds;;225;225;;;365;;hp;*
;151241..151317;;cgg;;136;136;;;;;;*
comp;151454..152929;;cds;;;;;;492;;chemotaxis sensory transducer protein;*
;;;;;;;;;;;;*
;189941..191668;;cds;;859;*859;;;576;;sulfate transporter/antisigma-factor antagonist;*
;192528..194004;;16s;;184;;;;1477;;;*
;194189..194265;;atc;;66;;;66;;;;*
;194332..194407;;gca;;362;;;;;;;*
;194770..197527;;23s;;119;;;;2758;;;*
;197647..197761;;5s;;96;;;;115;;;*
;197858..197934;;atgf;;287;287;;;;;;*
comp;198222..198455;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;305449..306648;;cds;;257;257;;;400;;Ppx/GppA phosphatase;*
;306906..306979;;cag;;319;319;;;;;;*
comp;307299..308303;;cds;;;;;;335;;LacI family transcriptional regulator;*
;;;;;;;;;;;;*
comp;322896..323807;;cds;;292;292;;;304;;hp;*
comp;324100..324174;;caa;;98;98;;;;;;*
comp;324273..325601;;cds;;;;;;443;;chemotaxis sensory transducer protein;*
;;;;;;;;;;;;*
;362552..362881;;cds;;224;224;;;110;;hp;*
;363106..363181;;gcc;+;202;;202;;;;;*
;363384..363459;;gcc;2 gcc;43;43;;;;;;*
comp;363503..364531;;cds;;;;;;343;;esterase;*
;;;;;;;;;;;;*
;407067..407606;;cds;;92;92;;;180;;YbaK/prolyl-tRNA synthetase associated domain-containing protein;*
;407699..407790;;agc;;141;141;;;;;;*
;407932..408774;;cds;;;;;;281;;hp;*
;;;;;;;;;;;;*
;466945..467925;;cds;;115;115;;;327;;hp;*
comp;468041..468126;;tta;;83;83;;;;;;*
comp;468210..468458;;cds;;;;;;83;;hp;*
;;;;;;;;;;;;*
comp;559038..559610;;cds;;86;86;;;191;;OsmC-like protein;*
;559697..559772;;aag;;140;140;;;;;;*
;559913..560608;;cds;;;;;;232;;hp;*
;;;;;;;;;;;;*
comp;794877..795188;;cds;;-81;*-81;;;104;;hp;*
comp;795108..795188;;Sig-pep;;217;217;;;27;;hp;*
;795406..795496;;tcc;;44;44;;;;;;*
;795541..795846;;cds;;;;;;102;;hp;*
;;;;;;;;;;;;*
comp;908584..910185;;cds;;-102;*-102;;;534;;peptidase M23B;*
comp;910084..910185;;Sig-pep;@1;1212;*1212;;;34;;hp;*
;911398..912874;;16s;;182;;;;1477;;;*
;913057..913133;;atc;;66;;;66;;;;*
;913200..913275;;gca;;361;;;;;;;*
;913637..916394;;23s;;118;;;;2758;;;*
;916513..916627;;5s;;95;;;;115;;;*
;916723..916799;;atgf;;573;*573;;;;;;*
;917373..921860;;cds;;;;;;*1496;;hp;*
;;;;;;;;;;;;*
;1159249..1160091;;cds;;71;71;;;281;;Linocin_M18 bacteriocin protein;*
;1160163..1160238;;gag;;117;117;;;;;;*
;1160356..1160613;;cds;;;;;;86;;prevent-host-death protein;*
;;;;;;;;;;;;*
comp;1464820..1465122;;cds;;283;283;;;101;;50S ribosomal protein L21;*
;1465406..1465495;;tcg;;139;139;;;;;;*
comp;1465635..1466303;;cds;;;;;;223;;cytochrome B561;*
;;;;;;;;;;;;*
;1791953..1792159;;cds;;116;116;;;69;;hp;*
comp;1792276..1792351;;gaa;;131;131;;;;;;*
comp;1792483..1792689;;cds;;;;;;69;;cold-shock DNA-binding protein family protein;*
;;;;;;;;;;;;*
;1824302..1825738;;cds;;98;98;;;479;;malonyl-CoA decarboxylase;*
;1825837..1825921;;cta;;102;102;;;;;;*
;1826024..1827415;;cds;;;;;;464;;trigger factor;*
;;;;;;;;;;;;*
;1833133..1833408;;cds;;284;284;;;92;;histone-like DNA-binding protein;*
;1833693..1833768;;gta;;70;70;;;;;;*
comp;1833839..1835326;;cds;;;;;;496;;methyl-accepting chemotaxis sensory transducer;*
;;;;;;;;;;;;*
;1933506..1934138;;cds;;-633;*-633;;;211;;hp;*
;1933506..1933652;;Sig-pep;;571;*571;;;49;;hp;*
;1934224..1934300;;cca;;63;63;;;;;;*
;1934364..1934663;;cds;;12;12;;;100;;ETC complex I subunit region;*
;1934676..1934752;;aga;;396;*396;;;;;;*
;1935149..1939624;;cds;;;;;;*1492;;hp;*
;;;;;;;;;;;;*
;1959133..1959858;;cds;;175;175;;;242;;MerR family transcriptional regulator;*
;1960034..1960110;;ccc;@2;1062;*1062;;;;;;*
;1961173..1961367;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;1996760..1998124;;cds;;-120;*-120;;;455;;lytic murein transglycosylase;*
comp;1998005..1998124;;Sig-pep;;119;119;;;40;;hp;*
;1998244..1998333;;tca;;927;*927;;;;;;*
comp;1999261..1999929;;cds;;;;;;223;;hp;*
;;;;;;;;;;;;*
;2032027..2032863;;cds;;123;123;;;279;;phage integrase;*
comp;2032987..2033062;;aaa;;186;186;;;;;;*
comp;2033249..2033755;;cds;;;;;;169;;peptidyl-prolyl isomerase;*
;;;;;;;;;;;;*
comp;2093327..2093977;;cds;;295;295;;;217;;protein-L-isoaspartate(D-aspartate) O-methyltransferase;*
;2094273..2094346;;tgc;;81;;81;;;;;*
;2094428..2094502;;aac;;150;150;;;;;;*
;2094653..2094916;;cds;;;;;;88;;prevent-host-death protein;*
;;;;;;;;;;;;*
comp;2304404..2305834;;cds;;89;89;;;477;;divalent cation transporter;*
comp;2305924..2306010;;ctc;;178;178;;;;;;*
;2306189..2306839;;cds;;;;;;217;;lipoate-protein ligase B;*
;;;;;;;;;;;;*
;2331183..2331521;;cds;;73;73;;;113;;hp;*
;2331595..2331671;;atgj;;126;126;;;;;;*
comp;2331798..2332040;;cds;;;;;;81;;hp;*
;;;;;;;;;;;;*
comp;2411337..2411804;;cds;;-72;*-72;;;156;;CreA;*
comp;2411733..2411804;;Sig-pep;;202;202;;;24;;hp;*
comp;2412007..2412083;;cac;;75;75;;;;;;*
comp;2412159..2413343;;cds;;;;;;395;;hp;*
;;;;;;;;;;;;*
;2729598..2731271;;cds;;449;*449;;;558;;macrocin-O-methyltransferase;*
comp;2731721..2731797;;atgf;;95;;;;;;;*
comp;2731893..2732007;;5s;;119;;;115;;;;*
comp;2732127..2734884;;23s;;362;;;2758;;;;*
comp;2735247..2735322;;gca;;66;;;66;;;;*
comp;2735389..2735465;;atc;;184;;;;;;;*
comp;2735650..2737126;;16s;;606;*606;;1477;;;;*
comp;2737733..2738110;;cds;;;;;;126;;hp;*
;;;;;;;;;;;;*
comp;2959802..2961874;;cds;;354;*354;;;*691;;chemotaxis sensory transducer protein;*
comp;2962229..2962303;;gtc;;123;123;;;;;;*
;2962427..2963359;;cds;;;;;;311;;N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;3124836..3125033;;cds;;151;151;;;66;;preprotein translocase subunit SecE;*
comp;3125185..3125260;;tgg;;343;343;;;;;;*
comp;3125604..3126794;;cds;;93;93;;;397;;elongation factor Tu;*
comp;3126888..3126961;;gga;;27;;27;;;;;*
comp;3126989..3127074;;tac;;37;37;;;;;;*
;3127112..3128158;;cds;;57;57;;;349;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;3128216..3128291;;aca;;127;127;;;;;;*
;3128419..3128652;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;3193350..3194507;;cds;;430;*430;;;386;;acyltransferase;*
comp;3194938..3195013;;ttc;;103;103;;;;;;*
comp;3195117..3195635;;cds;;;;;;173;;hp;*
;;;;;;;;;;;;*
;3320745..3322115;;cds;;-1371;*-1371;;;457;;virulence protein;*
;3320745..3320816;;Sig-pep;;1389;*1389;;;24;;hp;*
comp;3322206..3322281;;atgi;;60;60;;;;;;*
comp;3322342..3324432;;cds;;;;;;*697;;RNA polymerase sigma factor RpoD;*
;;;;;;;;;;;;*
comp;3377932..3378114;;cds;;140;140;;;61;;hp;*
;3378255..3378329;;acc;+;165;;165;;;;;*
;3378495..3378569;;acc;2 acc;237;237;;;;;;*
;3378807..3379370;;cds;;234;234;;;188;;hp;*
;3379605..3379681;;gac;;77;77;;;;;;*
comp;3379759..3380517;;cds;;;;;;253;;diguanylate phosphodiesterase;*
;;;;;;;;;;;;*
comp;3399207..3399494;;cds;;262;262;;;96;;hp;*
comp;3399757..3399833;;ccg;;56;56;;;;;;*
comp;3399890..3400972;;cds;;;;;;361;;farnesyltranstransferase;*
;;;;;;;;;;;;*
;3490378..3491148;;cds;;84;84;;;257;;2-phosphoglycolate phosphatase;*
;3491233..3491307;;gtg;;407;*407;;;;;;*
;3491715..3492080;;cds;;;;;;122;;hp;*
;;;;;;;;;;;;*
comp;3719367..3719753;;cds;;163;163;;;129;;hp;*
comp;3719917..3719990;;ggg;;95;95;;;;;;*
comp;3720086..3720859;;cds;;;;;;258;;enoyl-ACP reductase;*
;;;;;;;;;;;;*
;3805869..3806813;;cds;;130;130;;;315;;inner-membrane translocator;*
comp;3806944..3807058;;5s;;116;;;;115;;;*
comp;3807175..3809932;;23s;;362;;;;2758;;;*
comp;3810295..3810370;;gca;;66;;;66;;;;*
comp;3810437..3810513;;atc;;184;;;;;;;*
comp;3810698..3812174;;16s;;1227;*1227;;;1477;;;*
;3813402..3814118;;cds;;;;;;239;;transposase;*
;;;;;;;;;;;;*
comp;3824154..3825854;;cds;;76;76;;;567;;phage integrase;*
comp;3825931..3826007;;cgt;;387;*387;;;;;;*
;3826395..3827531;;cds;;;;;;379;;hp;*
;;;;;;;;;;;;*
;4021982..4023163;;cds;;27;27;;;394;;diguanylate phosphodiesterase;*
comp;4023191..4023277;;ttg;;224;224;;;;;;*
;4023502..4023855;;cds;;;;;;118;;hp;*
;;;;;;;;;;;;*
comp;4058818..4059117;;cds;;187;187;;;100;;hp;*
;4059305..4059380;;gcg;;179;179;;;;;;*
comp;4059560..4060126;;cds;;;;;;189;;hp;*
;;;;;;;;;;;;*
comp;4105626..4107317;;cds;;-114;*-114;;;564;;chemotaxis sensory transducer;*
comp;4107204..4107317;;Sig-pep;;721;*721;;;38;;hp;*
comp;4108039..4108113;;acg;;148;148;;;;;;*
;4108262..4108843;;cds;;;;;;194;;D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase;*
;;;;;;;;;;;;*
comp;4261100..4262038;;cds;;269;269;;;313;;thioredoxin-like protein;*
;4262308..4262382;;ggc;;118;118;;;;;;*
;4262501..4263136;;cds;;;;;;212;;lysine exporter protein LysE/YggA;*

rru cumuls[modifier | modifier le wikicode]

rru cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cds 300
avec rRNA;opérons;4;1;;;1;7;1;;100;23;1;0
;16atcgca235;1;20;;;50;6;40;;200;17;30;3
;Id-atgf;3;40;1;;100;19;80;;300;16;60;4
;-;;60;;;150;20;120;;400;17;90;12
;max a;3;80;;4;200;8;160;;500;8;120;10
;a doubles;0;100;1;;250;7;200;;600;5;150;3
;spéciaux;0;120;;;300;9;240;;700;2;180;4
;total aas;11;140;;;350;3;280;;800;0;210;5
sans ;opérons;40;160;;;400;3;320;;900;0;240;8
;1 aa;36;180;1;;450;3;360;;1000;0;270;4
;max a;2;200;;;500;0;400;;1100;0;300;3
;a doubles;2;;1;;;10;;;;3;;35
;total aas;44;;4;4;;95;;0;;91;;91
total aas;;55;;;;;;;;;;;
remarques;;;;;;;;;;;;;
avec jaune;;;moyenne;119;66;;208;;;;292;;
;;;variance;79;0;;333;;;;187;;
sans jaune;;;moyenne;;;;148;;;;237;;140
;;;variance;;;;83;;;;132;;69

rru blocs[modifier | modifier le wikicode]

rru blocs;;;;;;;
cds;859;576;sulfate;cds;606;126;hp
16s;184;1477;;16s;184;1477;
atc;66;;;atc;66;;
gca;362;;;gca;362;;
23s;119;2758;;23s;119;2758;
5s;96;115;;5s;95;115;
atgf;287;;;atgf;449;;
cds;;78;hp;cds;;558;macrocin
;;;;;;;
cds;-102;534;peptidase;;;;
Sig-pep;1212;34;hp;cds;1227;239;transposase
16s;182;1477;;16s;184;1477;
atc;66;;;atc;66;;
gca;361;;;gca;362;;
23s;118;2758;;23s;116;2758;
5s;95;115;;5s;130;115;
atgf;573;;;cds;;315;inner
cds;;1496;hp;;;;
;;;;;;;
sulfate;sulfate transporter/antisigma-factor antagonist;;;;;;
inner;inner-membrane translocator;;;;;;
macrocin;macrocin-O-methyltransferase;;;;;;
peptidase;peptidase M23B;;;;;;

oan[modifier | modifier le wikicode]

oan opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;oan;;genome;;;;;;;;;
56.1%GC;27.12.19 Paris;16s  4 ;61 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Ochrobactrum anthropi ATCC 49188 ;;;;;;;;;;;;
chromosom1;;;;;;;;;;;;
;34057..34446;;cds;;224;224;;;130;;TIGR02300 family protein;*
;34671..34746;;gcc;@1;-40;*-40;;;;;;*
;34707..35480;;cds;;;;;;258;;glutathione S-transferase family protein;*
;;;;;;;;;;;;*
;223549..224394;;cds;;164;164;;;282;;3'(2'),5'-bisphosphate nucleotidase CysQ;*
;224559..224635;;ccg;;109;109;;;;;;*
comp;224745..225806;;cds;;;;;;354;;site-specific integrase;*
;;;;;;;;;;;;*
comp;337757..338197;;cds;;158;158;;;147;;DMT family transporter;*
comp;338356..338431;;ttc;;171;171;;;;;;*
comp;338603..338818;;cds;;;;;;72;;DNA gyrase inhibitor YacG;*
;;;;;;;;;;;;*
comp;344419..344598;;cds;;147;147;;;60;;hp;*
;344746..344820;;acc;;397;397;;;;;;*
;345218..346030;;cds;;;;;;271;;DUF2189 domain-containing protein;*
;;;;;;;;;;;;*
comp;351922..353328;;cds;;167;167;;;469;;deoxyribodipyrimidine photo-lyase;*
comp;353496..353572;;cgt;;159;159;;;;;;*
comp;353732..355285;;cds;;;;;;*518;;HAMP domain-containing histidine kinase;*
;;;;;;;;;;;;*
comp;725472..726479;;cds;;219;219;;;336;;glycosyltransferase family 4 protein;*
;726699..726773;;caa;;61;61;;;;;;*
comp;726835..727413;;cds;;;;;;193;;hp;*
;;;;;;;;;;;;*
comp;934613..934987;;cds;;333;333;;;125;;transposase;*
comp;935321..935397;;agg;;114;114;;;;;;*
comp;935512..936675;;cds;;;;;;388;;amidohydrolase;*
;;;;;;;;;;;;*
;1049919..1051202;;cds;;24;24;;;428;;cystathionine gamma-synthase family protein;*
comp;1051227..1051311;;ttg;@2;593;*593;;;;;;*
comp;1051905..1053539;;cds;;;;;;*545;;phosphoethanolamine transferase;*
;;;;;;;;;;;;*
comp;1081066..1083021;;cds;;998;*998;;;*652;;M23 family metallopeptidase;*
;1084020..1085508;;16s;;268;;;;1489;;;*
;1085777..1085853;;atc;;11;;;11;;;;*
;1085865..1085940;;gca;;39;39;;;;;;*
>comp;1085980..1086168;;cds;@3;38;38;;;63;;P-hp;*
;1086207..1089125;;23s;;186;;;;2919;;;*
;1089312..1089426;;5s;;54;;;;115;;;*
;1089481..1089557;;atgf;;363;363;;;;;;*
;1089921..1090091;;cds;;;;;;57;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
;1096454..1096912;;cds;;7;7;;;153;;hp;*
comp;1096920..1097009;;tcg;;352;352;;;;;;*
;1097362..1097751;;cds;;;;;;130;;50S ribosomal protein L21;*
;;;;;;;;;;;;*
;1311344..1311823;;cds;;211;211;;;160;;hp;*
;1312035..1312109;;gag;;88;88;;;;;;*
;1312198..1312467;;cds;;;;;;90;;hp;*
;;;;;;;;;;;;*
;1344750..1345565;;cds;;677;*677;;;272;;IclR family transcriptional regulator;*
;1346243..1347731;;16s;;268;;;;1489;;;*
;1348000..1348076;;atc;;11;;;11;;;;*
;1348088..1348163;;gca;;39;39;;;;;;*
>comp;1348203..1348391;;cds;;38;38;;;63;;P-hp;*
;1348430..1351348;;23s;;186;;;;2919;;;*
;1351535..1351649;;5s;;54;;;;115;;;*
;1351704..1351780;;atgf;;360;360;;;;;;*
;1352141..1353082;;cds;;;;;;314;;LysR family transcriptional regulator;*
;;;;;;;;;;;;*
;1354558..1355604;;cds;;85;85;;;349;;polysaccharide deacetylase family protein;*
comp;1355690..1355764;;ggc;;136;136;;;;;;*
comp;1355901..1357280;;cds;;;;;;460;;MFS transporter;*
;;;;;;;;;;;;*
comp;1386666..1387982;;cds;;819;*819;;;439;;hp;*
comp;1388802..1388891;;tcc;;374;374;;;;;;*
;1389266..1389589;;cds;;;;;;108;;hp;*
;;;;;;;;;;;;*
comp;1405236..1405859;;cds;;139;139;;;208;;5,6-dimethylbenzimidazole synthase;*
comp;1405999..1406085;;ctg;;146;146;;;;;;*
comp;1406232..1406852;;cds;;;;;;207;;2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;*
;;;;;;;;;;;;*
comp;1604615..1604854;;cds;;26;26;;;80;;hp;*
comp;1604881..1604958;;atgj;;10;10;;;;;;*
comp;1604969..1605214;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
;1639492..1640289;;cds;;-44;*-44;;;266;;hp;*
comp;1640246..1640322;;atgj;;55;55;;;;;;*
;1640378..1640572;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
comp;1778816..1779571;;cds;;385;385;;;252;;SIMPL domain-containing protein;*
;1779957..1780033;;atgi;;265;265;;;;;;*
;1780299..1780844;;cds;;;;;;182;;sigma-70 family RNA polymerase sigma factor;*
;;;;;;;;;;;;*
>;1945985..1946374;;cds;;721;*721;;;130;;P-hp;*
comp;1947096..1947171;;aag;;-38;*-38;;;;;;*
comp;1947134..1947319;;cds;;;;;;62;;hp;*
;;;;;;;;;;;;*
comp;2014813..2015097;;cds;;103;103;;;95;;DUF2218 domain-containing protein;*
comp;2015201..2015275;;gaa;+;146;;146;;;;;*
comp;2015422..2015496;;gaa;2 gaa;200;200;;;;;;*
comp;2015697..2016962;;cds;;;;;;422;;DUF882 domain-containing protein;*
;;;;;;;;;;;;*
comp;2040234..2040453;;cds;;91;91;;;73;;hp;*
;2040545..2040629;;tac;;24;;24;;;;;*
;2040654..2040727;;gga;;6;6;;;;;;*
comp;2040734..2040916;;cds;;-50;*-50;;;61;;hp;*
;2040867..2042042;;cds;;65;65;;;392;;elongation factor Tu;*
;2042108..2042183;;tgg;;420;*420;;;;;;*
;2042604..2042804;;cds;;;;;;67;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
;2168416..2168658;;cds;;28;28;;;81;;PepSY domain-containing protein;*
comp;2168687..2168760;;ggg;;289;289;;;;;;*
;2169050..2169946;;cds;;;;;;299;;lipid kinase;*
;;;;;;;;;;;;*
comp;2244184..2245050;;cds;;112;112;;;289;;mechanosensitive ion channel;*
comp;2245163..2245248;;tta;;200;200;;;;;;*
;2245449..2246705;;cds;;;;;;419;;threonine ammonia-lyase IlvA;*
;;;;;;;;;;;;*
;2267888..2268835;;cds;;305;305;;;316;;patatin family protein;*
;2269141..2269225;;ctc;;66;66;;;;;;*
comp;2269292..2270185;;cds;;;;;;298;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
;2332394..2333530;;cds;;393;393;;;379;;glycosyltransferase family 2 protein;*
comp;2333924..2334000;;cgg;;169;169;;;;;;*
comp;2334170..2335792;;cds;;;;;;*541;;ABC-F family ATP-binding cassette domain-containing protein;*
;;;;;;;;;;;;*
comp;2339396..2340514;;cds;;1650;*1650;;;373;;porin;*
comp;2342165..2342239;;gtg;;178;178;;;;;;*
comp;2342418..2344424;;cds;;;;;;*669;;murein L,D-transpeptidase;*
;;;;;;;;;;;;*
comp;2369668..2370441;;cds;;152;152;;;258;;NAD kinase;*
;2370594..2370669;;aca;;987;*987;;;;;;*
comp;2371657..2372076;;cds;;;;;;140;;SUF system Fe-S cluster assembly protein;*
;;;;;;;;;;;;*
comp;2442729..2443145;;cds;;299;299;;;139;;hp;*
comp;2443445..2443519;;atgf;;70;70;;;;;;*
<comp;2443590..2443799;;cds;;;;;;70;;helix-turn-helix domain-containing protein;*
;;;;;;;;;;;;*
comp;2449947..2451311;;cds;;156;156;;;455;;tyrosine-type recombinase/integrase;*
comp;2451468..2451550;;cta;;236;236;;;;;;*
comp;2451787..2452356;;cds;;;;;;190;;hp;*
;;;;;;;;;;;;*
comp;2548914..2550098;;cds;;513;*513;;;395;;alpha/beta hydrolase;*
comp;2550612..2550688;;gac;+;245;;245;;;;;*
comp;2550934..2551010;;gac;2 gac;328;328;;;;;;*
;2551339..2551956;;cds;;;;;;206;;TetR/AcrR family transcriptional regulator;*
;;;;;;;;;;;;*
;2604616..2605908;;cds;;824;*824;;;431;;FAD-binding oxidoreductase;*
comp;2606733..2606808;;gta;;264;264;;;;;;*
comp;2607073..2607996;;cds;;;;;;308;;sugar kinase;*
;;;;;;;;;;;;*
;2641040..2641360;;cds;;97;97;;;107;;YnfA family protein;*
;2641458..2641534;;ccc;;94;94;;;;;;*
;2641629..2642357;;cds;;;;;;243;;SDR family oxidoreductase;*
;;;;;;;;;;;;*
;2696299..2697183;;cds;;54;54;;;295;;transcriptional regulator GcvA;*
comp;2697238..2697314;;aga;;123;123;;;;;;*
comp;2697438..2697743;;cds;;156;156;;;102;;ETC complex I subunit;*
comp;2697900..2697976;;cca;;186;186;;;;;;*
;2698163..2698309;;cds;;;;;;49;;hp;*
;;;;;;;;;;;;*
comp;2771579..2772697;;cds;;584;*584;;;373;;porin;*
;2773282..2773372;;agc;;203;203;;;;;;*
;2773576..2774643;;cds;;;;;;356;;porin;*
chromosom2;;;;;;;;;;;;*
;149537..151504;;cds;;355;355;;;*656;;selenocysteine-specific translation elongation factor;*
;151860..151955;;tga;;14;14;;;;;;*
comp;151970..152605;;cds;;;;;;212;;lipase;*
;;;;;;;;;;;;*
comp;298403..299422;;cds;;300;300;;;340;;TerC family protein;*
comp;299723..299796;;cag;;361;361;;;;;;*
comp;300158..300460;;cds;;;;;;101;;DUF1127 domain-containing protein;*
;;;;;;;;;;;;*
;455428..456111;;cds;;713;*713;;;228;;FkbM family methyltransferase;*
;456825..458313;;16s;;268;;;;1489;;;*
;458582..458658;;atc;;11;;;11;;;;*
;458670..458745;;gca;;39;39;;;;;;*
>comp;458785..458973;;cds;;38;38;;;63;;P-hp;*
;459012..461930;;23s;;186;;;;2919;;;*
;462117..462231;;5s;;54;;;;115;;;*
;462286..462362;;atgf;;-44;*-44;;;;;;*
comp;462319..463974;;cds;;;;;;*552;;recombinase family protein;*
;;;;;;;;;;;;*
comp;572059..572721;;cds;;545;*545;;;221;;response regulator transcription factor;*
comp;573267..573357;;other;@4;620;*620;;;;;;*
comp;573978..575285;;cds;;;;;;436;;SidA/IucD/PvdA family monooxygenase;*
;;;;;;;;;;;;*
comp;611464..611742;;cds;;88;88;;;93;;hp;*
comp;611831..611905;;ggc;;387;387;;;;;;*
;612293..612814;;cds;;;;;;174;;prolyl-tRNA synthetase associated domain-containing protein;*
;;;;;;;;;;;;*
;991265..991999;;cds;;217;217;;;245;;alpha/beta hydrolase;*
comp;992217..992306;;tca;;323;323;;;;;;*
;992630..992884;;cds;;;;;;85;;DUF2171 domain-containing protein;*
;;;;;;;;;;;;*
comp;1031528..1032946;;cds;;607;*607;;;473;;PepSY domain-containing protein;*
comp;1033554..1033629;;aaa;;327;327;;;;;;*
;1033957..1035651;;cds;;;;;;*565;;membrane protein;*
;;;;;;;;;;;;*
;1067405..1068742;;cds;;131;131;;;446;;DNA polymerase IV;*
;1068874..1068947;;tgc;;739;*739;;;;;;*
;1069687..1069905;;cds;;;;;;73;;hp;*
;;;;;;;;;;;;*
;1081639..1082031;;cds;;103;103;;;131;;hp;*
comp;1082135..1082209;;aac;;168;168;;;;;;*
;1082378..1082653;;cds;;;;;;92;;hp;*
;;;;;;;;;;;;*
comp;1333375..1333587;;cds;;209;209;;;71;;hp;*
comp;1333797..1333873;;cac;;352;352;;;;;;*
;1334226..1337393;;cds;;;;;;*1056;;PAS domain S-box protein;*
;;;;;;;;;;;;*
;1473437..1474405;;cds;;269;269;;;323;;nitronate monooxygenase;*
;1474675..1474750;;acg;;156;156;;;;;;*
>comp;1474907..1475239;;cds;;;;;;111;;DNA adenine methylase;*
;;;;;;;;;;;;*
comp;1597496..1597666;;cds;;363;363;;;57;;LysR family transcriptional regulator;*
comp;1598030..1598106;;atgf;;54;;;;;;;*
comp;1598161..1598275;;5s;;186;;;;115;;;*
comp;1598462..1601380;;23s;;38;38;;;2919;;;*
<;1601419..1601607;;cds;;39;39;;;63;;P-hp;*
comp;1601647..1601722;;gca;;11;;;11;;;;*
comp;1601734..1601810;;atc;;268;;;;;;;*
comp;1602079..1603567;;16s;;743;*743;;;1489;;;*
;1604311..1605192;;cds;;;;;;294;;ATPase;*
;;;;;;;;;;;;*
;1720169..1720531;;cds;;113;113;;;121;;response regulator;*
;1720645..1720719;;gtc;;465;*465;;;;;;*
;1721185..1721838;;cds;;;;;;218;;protein-L-isoaspartate(D-aspartate) O-methyltransferase;*

oan cumuls[modifier | modifier le wikicode]

oan cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;4;1;;4;1;5;1;;100;25;1;0
;16atcgca-cds;4;20;;;50;15;40;;200;20;30;0
;-;;40;1;;100;12;80;;300;21;60;4
;-;;60;;;150;12;120;;400;15;90;18
;max a;3;80;;;200;15;160;;500;11;120;8
;a doubles;0;100;;;250;7;200;;600;5;150;9
;spéciaux;0;120;;;300;6;240;;700;3;180;3
;total aas;12;140;;;350;5;280;;800;0;210;6
sans ;opérons;45;160;1;;400;12;320;;900;0;240;4
;1 aa;42;180;;;450;1;360;;1000;0;270;6
;max a;2;200;;;500;1;400;;1100;1;300;8
;a doubles;2;;1;;;16;;;;0;;35
;total aas;48;;3;4;;107;;0;;101;;101
total aas;;60;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;138;11;;258;;;;256;;
;;;variance;111;0;;268;;;;180;;
sans jaune;;;moyenne;;;;174;;;;218;;150
;;;variance;;;;117;;;;132;;81

oan blocs[modifier | modifier le wikicode]

oan blocs;;;;
Constantes;;;;
cds;;intercal;cdsa;
16s;;268;1489;
atc;;11;;
gca;;39;;
cds;;38;63;P-hp
23s;;186;2919;
5s;;54;115;
atgf;;;;
cds;;;;
Variations;;;;
blocs 16s;;intercal;cdsa;
1084020..1085508;;998;652;M23 family metallopeptidase
;;363;57;LysR family transcriptional regulator
;;;;
1346243..1347731;;677;272;IclR family transcriptional regulator
;;360;314;LysR family transcriptional regulator
;;;;
456825..458313;;713;228;FkbM family methyltransferase
;;-44;552;recombinase family protein
;;;;
1602079..1603567;;743;294;ATPase
;;363;57;LysR family transcriptional regulator

abq[modifier | modifier le wikicode]

abq opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;abq;;genome;;;;;;;;;
68.45%GC;29.12.19 Paris;16s  9 ;88 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Azospirillum brasilense strain Az39;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
;125527..126444;;cds;;127;127;;;306;;restriction endonuclease;*
comp;126572..126647;;gcg;;206;206;;;;;;*
;126854..127138;;cds;;;;;;95;;YggT family protein;*
;;;;;;;;;;;;*
comp;163237..164982;;cds;;175;175;;;582;;hydrogenase maturation nickel metallochaperone HypA;*
;165158..165234;;agg;;59;59;;;;;;*
;165294..166022;;cds;;;;;;243;;SDR family NAD(P)-dependent oxidoreductase;*
;;;;;;;;;;;;*
comp;188235..189860;;cds;;42;42;;;542;;glycosyltransferase;*
comp;189903..189977;;acg;;81;81;;;;;;*
comp;190059..191987;;cds;;;;;;643;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;250833..251111;;cds;;169;169;;;93;;hp;*
comp;251281..251356;;gcc;;141;141;;;;;;*
comp;251498..251893;;cds;;;;;;132;;TIGR02300 family protein;*
;;;;;;;;;;;;*
comp;458142..458459;;cds;;209;209;;;106;;50S ribosomal protein L21;*
;458669..458758;;tcg;;63;63;;;;;;*
comp;458822..459664;;cds;;;;;;281;;alpha/beta hydrolase fold domain-containing protein;*
;;;;;;;;;;;;*
comp;496776..497171;;cds;;162;162;;;132;;cupin domain-containing protein;*
comp;497334..497420;;ttg;;137;137;;;;;;*
;497558..498085;;cds;;;;;;176;;disulfide bond formation protein B;*
;;;;;;;;;;;;*
comp;615937..616350;;cds;;121;121;;;138;;hp;*
comp;616472..616548;;ccg;+;206;;206;;;;;*
comp;616755..616831;;ccg;2 ccg;109;109;;;;;;*
comp;616941..617957;;cds;;;;;;339;;farnesyltranstransferase;*
;;;;;;;;;;;;*
comp;748703..749161;;cds;;38;38;;;153;;hp;*
comp;749200..749275;;aca;;91;91;;;;;;*
comp;749367..750221;;cds;;144;144;;;285;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;750366..750451;;tac;;60;;60;;;;;*
;750512..750585;;gga;;81;81;;;;;;*
;750667..751857;;cds;;153;153;;;397;;elongation factor Tu;*
;752011..752086;;tgg;;69;69;;;;;;*
;752156..752353;;cds;;;;;;66;;preprotein translocase subunit SecE;*
;;;;;;;;;;;;*
comp;794457..795983;;cds;;296;296;;;509;;methyltransferase domain-containing protein;*
;796280..796355;;aag;+;76;;76;;;;;*
;796432..796507;;aag;2 aag;109;109;;;;;;*
comp;796617..797057;;cds;;;;;;147;;MaoC family dehydratase;*
;;;;;;;;;;;;*
;870412..872373;;cds;;159;159;;;654;;RNA polymerase sigma factor RpoD;*
;872533..872608;;atgi;;5;5;;;;;;*
comp;872614..873093;;cds;;134;134;;;160;;GNAT family N-acetyltransferase;*
comp;873228..873304;;cgt;;212;212;;;;;;*
;873517..874023;;cds;;;;;;169;;hp;*
;;;;;;;;;;;;*
;931962..933011;;cds;;68;68;;;350;;low specificity L-threonine aldolase;*
;933080..933155;;gag;+;38;;38;;;;;*
;933194..933269;;gag;2 gag;72;72;;;;;;*
comp;933342..934340;;cds;;;;;;333;;transglycosylase SLT domain-containing protein;*
;;;;;;;;;;;;*
;997881..998357;;cds;;246;246;;;159;;peptidoglycan-associated lipoprotein Pal;*
comp;998604..998678;;acc;;175;175;;;;;;*
comp;998854..1000815;;cds;;;;;;654;;polysaccharide biosynthesis protein;*
;;;;;;;;;;;;*
comp;1164137..1165048;;cds;;159;159;;;304;;DUF3108 domain-containing protein;*
;1165208..1165282;;gtg;+;132;;132;;;;;*
;1165415..1165489;;gtg;2 gtg;231;231;;;;;;*
;1165721..1165885;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
;1242416..1242919;;cds;;85;85;;;168;;MerR family transcriptional regulator;*
;1243005..1243081;;ccc;;139;139;;;;;;*
comp;1243221..1244999;;cds;;;;;;593;;cyclic nucleotide-binding domain-containing protein;*
;;;;;;;;;;;;*
comp;1353398..1353895;;cds;;118;118;;;166;;hp;*
;1354014..1354091;;cca;;49;49;;;;;;*
;1354141..1354437;;cds;;10;10;;;99;;ETC complex I subunit;*
;1354448..1354524;;aga;;443;*443;;;;;;*
;1354968..1355213;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
comp;1370270..1370500;;cds;;196;196;;;77;;hp;*
comp;1370697..1370772;;aac;@2;220;;220;;;;;*
comp;1370993..1371066;;tgc;;218;218;;;;;;*
;1371285..1371941;;cds;;;;;;219;;protein-L-isoaspartate O-methyltransferase;*
;;;;;;;;;;;;*
comp;1427443..1427733;;cds;;236;236;;;97;;YkgJ family cysteine cluster protein;*
comp;1427970..1428085;;5s;;129;;;;116;;;*
comp;1428215..1430967;;23s;;266;;;;2753;;;*
comp;1431234..1431309;;gca;;30;;;30;;;;*
comp;1431340..1431416;;atc;;108;;;;;;;*
comp;1431525..1433015;;16s;;779;*779;;;1491;;;*
;1433795..1437778;;cds;;;;;;1328;;non-ribosomal peptide synthetase;*
;;;;;;;;;;;;*
comp;1576457..1577296;;cds;;243;243;;;280;;aldo/keto reductase;*
comp;1577540..1577615;;gaa;;123;123;;;;;;*
comp;1577739..1579538;;cds;;;;;;600;;single-stranded-DNA-specific exonuclease RecJ;*
;;;;;;;;;;;;*
comp;1723089..1723457;;cds;;344;344;;;123;;NADH-quinone oxidoreductase subunit A;*
comp;1723802..1723878;;gac;;164;;164;;;;;*
comp;1724043..1724117;;gta;;106;106;;;;;;*
comp;1724224..1724496;;cds;;;;;;91;;HU family DNA-binding protein;*
;;;;;;;;;;;;*
comp;1730385..1731719;;cds;;91;91;;;445;;trigger factor;*
comp;1731811..1731895;;cta;;173;173;;;;;;*
comp;1732069..1733634;;cds;;;;;;522;;malonyl-CoA decarboxylase;*
;;;;;;;;;;;;*
comp;1733741..1735207;;cds;;129;129;;;489;;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;*
comp;1735337..1735412;;cac;+;109;;109;;;;;*
comp;1735522..1735597;;cac;2 cac;337;337;;;;;;*
;1735935..1736273;;cds;;;;;;113;;P-II family nitrogen regulator;*
;;;;;;;;;;;;*
;1951126..1951752;;cds;;149;149;;;209;;nitrogen fixation protein NifQ;*
;1951902..1951987;;tac;;74;74;;;;;;*
comp;1952062..1952424;;cds;;;;;;121;;hp;*
;;;;;;;;;;;;*
;1996903..1997244;;cds;;595;*595;;;114;;hp;*
comp;1997840..1997914;;atgj;;131;131;;;;;;*
comp;1998046..1999179;;cds;;;;;;378;;tRNA 2-thiouridine(34) synthase MnmA;*
;;;;;;;;;;;;*
;2086487..2088658;;cds;;156;156;;;724;;malate synthase G;*
comp;2088815..2088889;;gtc;;234;234;;;;;;*
;2089124..2090002;;cds;;;;;;293;;N-formylglutamate amidohydrolase;*
;;;;;;;;;;;;*
comp;2303404..2303880;;cds;;414;*414;;;159;;bacterioferritin;*
comp;2304295..2304377;;tta;;406;*406;;;;;;*
comp;2304784..2305029;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
;2482875..2484518;;cds;;365;*365;;;548;;recombinase family protein;*
comp;2484884..2484974;;tcc;;120;120;;;;;;*
comp;2485095..2485898;;cds;;;;;;268;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;2640759..2641325;;cds;;149;149;;;189;;prolyl-tRNA synthetase associated domain-containing protein;*
;2641475..2641549;;ggc;;688;*688;;;;;;*
;2642238..2642915;;cds;;;;;;226;;dimethylmenaquinone methyltransferase;*
;;;;;;;;;;;;*
comp;2764482..2765567;;cds;;659;*659;;;362;;hp;*
comp;2766227..2766300;;ggg;;35;35;;;;;;*
comp;2766336..2766995;;cds;;;;;;220;;N-acetyltransferase;*
;;;;;;;;;;;;*
;2781933..2783774;;cds;;187;187;;;614;;EAL and GGDEF domain-containing protein;*
comp;2783962..2784077;;5s;;129;;;;116;;;*
comp;2784207..2786959;;23s;;255;;;;2753;;;*
comp;2787215..2787290;;gca;;30;;;30;;;;*
comp;2787321..2787397;;atc;;108;;;;;;;*
comp;2787506..2789006;;16s;;496;*496;;;1501;;;*
comp;2789503..2790207;;cds;;;;;;235;;phosphatase PAP2 family protein;*
;;;;;;;;;;;;*
;2843264..2843443;;cds;;77;77;;;60;;hp;*
comp;2843521..2843597;;cgt;;170;170;;;;;;*
;2843768..2844268;;cds;;;;;;167;;xanthine phosphoribosyltransferase;*
plasmide2;;;;;;;;;;;;*
comp;51090..51836;;cds;;481;*481;;;249;;sigma-70 family RNA polymerase sigma factor;*
comp;52318..52393;;tgg;;363;*363;;;;;;*
;52757..53587;;cds;;;;;;277;;hp;*
;;;;;;;;;;;;*
comp;809229..810019;;cds;;870;*870;;;264;;IS5 family transposase;*
comp;810890..810966;;atgf;;96;;;;;;;*
comp;811063..811178;;5s;;127;;;;116;;;*
comp;811306..814058;;23s;;266;;;;2753;;;*
comp;814325..814400;;gca;;30;;;30;;;;*
comp;814431..814507;;atc;;108;;;;;;;*
comp;814616..816106;;16s;;452;*452;;;1491;;;*
comp;816559..817443;;cds;;;;;;295;;helix-turn-helix domain-containing protein;*
plasmide4;;;;;;;;;;;;*
;196992..199346;;cds;;148;148;;;785;;mechanosensitive ion channel;*
;199495..199581;;ctg;;30;;30;;;;;*
;199612..199687;;gcc;;188;188;;;;;;*
;199876..201333;;cds;;;;;;486;;hp;*
;;;;;;;;;;;;*
;237538..238578;;cds;;92;92;;;347;;response regulator;*
comp;238671..238747;;cgg;;96;96;;;;;;*
comp;238844..239821;;cds;;;;;;326;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;257739..258470;;cds;;125;125;;;244;;lipoyl(octanoyl) transferase LipB;*
;258596..258682;;ctc;;123;123;;;;;;*
comp;258806..259108;;cds;;;;;;101;;STAS domain-containing protein;*
;;;;;;;;;;;;*
comp;399367..400527;;cds;;278;278;;;387;;PQQ-dependent sugar dehydrogenase;*
comp;400806..400921;;5s;;129;;;;116;;;*
comp;401051..403803;;23s;;255;;;;2753;;;*
comp;404059..404134;;gca;;30;;;30;;;;*
comp;404165..404241;;atc;;108;;;;;;;*
comp;404350..405850;;16s;;502;*502;;;1501;;;*
comp;406353..406547;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
;504531..504893;;cds;;82;82;;;121;;response regulator;*
;504976..505051;;aac;;3;;3;;;;;*
;505055..505131;;gac;;4;;4;;;;;*
;505136..505210;;ggc;;102;102;;;;;;*
comp;505313..506080;;cds;;83;83;;;256;;helix-turn-helix transcriptional regulator;*
;506164..506790;;cds;;202;202;;;209;;pyridoxamine 5'-phosphate oxidase;*
comp;506993..507108;;5s;;127;;;;116;;;*
comp;507236..509988;;23s;;266;;;;2753;;;*
comp;510255..510330;;gca;;30;;;30;;;;*
comp;510361..510437;;atc;;110;;;;;;;*
comp;510548..512038;;16s;;615;*615;;;1491;;;*
;512654..513568;;cds;;;;;;305;;lytic transglycosylase domain-containing protein;*
;;;;;;;;;;;;*
comp;588108..590768;;cds;;340;340;;;887;;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;*
;591109..591184;;ttc;;286;286;;;;;;*
;591471..592979;;cds;;;;;;503;;FAD-binding oxidoreductase;*
plasmide5;;;;;;;;;;;;*
;86421..87089;;cds;;455;*455;;;223;;RraA family protein;*
;87545..87619;;ggc;;193;193;;;;;;*
;87813..88865;;cds;;;;;;351;;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);*
plasmide1;;;;@3;;;;;;;;*
>comp;115594..115896;;cds;;394;*394;;;101;;P-IS5/IS1182 family transposase;*
comp;116291..116367;;atgf;;96;;;;;;;*
comp;116464..116579;;5s;;129;;;;116;;;*
comp;116709..119461;;23s;;255;;;;2753;;;*
comp;119717..119792;;gca;;30;;;30;;;;*
comp;119823..119899;;atc;;108;;;;;;;*
comp;120008..121498;;16s;;740;*740;;;1491;;;*
;122239..123597;;cds;;;;;;453;;peptidoglycan DD-metalloendopeptidase family protein;*
;;;;;;;;;;;;*
comp;217550..218176;;cds;;123;123;;;209;;ribonuclease D;*
comp;218300..218386;;ctg;;228;228;;;;;;*
;218615..219604;;cds;;;;;;330;;complex I NDUFA9 subunit family protein;*
;;;;;;;;;;;;*
comp;300477..301733;;cds;;472;*472;;;419;;exonuclease subunit SbcD;*
;302206..303696;;16s;;108;;;;1491;;;*
;303805..303881;;atc;;30;;;30;;;;*
;303912..303987;;gca;;255;;;;;;;*
;304243..306995;;23s;;129;;;;2753;;;*
;307125..307240;;5s;;96;;;;116;;;*
;307337..307413;;atgf;;161;161;;;;;;*
<comp;307575..307805;;cds;;;;;;77;;p-ATP-binding protein;*
;;;;;;;;;;;;*
comp;466493..467710;;cds;;231;231;;;406;;site-specific integrase;*
comp;467942..468031;;tca;;205;205;;;;;;*
comp;468237..468809;;cds;;;;;;191;;hp;*
;;;;;;;;;;;;*
;512242..512790;;cds;;136;136;;;183;;pantetheine-phosphate adenylyltransferase;*
;512927..513002;;aaa;;209;209;;;;;;*
;513212..514036;;cds;;;;;;275;;DUF3618 domain-containing protein;*
;;;;;;;;;;;;*
;931813..933912;;cds;;79;79;;;700;;membrane protein;*
;933992..934066;;caa;;382;*382;;;;;;*
comp;934449..935270;;cds;;;;;;274;;hp;*
;;;;;;;;;;;;*
comp;948715..949743;;cds;;199;199;;;343;;Ppx/GppA family phosphatase;*
;949943..950016;;cag;;246;246;;;;;;*
comp;950263..950829;;cds;;;;;;189;;IS3 family transposase;*
;;;;;;;;;;;;*
>;971260..971532;;cds;;493;*493;;;91;;P-hp;*
comp;972026..972119;;agc;;197;197;;;;;;*
;972317..972550;;cds;;;;;;78;;hp;*
;;;;;;;;;;;;*
comp;1302373..1303350;;cds;;166;166;;;326;;alpha-1,3-fucosyltransferase;*
comp;1303517..1303592;;ttc;;98;98;;;;;;*
comp;1303691..1303876;;cds;;;;;;62;;DNA gyrase inhibitor YacG;*
;;;;;;;;;;;;*
;1349823..1350929;;cds;;145;145;;;369;;GNAT family N-acetyltransferase;*
comp;1351075..1353828;;23s;;262;;;;2754;;;*
comp;1354091..1355591;;16s;@1;676;*676;;;1501;;;*
;1356268..1356726;;cds;;;;;;153;;MarR family transcriptional regulator;*
;;;;;;;;;;;;*
comp;1441708..1443066;;cds;;153;153;;;453;;hp;*
;1443220..1443294;;acc;;1;;1;;;;;*
;1443296..1443371;;gcg;;99;;99;;;;;*
;1443471..1443547;;gac;;44;;44;;;;;*
;1443592..1443666;;gtc;;1;;1;;;;;*
;1443668..1443741;;cag;;137;137;;;;;;*
comp;1443879..1446428;;cds;;;;;;850;;dipeptide ABC transporter ATP-binding protein;*
;;;;;;;;;;;;*
;1566394..1566612;;cds;;193;193;;;73;;hp;*
comp;1566806..1566921;;5s;;128;;;;116;;;*
comp;1567050..1569802;;23s;;254;;;;2753;;;*
comp;1570057..1570132;;gca;;30;;;30;;;;*
comp;1570163..1570239;;atc;;94;;;;;;;*
comp;1570334..1571834;;16s;;444;*444;;;1501;;;*
comp;1572279..1572707;;cds;;;;;;143;;DUF1489 domain-containing protein;*
;;;;;;;;;;;;*
;1723583..1724962;;cds;;94;94;;;460;;hp;*
comp;1725057..1725143;;ctc;;475;*475;;;;;;*
;1725619..1726311;;cds;;;;;;231;;FadR family transcriptional regulator;*
;;;;;;;;;;;;*
;1757680..1760568;;cds;;308;308;;;963;;PAS domain-containing protein;*
;1760877..1760963;;ctg;;29;;29;;;;;*
;1760993..1761068;;gcc;;247;247;;;;;;*
comp;1761316..1761840;;cds;;;;;;175;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;1854042..1855049;;cds;;135;135;;;336;;inorganic phosphate transporter;*
comp;1855185..1855259;;ggc;;243;243;;;;;;*
;1855503..1858685;;cds;;;;;;1061;;AAA family ATPase;*
;;;;;;;;;;;;*
>comp;1883235..1883816;;cds;;210;210;;;194;;P-hp;*
;1884027..1884102;;aac;;4;;4;;;;;*
;1884107..1884183;;gac;;32;32;;;;;;*
comp;1884216..1884821;;cds;;;;;;202;;hp;*

abq cumuls[modifier | modifier le wikicode]

abq cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;cdsa 30-300;
avec rRNA;opérons;9;1;2;;1;0;1;;100;17;1;0
;16atcgca235;5;20;3;;50;7;40;;200;29;30;0
;Id-atgf;3;40;3;8;100;19;80;;300;24;60;2
;16s23s;1;60;2;;150;26;120;;400;18;90;9
;max a;3;80;1;;200;20;160;;500;8;120;11
;a doubles;0;100;1;;250;18;200;;600;8;150;8
;spéciaux;0;120;1;;300;3;240;;700;5;180;11
;total aas;19;140;1;;350;4;280;;800;2;210;9
sans ;opérons;51;160;0;;400;4;320;;900;2;240;6
;1 aa;38;180;1;;450;4;360;;1000;1;270;6
;max a;5;200;0;;500;7;400;;1100;1;300;8
;a doubles;5;;2;;;9;;;;1;;46
;total aas;68;;17;8;;121;;0;;116;;116
total aas;;87;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;72;30;;227;;;;308;;
;;;variance;72;0;;175;;;;230;;
sans jaune;;;moyenne;;;;153;;;;249;;166
;;;variance;;;;74;;;;142;;71

abq blocs[modifier | modifier le wikicode]

abq blocs;;;;;;;;;;;;;;;
bloc;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;
cds;779;1328;non ribosom;496;235;PAP2 fam;502;65;hp;615;305;lytic dom;444;143;DUF1489
$16s;108;§1491;;108;§1501;;108;§1501;;110;1491;;94;§1501;
atc;30;;;30;;;30;;;30;;;30;;
gca;266;;;255;;;255;;;266;;;254;;
$23s;129;§2753;;129;§2753;;129;§2753;;127;2753;;128;§2753;
$5s;236;§116;;187;§116;;278;§116;;202;116;;193;§116;
cds;;97;YkgJ fam;;614;EAL & GGDEF;;387;PQQ;;209;pyridoxamine;;73;hp
;;;;;;;;;;;;;;;
cds;452;295;Hx-t-Hx;740;453;peptido fam;472;419;exo SbcD;;;;;;
$16s;108;§1491;;108;§1491;;108;§1491;;;;;;;
atc;30;;;30;;;30;;;;;;;;
gca;266;;;255;;;255;;;;cds;676;153;MarR fam;
$23s;127;§2753;;129;§2753;;129;§2753;;;$16s;262;§1501;;
$5s;96;§116;;96;§116;;96;§116;;;$23s;145;§2754;;
atgf;870;;;394;;;161;;;;cds;;369;GNAT fam;
cds;;264;IS5 fam;;101;p-IS5/IS1182;;77;p-ATP-bind;;;;;;

abs[modifier | modifier le wikicode]

abs opérons[modifier | modifier le wikicode]

;gtRNAdb;;;;;;;;;;;
;abs;;genome;;;;;;;;;
68.45%GC;10.1.20 Paris;16s  5 ;80 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Azospirillum brasilense strain Sp245;;;;;;;;;;;;
chromosome;;;;;;;;;;;;
comp;16414..16980;;cds;;163;163;;;189;;prolyl-tRNA synthetase associated domain-containing protein;*
;17144..17218;;ggc;;670;*670;;;;;;*
;17889..18566;;cds;;;;;;226;;demethylmenaquinone methyltransferase;*
;;;;;;;;;;;;*
;84790..85017;;cds;;114;114;;;76;;osmotically-inducible lipoprotein B;*
comp;85132..85205;;ggg;;35;35;;;;;;*
comp;85241..85900;;cds;;;;;;220;;N-acetyltransferase;*
;;;;;;;;;;;;*
comp;93530..94258;;cds;;60;60;;;243;;SDR family NAD(P)-dependent oxidoreductase;*
comp;94319..94395;;agg;;175;175;;;;;;*
;94571..96262;;cds;;;;;;564;;hp;*
;;;;;;;;;;;;*
comp;131833..132117;;cds;;206;206;;;95;;YggT family protein;*
;132324..132399;;gcg;;140;140;;;;;;*
comp;132540..133586;;cds;;;;;;349;;DMT family transporter;*
;;;;;;;;;;;;*
comp;483582..484082;;cds;;170;170;;;167;;xanthine phosphoribosyltransferase;*
;484253..484329;;cgt;;77;77;;;;;;*
comp;484407..484586;;cds;;;;;;60;;hp;*
;;;;;;;;;;;;*
;536869..537573;;cds;;495;*495;;;235;;phosphatase PAP2 family protein;*
;538069..539152;;16s’;@1;189;;;;1084;;;*
;539342..540019;;23s°;;127;;;;678;;;*
;540147..540262;;5s;;153;153;;;116;;;*
comp;540416..542290;;cds;;;;;;*625;;GGDEF domain-containing protein;*
;;;;;;;;;;;;*
;600048..601079;;cds;;79;79;;;344;;tyrosine-type recombinase/integrase;*
comp;601159..601233;;acg;;81;81;;;;;;*
comp;601315..603243;;cds;;;;;;*643;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;656242..656520;;cds;;169;169;;;93;;hp;*
comp;656690..656765;;gcc;;141;141;;;;;;*
comp;656907..657305;;cds;;;;;;133;;TIGR02300 family protein;*
;;;;;;;;;;;;*
comp;864141..864458;;cds;;209;209;;;106;;50S ribosomal protein L21;*
;864668..864757;;tcg;;79;79;;;;;;*
comp;864837..865679;;cds;;;;;;281;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
;927651..927896;;cds;;392;*392;;;82;;hp;*
;928289..928371;;tta;;175;175;;;;;;*
;928547..929164;;cds;;;;;;206;;hp;*
;;;;;;;;;;;;*
comp;1148345..1149223;;cds;;234;234;;;293;;N-formylglutamate amidohydrolase;*
;1149458..1149532;;gtc;;106;106;;;;;;*
comp;1149639..1151516;;cds;;;;;;*626;;methyl-accepting chemotaxis protein;*
;;;;;;;;;;;;*
;1243974..1245108;;cds;;131;131;;;378;;tRNA 2-thiouridine(34) synthase MnmA;*
;1245240..1245314;;atgj;;354;*354;;;;;;*
comp;1245669..1246637;;cds;;;;;;323;;NAD(+) diphosphatase;*
;;;;;;;;;;;;*
;1279875..1280237;;cds;;74;74;;;121;;hp;*
comp;1280312..1280397;;tac;;148;148;;;;;;*
comp;1280546..1281172;;cds;;;;;;209;;nitrogen fixation protein NifQ;*
;;;;;;;;;;;;*
comp;1500772..1501110;;cds;;338;338;;;113;;P-II family nitrogen regulator;*
;1501449..1501524;;cac;+;109;;109;;;;;*
;1501634..1501709;;cac;2 cac;129;129;;;;;;*
;1501839..1503305;;cds;;106;106;;;489;;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;*
;1503412..1504977;;cds;;173;173;;;522;;malonyl-CoA decarboxylase;*
;1505151..1505235;;cta;;91;91;;;;;;*
;1505327..1506661;;cds;;;;;;445;;trigger factor;*
;;;;;;;;;;;;*
;1511745..1512017;;cds;;105;105;;;91;;HU family DNA-binding protein;*
;1512123..1512197;;gta;;163;;163;;;;;*
;1512361..1512437;;gac;;344;344;;;;;;*
;1512782..1513150;;cds;;;;;;123;;NADH-quinone oxidoreductase subunit A;*
;;;;;;;;;;;;*
;1657596..1659397;;cds;;123;123;;;*601;;p-single-stranded-DNA-specific exonuclease RecJ;*
;1659521..1659596;;gaa;;234;234;;;;;;*
;1659831..1660671;;cds;;;;;;280;;aldo/keto reductase;*
;;;;;;;;;;;;*
comp;1808199..1808735;;cds;;79;79;;;179;;hp;*
;1808815..1808892;;cca;;49;49;;;;;;*
;1808942..1809238;;cds;;10;10;;;99;;ETC complex I subunit;*
;1809249..1809325;;aga;;442;*442;;;;;;*
;1809768..1810013;;cds;;;;;;82;;hp;*
;;;;;;;;;;;;*
comp;1825075..1825305;;cds;;210;210;;;77;;hp;*
comp;1825516..1825591;;aac;@2;219;;219;;;;;*
comp;1825811..1825884;;tgc;;217;217;;;;;;*
;1826102..1826758;;cds;;;;;;219;;protein-L-isoaspartate O-methyltransferase;*
;;;;;;;;;;;;*
comp;1878424..1878714;;cds;;244;244;;;97;;YkgJ family cysteine cluster protein;*
comp;1878959..1879074;;5s;;123;;;;116;;;*
comp;1879198..1881950;;23s;;272;;;;2753;;;*
comp;1882223..1882298;;gca;;32;;;32;;;;*
comp;1882331..1882407;;atc;;110;;;;;;;*
comp;1882518..1883224;;16s°;;100;100;;;707;;;*
<comp;1883325..1883763;;cds;;;;;;146;;p-erythrose-4-phosphate dehydrogenase;*
;;;;;;;;;;;;*
;1896604..1897080;;cds;;192;192;;;159;;peptidoglycan-associated lipoprotein Pal;*
comp;1897273..1897347;;acc;;162;162;;;;;;*
comp;1897510..1899495;;cds;;;;;;*662;;polysaccharide biosynthesis protein;*
;;;;;;;;;;;;*
comp;2032701..2033588;;cds;;165;165;;;296;;DUF3108 domain-containing protein;*
;2033754..2033828;;gtg;+;132;;132;;;;;*
;2033961..2034035;;gtg;2 gtg;231;231;;;;;;*
;2034267..2034431;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
;2113098..2113601;;cds;;85;85;;;168;;MerR family transcriptional regulator;*
;2113687..2113763;;ccc;;140;140;;;;;;*
comp;2113904..2115682;;cds;;;;;;593;;cyclic nucleotide-binding domain-containing protein;*
;;;;;;;;;;;;*
comp;2163405..2167388;;cds;;775;*775;;;*1328;;non-ribosomal peptide synthetase;*
;2168164..2168552;;16s°;;100;;;;389;;;*
comp;2168653..2169323;;16s°;;522;*522;;;671;;;*
comp;2169846..2170325;;cds;;;;;;160;;DUF2141 domain-containing protein;*
;;;;;;;;;;;;*
;2176963..2177427;;cds;;107;107;;;155;;membrane protein;*
comp;2177535..2177610;;gcc;;30;;30;;;;;*
comp;2177641..2177727;;ctg;;135;135;;;;;;*
comp;2177863..2180208;;cds;;;;;;*782;;mechanosensitive ion channel;*
;;;;;;;;;;;;*
;2233677..2234435;;cds;;92;92;;;253;;hp;*
comp;2234528..2234603;;gag;+;38;;38;;;;;*
comp;2234642..2234717;;gag;2 gag;68;68;;;;;;*
comp;2234786..2235836;;cds;;;;;;350;;p-low specificity L-threonine aldolase;*
;;;;;;;;;;;;*
comp;2293087..2293593;;cds;;211;211;;;169;;hp;*
;2293805..2293881;;cgt;;137;137;;;;;;*
;2294019..2294495;;cds;;5;5;;;159;;GNAT family N-acetyltransferase;*
comp;2294501..2294576;;atgi;;145;145;;;;;;*
comp;2294722..2296683;;cds;;;;;;*654;;RNA polymerase sigma factor RpoD;*
;;;;;;;;;;;;*
;2372946..2373401;;cds;;86;86;;;152;;MaoC family dehydratase;*
comp;2373488..2373563;;aag;+;74;;74;;;;;*
comp;2373638..2373713;;aag;2 aag;309;309;;;;;;*
;2374023..2375549;;cds;;;;;;509;;methyltransferase domain-containing protein;*
;;;;;;;;;;;;*
comp;2418203..2418400;;cds;;69;69;;;66;;preprotein translocase subunit SecE;*
comp;2418470..2418545;;tgg;;152;152;;;;;;*
comp;2418698..2419888;;cds;;81;81;;;397;;elongation factor Tu;*
comp;2419970..2420043;;gga;;60;;60;;;;;*
comp;2420104..2420189;;tac;;144;144;;;;;;*
;2420334..2421188;;cds;;91;91;;;285;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;2421280..2421355;;aca;;137;137;;;;;;*
;2421493..2423187;;cds;;;;;;565;;site-specific integrase;*
;;;;;;;;;;;;*
;2561207..2562223;;cds;;109;109;;;339;;farnesyltranstransferase;*
;2562333..2562409;;ccg;+;205;;205;;;;;*
;2562615..2562691;;ccg;2 ccg;136;136;;;;;;*
;2562828..2563241;;cds;;;;;;138;;hp;*
;;;;;;;;;;;;*
comp;2680406..2680930;;cds;;140;140;;;175;;disulfide bond formation protein B;*
;2681071..2681157;;ttg;;162;162;;;;;;*
;2681320..2681715;;cds;;;;;;132;;cupin domain-containing protein;*
;;;;;;;;;;;;*
;2856509..2858152;;cds;;365;*365;;;548;;recombinase family protein;*
comp;2858518..2858608;;tcc;;118;118;;;;;;*
comp;2858727..2859530;;cds;;;;;;268;;alpha/beta hydrolase;*
plasmide1;;;@3;;;;;;;;;*
;198109..199200;;cds;;84;84;;;364;;tyrosine-type recombinase/integrase;*
comp;199285..199360;;aaa;;135;135;;;;;;*
comp;199496..200044;;cds;;;;;;183;;pantetheine-phosphate adenylyltransferase;*
;;;;;;;;;;;;*
;243776..244348;;cds;;205;205;;;191;;hp;*
;244554..244643;;tca;;143;143;;;;;;*
;244787..245683;;cds;;;;;;299;;diguanylate cyclase;*
;;;;;;;;;;;;*
;338004..339383;;cds;;116;116;;;460;;hp;*
comp;339500..339586;;ctc;;257;257;;;;;;*
comp;339844..340836;;cds;;;;;;331;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
comp;364473..365501;;cds;;200;200;;;343;;Ppx/GppA family phosphatase;*
;365702..365775;;cag;;746;*746;;;;;;*
;366522..367214;;cds;;;;;;231;;FadR family transcriptional regulator;*
;;;;;;;;;;;;*
;474173..477079;;cds;;298;298;;;*969;;PAS domain-containing protein;*
;477378..477464;;ctg;;30;;30;;;;;*
;477495..477570;;gcc;;238;238;;;;;;*
;477809..478123;;cds;;;;;;105;;hp;*
;;;;;;;;;;;;*
;599223..600230;;cds;;245;245;;;336;;inorganic phosphate transporter;*
comp;600476..600550;;ggc;;351;*351;;;;;;*
;600902..602071;;cds;;;;;;390;;adenylate/guanylate cyclase domain-containing protein;*
;;;;;;;;;;;;*
comp;629856..631229;;cds;;154;154;;;458;;tetratricopeptide repeat protein;*
;631384..631458;;acc;;1;;1;;;;;*
;631460..631535;;gcg;;99;;99;;;;;*
;631635..631711;;gac;;35;;35;;;;;*
;631747..631821;;gtc;;1;;1;;;;;*
;631823..631896;;cag;;153;153;;;;;;*
;632050..632259;;cds;;;;;;70;;hp;*
;;;;;;;;;;;;*
>comp;699265..699846;;cds;;210;210;;;194;;P-hp;*
;700057..700132;;aac;;4;;4;;;;;*
;700137..700213;;gac;;32;32;;;;;;*
comp;700246..700851;;cds;;;;;;202;;hp;*
;;;;;;;;;;;;*
;909530..909766;;cds;;153;153;;;79;;hp;*
comp;909920..910035;;5s;;127;;;;116;;;*
comp;910163..912915;;23s;;271;;;;2753;;;*
comp;913187..913262;;gca;;30;;;30;;;;*
comp;913293..913369;;atc;;110;;;;;;;*
comp;913480..914970;;16s;;486;*486;;;1491;;;*
;915457..916713;;cds;;;;;;419;;exonuclease subunit SbcD;*
;;;;;;;;;;;;*
comp;998160..999149;;cds;;229;229;;;330;;complex I NDUFA9 subunit family protein;*
;999379..999465;;ctg;;123;123;;;;;;*
;999589..1000215;;cds;;;;;;209;;ribonuclease D;*
;;;;;;;;;;;;*
comp;1098197..1098655;;cds;;675;*675;;;153;;MarR family transcriptional regulator;*
;1099331..1100821;;16s;;107;;;;1491;;;*
;1100929..1101005;;atc;;31;;;31;;;;*
;1101037..1101112;;gca;;271;;;;;;;*
;1101384..1104136;;23s;;147;147;;;2753;;;*
comp;1104284..1105390;;cds;;;;;;369;;GNAT family N-acetyltransferase;*
;;;;;;;;;;;;*
;1157171..1157356;;cds;;98;98;;;62;;DNA gyrase inhibitor YacG;*
;1157455..1157530;;ttc;;178;178;;;;;;*
;1157709..1158686;;cds;;;;;;326;;alpha-(1,3)-fucosyltransferase;*
;;;;;;;;;;;;*
;1394614..1396740;;cds;;453;*453;;;*709;;PAS domain S-box protein;*
;1397194..1397287;;agc;;52;52;;;;;;*
comp;1397340..1397858;;cds;;;;;;173;;tyrosine-type recombinase/integrase;*
;;;;;;;;;;;;*
;1399009..1399830;;cds;;301;301;;;274;;hp;*
comp;1400132..1400206;;caa;;79;79;;;;;;*
comp;1400286..1402379;;cds;;;;;;*698;;hp;*
;;;;;;;;;;;;*
;1577667..1578095;;cds;;457;*457;;;143;;DUF1489 domain-containing protein;*
;1578553..1580043;;16s;;110;;;;1491;;;*
;1580154..1580230;;atc;;31;;;31;;;;*
;1580262..1580337;;gca;;269;;;;;;;*
;1580607..1581986;;23s°;;100;;;;1380;;;*
;1582087..1582616;;23s°;;123;;;;530;;;*
;1582740..1582855;;5s;;100;;;;116;;;*
;1582956..1583032;;atgf;;706;*706;;;;;;*
;1583739..1585157;;cds;;;;;;473;;pyruvate kinase;*
plasmide2;;;;;;;;;;;;*
;271302..272090;;cds;;529;*529;;;263;;ATP-binding cassette domain-containing protein;*
;272620..272695;;tgg;;480;*480;;;;;;*
;273176..273922;;cds;;;;;;249;;sigma-70 family RNA polymerase sigma factor;*
;;;;;;;;;;;;*
;449562..450338;;cds;;465;*465;;;259;;IclR family transcriptional regulator;*
;450804..452289;;16s;;584;;;;1486;;;*
;452874..453640;;23s°;;128;;;;767;;;*
;453769..453884;;5s;;101;;;;116;;;*
;453986..454062;;atgf;;359;*359;;;;;;*
comp;454422..457751;;cds;;;;;;*1110;;NERD domain-containing protein;*
plasmide4;;;;;;;;;;;;*
>comp;131140..131621;;cds;;193;193;;;161;;p-erythrose-4-phosphate dehydrogenase;*
;131815..131891;;atgf;;202;202;;;;;;*
comp;132094..132276;;cds;;;;;;61;;hp;*
;;;;;;;;;;;;*
comp;197300..198643;;cds;;738;*738;;;448;;peptidoglycan DD-metalloendopeptidase family protein;*
;199382..199953;;16s°;;193;;;;572;;;*
;200147..200223;;atgf;;437;*437;;;;;;*
comp;200661..202571;;cds;;;;;;*637;;PAS domain-containing sensor histidine kinase;*
;;;;;;;;;;;;*
;246777..248687;;cds;;208;208;;;*637;;RNA-directed DNA polymerase;*
comp;248896..248972;;cgg;;96;96;;;;;;*
comp;249069..249983;;cds;;;;;;305;;alpha/beta hydrolase;*
;;;;;;;;;;;;*
;319641..319943;;cds;;134;134;;;101;;STAS domain-containing protein;*
comp;320078..320164;;ctc;;125;125;;;;;;*
;320290..321018;;cds;;;;;;243;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
comp;401067..402227;;cds;;281;281;;;387;;PQQ-dependent sugar dehydrogenase;*
comp;402509..402624;;5s;;129;;;;116;;;*
comp;402754..403402;;23s°;;106;;;;649;;;*
comp;403509..403880;;16s°;;502;*502;;;372;;;*
comp;404383..404577;;cds;;;;;;65;;hp;*
;;;;;;;;;;;;*
;501394..501756;;cds;;95;95;;;121;;response regulator;*
;501852..501927;;aac;;4;;4;;;;;*
;501932..502008;;gac;;4;;4;;;;;*
;502013..502087;;ggc;;102;102;;;;;;*
comp;502190..502957;;cds;;;;;;256;;helix-turn-helix transcriptional regulator;*
;;;;;;;;;;;;*
;503041..503667;;cds;;249;249;;;209;;pyridoxamine 5'-phosphate oxidase;*
comp;503917..504474;;16s°;;547;*547;;;558;;;*
;505022..506005;;cds;;;;;;328;;lytic transglycosylase domain-containing protein;*
;;;;;;;;;;;;*
comp;601019..603679;;cds;;358;*358;;;*887;;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;*
;604038..604113;;ttc;;318;318;;;;;;*
>;604432..605613;;cds;;;;;;394;;site-specific integrase;*
plasmide6;;;;;;;;;;;;*
;88804..89472;;cds;;397;*397;;;223;;RraA family protein;*
;89870..89944;;ggc;;249;249;;;;;;*
;90194..91186;;cds;;;;;;331;;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);*

abs cumuls[modifier | modifier le wikicode]

abs cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;cdsa 30-300;
avec rRNA;opérons;10;1;2;;1;0;1;;100;18;1;0
;16atcgca235;1;20;3;;50;5;40;;200;29;30;0
;Id-23s°-atgf;1;40;4;4;100;22;80;;300;26;60;3
;1623s°5atgf;1;60;1;;150;29;120;;400;20;90;10
;max a;3;80;1;;200;18;160;;500;7;120;9
;a doubles;0;100;1;;250;18;200;;600;6;150;8
;autres;7;120;1;;300;3;240;;700;9;180;13
;total aas;10;140;1;;350;5;280;;800;2;210;9
sans ;opérons;51;160;0;;400;7;320;;900;1;240;6
;1 aa;39;180;1;;450;2;360;;1000;1;270;8
;max a;5;200;0;;500;6;400;;1100;0;300;7
;a doubles;5;;2;;;10;;;;2;;48
;total aas;67;;17;4;;125;;0;;121;;121
total aas;;;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;71;31;;221;;;;308;;
;;;variance;72;1;;168;;;;230;;
sans jaune;;;moyenne;;;;151;;;;242;;166
;;;variance;;;;72;;;;137;;72

abs blocs[modifier | modifier le wikicode]

abs blocs abrégé[modifier | modifier le wikicode]
abs abq;;;
abrégé;nom;;
23s RlmB;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;;*
50s L21;50S ribosomal protein L21;;*
AAA fam;AAA family ATPase;;*
ab hydrolase;alpha/beta hydrolase;;*
ab hydrolase f;alpha/beta hydrolase fold domain-containing protein;;*
AG cyclase;adenylate/guanylate cyclase domain-containing protein;;*
ak reductase;aldo/keto reductase;;*
ATP bind;ATP-binding cassette domain-containing protein;;*
bacteriofer;bacterioferritin;;*
bif CoA;bifunctional acetaldehyde-CoA/alcohol dehydrogenase;;*
bif NAD;bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase;;*
chemotaxis p;methyl-accepting chemotaxis protein;;*
cupin dom;cupin domain-containing protein;;*
cyclicN bind;cyclic nucleotide-binding domain-containing protein;;*
diG cyclase;diguanylate cyclase;;*
dip ABC;dipeptide ABC transporter ATP-binding protein;;*
disulfide;disulfide bond formation protein B;;*
DMT fam;DMT family transporter;;*
DUF1489;DUF1489 domain-containing protein;;*
DUF2141;DUF2141 domain-containing protein;;*
DUF3108;DUF3108 domain-containing protein;;*
DUF3618;DUF3618 domain-containing protein;;*
EAL & GGDEF;EAL and GGDEF domain-containing protein;;*
elonga Tu;elongation factor Tu;;*
ETC complex;ETC complex I subunit;;*
exo SbcD;exonuclease subunit SbcD;;*
FAD bind;FAD-binding oxidoreductase;;*
FadR fam;FadR family transcriptional regulator;;*
farnesyl;farnesyltranstransferase;;*
fucosyl;alpha-1,3-fucosyltransferase;;*
GGDEF dom;GGDEF domain-containing protein;;*
glycosyl;glycosyltransferase;;*
GNAT fam;GNAT family N-acetyltransferase;;*
gyrase YacG;DNA gyrase inhibitor YacG;;*
Hase HypA;hydrogenase maturation nickel metallochaperone HypA;;*
helicas RecQ;DNA helicase RecQ;;*
HU bind;HU family DNA-binding protein;;*
Hx-t-Hx;helix-turn-helix transcriptional regulator;;*
Hx-t-Hx dom;helix-turn-helix domain-containing protein;;*
IclR fam;IclR family transcriptional regulator;;*
inorganic  P;inorganic phosphate transporter;;*
IS3 fam;IS3 family transposase;;*
IS5 fam;IS5 family transposase;;*
L-iso-Asp;protein-L-isoaspartate O-methyltransferase;;*
lipoyl LipB;lipoyl(octanoyl) transferase LipB;;*
low Thr;low specificity L-threonine aldolase;;*
lytic dom;lytic transglycosylase domain-containing protein;;*
malate G;malate synthase G;;*
malonyl CoA;malonyl-CoA decarboxylase;;*
MaoC fam;MaoC family dehydratase;;*
MarR fam;MarR family transcriptional regulator;;*
mecano ion;mechanosensitive ion channel;;*
membrane p;membrane protein;;*
menaquinone;dimethylmenaquinone methyltransferase;;*
MerR fam;MerR family transcriptional regulator;;*
methyl trans;methyltransferase domain-containing protein;;*
N-acetyl trans;N-acetyltransferase;;*
N-formyl Glu;N-formylglutamate amidohydrolase;;*
NAD diP;NAD(+) diphosphatase;;*
NADH-quinone;NADH-quinone oxidoreductase subunit A;;*
NDUFA9;complex I NDUFA9 subunit family protein;;*
NERD dom;NERD domain-containing protein;;*
nitrogen NifQ;nitrogen fixation protein NifQ;;*
non ribosom;non-ribosomal peptide synthetase;;*
osmose LipB;osmotically-inducible lipoprotein B;;*
p-ATP-bind;p-ATP-binding protein;;*
p-erythrose;p-erythrose-4-phosphate dehydrogenase;;*
P-II nitrogen;P-II family nitrogen regulator;;*
p-IS5/IS1182;P-IS5/IS1182 family transposase;;*
p-low Thr;p-low specificity L-threonine aldolase;;*
p-ssDNA exo;p-single-stranded-DNA-specific exonuclease RecJ;;*
pantetheine;pantetheine-phosphate adenylyltransferase;;*
PAP2 fam;phosphatase PAP2 family protein;;*
PAS dom;PAS domain-containing protein;;*
PAS kinase;PAS domain-containing sensor histidine kinase;;*
PAS S-box;PAS domain S-box protein;;*
peptido fam;peptidoglycan DD-metalloendopeptidase family protein;;*
peptido Pal;peptidoglycan-associated lipoprotein Pal;;*
polymerase;RNA-directed DNA polymerase;;*
polysacchard;polysaccharide biosynthesis protein;;*
Ppx/GppA;Ppx/GppA family phosphatase;;*
PQQ;PQQ-dependent sugar dehydrogenase;;*
Prolyl-tRNA;prolyl-tRNA synthetase associated domain-containing protein;;*
pyridoxamine;pyridoxamine 5'-phosphate oxidase;;*
pyruvate kin;pyruvate kinase;;*
recombinase;recombinase family protein;;*
response reg;response regulator;;*
restriction end;restriction endonuclease;;*
ribonucleaseD;ribonuclease D;;*
RraA fam;RraA family protein;;*
SDR fam;SDR family NAD(P)-dependent oxidoreductase;;*
sigma RpoD;RNA polymerase sigma factor RpoD;;*
sigma-70 fam;sigma-70 family RNA polymerase sigma factor;;*
SLT dom;transglycosylase SLT domain-containing protein;;*
ss integrase;site-specific integrase;;*
Ss-DNA;single-stranded-DNA-specific exonuclease RecJ;;*
STAS dom;STAS domain-containing protein;;*
subunit SecE;preprotein translocase subunit SecE;;*
tetratricopep;tetratricopeptide repeat protein;;*
TIGR02300;TIGR02300 family protein;;*
trigger factor;trigger factor;;*
tRNA MnmA;tRNA 2-thiouridine(34) synthase MnmA;;*
Tyr rec/int;tyrosine-type recombinase/integrase;;*
UDP-N-acetyl;UDP-N-acetylglucosamine 4,6-dehydratase (inverting);;*
xanthine;xanthine phosphoribosyltransferase;;*
YggT fam;YggT family protein;;*
YkgJ fam;YkgJ family cysteine cluster protein;;*
abs blocs tableau[modifier | modifier le wikicode]
abs blocs;;;;;;;;;;;
gène;inter;long;abrégé;gène;inter;long;abrégé;gène;inter;long;abrégé
cds;486;419;SbcD;cds;100;146;P-eryt;cds;675;153;MarR
16s;110;1491;;16s°;110;707;;16s;107;1491;
atc;30;;;atc;32;;;atc;31;;
gca;271;;;gca;272;;;gca;271;;
23s;127;2753;;23s;123;2753;;23s;147;2753;
5s;153;116;;5s;244;116;;cds;;369;GNAT
cds;;79;hp;cds;;97;YkgJ;;;;
;;;;;;;;;;;
cds;457;143;DUF1489;;;;;;;;
16s;110;1491;;;;;;;;;
atc;31;;;;;;;;;;
gca;269;;;;;10 cds < 259 sur 20;;;;;
23s°;100;1380;;;;Dont 2 hp + 1 p;;;;;
23s°;123;530;;;;;;;;;
5s;100;116;;;;;;;;;
atgf;706;;;;;;;;;;
cds;;473;pyruvat;;;;;;;;
;;;;;;;;;;;
cds;465;259;IclR;cds;502;65;hp;cds;495;235;PAP2
16s;584;1486;;16s°;106;372;;16s’;189;1084;
23s°;128;767;;23s°;129;649;;23s°;127;678;
5s;101;116;;5s;281;116;;5s;153;116;
atgf;359;;;cds;;387;PQQ;cds;;625;GGDEF
cds;;1110;NERD;;;;;;;;
;;;;;;;;;;;
cds;775;1328;non-rib;cds;738;448;peptido;cds;249;209;pyridox
16s°;100;389;;16s°;193;;;16s°;547;558;
16s°;522;671;;atgf;437;;;cds;;328;lytic
cds;;160;DUF2141;cds;;637;PAS;;;;
abs abq blocs[modifier | modifier le wikicode]
  • Lien tableau: abs abq blocs
  • Note: attention pour les couleurs de & (EAL & GDDEF) et de ? (d'où?) 3 fois
;gtRNAdb;;;;;;;;;;gtRNAdb;;;;;
;abs;genome;;;;;;;;;abq;genome;;;;
68.45%GC;10.1.20 Paris;80 aas;intercalaires;cdsa;protéines;;;;;68.45%GC;29.12.19 Paris;88 aas;intercalaires;cdsa;protéines;
Azospirillum brasilense strain Sp245;;;;;;;;;;Azospirillum brasilense strain Az39;;;;;;
chromosome;;;;;;;;;;chromosome;;;;;;
;2856509..2858152;cds;365;548;recombinase;*    CHA1;;*  comp;;;2482875..2484518;cds;365;548;recombinase;*    CHA1
comp;2858518..2858608;tcc;118;;;*;;*  hp caracter;;comp;2484884..2484974;tcc;120;;;*
comp;2858727..2859530;cds;;268;ab hydrolase;* ;;*  modif;;comp;2485095..2485898;cds;;268;ab hydrolase;*
;;;;;;;;*  déplacé;;;;;;;;*
comp;16414..16980;cds;163;189;Prolyl-tRNA;*   ;;*   d’où?;;comp;2640759..2641325;cds;149;189;Prolyl-tRNA;*
;17144..17218;ggc;670;;;*;;*   recomb;;;2641475..2641549;ggc;688;;;*
;17889..18566;cds;;226;menaquinone;*;;*  insertion;;;2642238..2642915;cds;;226;menaquinone;*
;;;;;;*;;*  bloc?;;;;;;;;*
;84790..85017;cds;114;76;@osmose LipB;*  comp;;*  réunion;;comp;2764482..2765567;cds;659;362;@hp;*
comp;85132..85205;ggg;35;;;*;;*  recombi;;comp;2766227..2766300;ggg;35;;;*
comp;85241..85900;cds;;220;N-acetyl trans;*;;;;comp;2766336..2766995;cds;;220;N-acetyl trans;*
;;;;;;;;;;;;;;;;
comp;93530..94258;cds;60;243;SDR fam;*  CHA;;;;;2781933..2783774;cds;187;614;EAL & GGDEF;*    CHA
comp;94319..94395;agg;175;;;*;;;;comp;2783962..2784077;$5s;129;§116;;*
;94571..96262;cds;;564;@hp;*  hp caracter;;;;comp;2784207..2786959;$23s;255;§2753;;*
;;;;;;*;;;;comp;2787215..2787290;gca;30;;;*
comp;131833..132117;cds;206;95;YggT fam;*;;;;comp;2787321..2787397;atc;108;;;*
;132324..132399;gcg;140;;;*;;;;comp;2787506..2789006;$16s;496;§1501;;*
comp;132540..133586;cds;;349;@DMT fam;*  modif;;;;comp;2789503..2790207;cds;;235;PAP2 fam;*
;;;;;;*;;;;;;;;;;*
comp;483582..484082;cds;170;167;xanthine;*;;;;;2843264..2843443;cds;77;60;hp;*
;484253..484329;cgt;77;;;*;;;;comp;2843521..2843597;cgt;170;;;*
comp;484407..484586;cds;;60;hp;*;;;;;2843768..2844268;cds;;167;xanthine;*
;;;;;;*;;;;;;;;;;
;536869..537573;cds;495;235;PAP2 fam;*;;;;;125527..126444;cds;127;306;@restriction end;*    
;538069..539152;?16s’;189;§1084;;*;;;;comp;126572..126647;gcg;206;;;*
;539342..540019;&23s°;127;§678;;*;;;;;126854..127138;cds;;95;YggT fam;*
;540147..540262;$5s;153;§116;;*;;;;;;;;;;*
comp;540416..542290;cds;;625;GGDEF dom;*;;;;comp;163237..164982;cds;175;582;@Hase HypA;*
;;;;;;;;;;;165158..165234;agg;59;;;*
;;;;;;;;;;;165294..166022;cds;;243;SDR fam;*
;;;;;;;;;;;;;;;;
;600048..601079;cds;79;344;@Tyr rec/int;*    comp;;;;comp;188235..189860;cds;42;542;@glycosyl;*    CHB
comp;601159..601233;acg;81;;;*;;;;comp;189903..189977;acg;81;;;*
comp;601315..603243;cds;;643;helicas RecQ;*;;;;comp;190059..191987;cds;;643;helicas RecQ;*
;;;;;;*  CHB;;;;;;;;;;*
comp;656242..656520;cds;169;93;hp;*;;;;comp;250833..251111;cds;169;93;hp;*
comp;656690..656765;gcc;141;;;*;;;;comp;251281..251356;gcc;141;;;*
comp;656907..657305;cds;;133;TIGR02300;*;;;;comp;251498..251893;cds;;132;TIGR02300;*
;;;;;;*;;;;;;;;;;*
comp;864141..864458;cds;209;106;50s L21;*;;;;comp;458142..458459;cds;209;106;50s L21;*
;864668..864757;tcg;79;;;*;;;;;458669..458758;tcg;63;;;*
comp;864837..865679;cds;;281;ab hydrolase;*;;;;comp;458822..459664;cds;;281;ab hydrolase f;*
;;;;;;;;;;;;;;;;
;2233677..2234435;cds;92;253;@hp;*    recomb;;;;comp;496776..497171;cds;162;132;cupin dom;*    CHC
comp;2234528..2234603;?gag;38;;;*;;;;comp;497334..497420;ttg;137;;;*
comp;2234642..2234717;?gag;68;;;*;;;;;497558..498085;cds;;176;disulfide;*
comp;2234786..2235836;cds;;350;@p-low Thr;*  modif;;;;;;;;;;*
;;;;;;*;;;;comp;615937..616350;cds;121;138;hp;*
comp;2293087..2293593;cds;211;169;hp;*  CHC;;;;comp;616472..616548;?ccg;206;;;*
;2293805..2293881;cgt;137;;;*;;;;comp;616755..616831;?ccg;109;;;*
;2294019..2294495;cds;5;159;GNAT fam;*;;;;comp;616941..617957;cds;;339;farnesyl;*
comp;2294501..2294576;atgi;145;;;*;;;;;;;;;;*
comp;2294722..2296683;cds;;654;sigma RpoD;*;;;;comp;748703..749161;cds;38;153;@hp;*
;;;;;;*;;;;comp;749200..749275;aca;91;;;*
;2372946..2373401;cds;86;152;MaoC fam;*;;;;comp;749367..750221;cds;144;285;23s RlmB;*
comp;2373488..2373563;?aag;74;;;*;;;;;750366..750451;tac;60;;;*
comp;2373638..2373713;?aag;309;;;*;;;;;750512..750585;gga;81;;;*
;2374023..2375549;cds;;509;methyl trans;*;;;;;750667..751857;cds;153;397;elonga Tu;*
;;;;;;*;;;;;752011..752086;tgg;69;;;*
comp;2418203..2418400;cds;69;66;subunit SecE;*;;;;;752156..752353;cds;;66;subunit SecE;*
comp;2418470..2418545;tgg;152;;;*;;;;;;;;;;*
comp;2418698..2419888;cds;81;397;elonga Tu;*;;;;comp;794457..795983;cds;296;509;methyl trans;*
comp;2419970..2420043;gga;60;;;*;;;;;796280..796355;?aag;76;;;*
comp;2420104..2420189;tac;144;;;*;;;;;796432..796507;?aag;109;;;*
;2420334..2421188;cds;91;285;23s RlmB;*;;;;comp;796617..797057;cds;;147;MaoC fam;*
;2421280..2421355;aca;137;;;*;;;;;;;;;;*
;2421493..2423187;cds;;565;@ss integrase;*    recombi;;;;;870412..872373;cds;159;654;sigma RpoD;*
;;;;;;*;;;;;872533..872608;atgi;5;;;*
;2561207..2562223;cds;109;339;farnesyl;*;;;;comp;872614..873093;cds;134;160;GNAT fam;*
;2562333..2562409;?ccg;205;;;*;;;;comp;873228..873304;cgt;212;;;*
;2562615..2562691;?ccg;136;;;*;;;;;873517..874023;cds;;169;hp;*
;2562828..2563241;cds;;138;hp;*;;;;;;;;;;*
;;;;;;*;;;;;931962..933011;cds;68;350;@low Thr;*
comp;2680406..2680930;cds;140;175;disulfide;*;;;;;933080..933155;?gag;38;;;*
;2681071..2681157;ttg;162;;;*;;;;;933194..933269;?gag;72;;;*
;2681320..2681715;cds;;132;cupin dom;*;;;;comp;933342..934340;cds;;333;@SLT dom;*
;;;;;;*;;;;;;;;;;
;1896604..1897080;cds;192;159;peptido Pal;*    CHD;;;;;997881..998357;cds;246;159;peptido Pal;*    CHD
comp;1897273..1897347;acc;162;;;*;;;;comp;998604..998678;acc;175;;;*
comp;1897510..1899495;cds;;662;polysacchard;*;;;;comp;998854..1000815;cds;;654;polysacchard;*
;;;;;;*;;;;;;;;;;*
comp;2032701..2033588;cds;165;296;DUF3108;*;;;;comp;1164137..1165048;cds;159;304;DUF3108;*
;2033754..2033828;?gtg;132;;;*;;;;;1165208..1165282;?gtg;132;;;*
;2033961..2034035;?gtg;231;;;*;;;;;1165415..1165489;?gtg;231;;;*
;2034267..2034431;cds;;55;hp;*;;;;;1165721..1165885;cds;;55;hp;*
;;;;;;*;;;;;;;;;;*
;2113098..2113601;cds;85;168;MerR fam;*;;;;;1242416..1242919;cds;85;168;MerR fam;*
;2113687..2113763;ccc;140;;;*;;;;;1243005..1243081;ccc;139;;;*
comp;2113904..2115682;cds;;593;cyclicN bind;*;;;;comp;1243221..1244999;cds;;593;cyclicN bind;*
;;;;;;;;;;;;;;;;*
comp;1808199..1808735;cds;79;179;hp;*    CHE;;;;comp;1353398..1353895;cds;118;166;hp;*    CHE
;1808815..1808892;cca;49;;;*;;;;;1354014..1354091;cca;49;;;*
;1808942..1809238;cds;10;99;ETC complex;*;;;;;1354141..1354437;cds;10;99;ETC complex;*
;1809249..1809325;aga;442;;;*;;;;;1354448..1354524;aga;443;;;*
;1809768..1810013;cds;;82;hp;*;;;;;1354968..1355213;cds;;82;hp;*
;;;;;;*;;;;;;;;;;*
comp;1825075..1825305;cds;210;77;hp;*;;;;comp;1370270..1370500;cds;196;77;hp;*
comp;1825516..1825591;aac;219;;;*;;;;comp;1370697..1370772;aac;220;;;*
comp;1825811..1825884;tgc;217;;;*;;;;comp;1370993..1371066;tgc;218;;;*
;1826102..1826758;cds;;219;L-iso-Asp;*;;;;;1371285..1371941;cds;;219;L-iso-Asp;*
;;;;;;*;;;;;;;;;;*
comp;1878424..1878714;cds;244;97;YkgJ fam;*;;;;comp;1427443..1427733;cds;236;97;YkgJ fam;*
comp;1878959..1879074;$5s;123;§116;;*;;;;comp;1427970..1428085;$5s;129;§116;;*
comp;1879198..1881950;$23s;272;§2753;;*;;;;comp;1428215..1430967;$23s;266;§2753;;*
comp;1882223..1882298;gca;32;;;*;;;;comp;1431234..1431309;gca;30;;;*
comp;1882331..1882407;atc;110;;;*;;;;comp;1431340..1431416;atc;108;;;*
comp;1882518..1883224;&16s°;100;§707;;*;;;;comp;1431525..1433015;$16s;779;§1491;;*
<comp;1883325..1883763;cds;;146;@p-erythrose;*  comp;;;;;1433795..1437778;cds;;1328;@non ribosom;*
;;;;;;;;;;;;;;;;
comp;2163405..2167388;cds;775;1328;@non ribosom;*  déplacé;;;;;;;;;;
;2168164..2168552;&16s°;100;§389;;*;;;;;;;;;;
comp;2168653..2169323;&16s°;522;§671;;*     d’où?;;;;;;;;;;
comp;2169846..2170325;cds;;160;DUF2141;*;;;;;;;;;;
;;;;;;;;;;;;;;;;
;927651..927896;cds;392;82;hp;*    CHF;;;;comp;1576457..1577296;cds;243;280;ak reductase;*    CHF
;928289..928371;tta;175;;;*;;;;comp;1577540..1577615;gaa;123;;;*
;928547..929164;cds;;206;@hp;*   recombi;;;;comp;1577739..1579538;cds;;600;ss-DNA;*
;;;;;;*;;;;;;;;;;*
comp;1148345..1149223;cds;234;293;N-formyl Glu;*;;;;comp;1723089..1723457;cds;344;123;NADH-quinone;*
;1149458..1149532;gtc;106;;;*;;;;comp;1723802..1723878;gac;164;;;*
comp;1149639..1151516;cds;;626;@chemotaxis p;*    modif;;;;comp;1724043..1724117;gta;106;;;*
;;;;;;*;;;;comp;1724224..1724496;cds;;91;HU bind;*
;1243974..1245108;cds;131;378;tRNA MnmA;*;;;;;;;;;;*
;1245240..1245314;atgj;354;;;*;;;;comp;1730385..1731719;cds;91;445;trigger factor;*
comp;1245669..1246637;cds;;323;@NAD diP;*   recombi;;;;comp;1731811..1731895;cta;173;;;*
;;;;;;*;;;;comp;1732069..1733634;cds;106;522;malonyl CoA;*
;1279875..1280237;cds;74;121;hp;*;;;;comp;1733741..1735207;cds;129;489;bif NAD;*
comp;1280312..1280397;tac;148;;;*;;;;comp;1735337..1735412;?cac;109;;;*
comp;1280546..1281172;cds;;209;nitrogen NifQ;*;;;;comp;1735522..1735597;?cac;337;;;*
;;;;;;*;;;;;1735935..1736273;cds;;113;P-II nitrogen;*
comp;1500772..1501110;cds;338;113;P-II nitrogen;*;;;;;;;;;;*
;1501449..1501524;?cac;109;;;*;;;;;1951126..1951752;cds;149;209;nitrogen NifQ;*
;1501634..1501709;?cac;129;;;*;;;;;1951902..1951987;tac;74;;;*
;1501839..1503305;cds;106;489;bif NAD;*;;;;comp;1952062..1952424;cds;;121;hp;*
;1503412..1504977;cds;173;522;malonyl CoA;*;;;;;;;;;;*
;1505151..1505235;cta;91;;;*;;;;;1996903..1997244;cds;595;114;@hp;*
;1505327..1506661;cds;;445;trigger factor;*;;;;comp;1997840..1997914;atgj;131;;;*
;;;;;;*;;;;comp;1998046..1999179;cds;;378;tRNA MnmA;*
;1511745..1512017;cds;105;91;HU bind;*;;;;;;;;;;*
;1512123..1512197;gta;163;;;*;;;;;2086487..2088658;cds;156;724;@malate G;*
;1512361..1512437;gac;344;;;*;;;;comp;2088815..2088889;gtc;234;;;*
;1512782..1513150;cds;;123;NADH-quinone;*;;;;;2089124..2090002;cds;;293;N-formyl Glu;*
;;;;;;*;;;;;;;;;;*
;1657596..1659397;cds;123;601;p-ssDNA exo;*;;;;comp;2303404..2303880;cds;414;159;@bacteriofer;*
;1659521..1659596;gaa;234;;;*;;;;comp;2304295..2304377;tta;406;;;*
;1659831..1660671;cds;;280;ak reductase;*;;;;comp;2304784..2305029;cds;;82;hp;*
plasmide1;;;;;;;;;;plasmide1;;;;;;
comp;197300..198643;cds;738;448;peptido fam;*   PL4;;;;>comp;115594..115896;cds;394;101;@p-IS5/IS1182;*   PL1A
;199382..199953;&16s°;193;§572;;*   déplacé;;;;comp;116291..116367;atgf;96;;;*
;200147..200223;atgf;437;;;*;;;;comp;116464..116579;$5s;129;§116;;*
comp;200661..202571;cds;;637;@PAS kinase;*  déplacé;;;;comp;116709..119461;$23s;255;§2753;;* 
;;;;;;;;;;comp;119717..119792;gca;30;;;*
;;;;;;;;;;comp;119823..119899;atc;108;;;*
;;;;;;;;;;comp;120008..121498;$16s;740;§1491;;*
;;;;;;;;;;;122239..123597;cds;;453;peptido fam;*
;;;;;;;;;;;;;;;;
;909530..909766;cds;153;79;@hp;*hp caracter;;;;comp;217550..218176;cds;123;209;ribonucleaseD;*   PL1B
comp;909920..910035;$5s;127;§116;;*;;;;comp;218300..218386;ctg;228;;;*
comp;910163..912915;$23s;271;§2753;;*;;;;;218615..219604;cds;;330;NDUFA9;*
comp;913187..913262;gca;30;;;*    PL1B;;;;;;;;;;*
comp;913293..913369;atc;110;;;*;;;;comp;300477..301733;cds;472;419;exo SbcD;*
comp;913480..914970;$16s;486;§1491;;*;;;;;302206..303696;$16s;108;§1491;;*
;915457..916713;cds;;419;exo SbcD;*;;;;;303805..303881;atc;30;;;*
;;;;;;*;;;;;303912..303987;gca;255;;;*
comp;998160..999149;cds;229;330;NDUFA9;*;;;;;304243..306995;$23s;129;§2753;;*
;999379..999465;ctg;123;;;*;;;;;307125..307240;$5s;96;§116;;*
;999589..1000215;cds;;209;ribonucleaseD;*;;;;;307337..307413;atgf;161;;;*
;;;;;;;;;;<comp;307575..307805;cds;;77;@p-ATP-bind;*
;;;;;;;;;;;;;;;;
;198109..199200;cds;84;364;@Tyr rec/int;*   comp;;;;comp;466493..467710;cds;231;406;@ss integrase;*   PL1C
comp;199285..199360;aaa;135;;;*;;;;comp;467942..468031;tca;205;;;*
comp;199496..200044;cds;;183;pantetheine;*    PL1C;;;;comp;468237..468809;cds;;191;hp;*
;;;;;;*;;;;;;;;;;*
;243776..244348;cds;205;191;hp;*;;;;;512242..512790;cds;136;183;pantetheine;*
;244554..244643;tca;143;;;*;;;;;512927..513002;aaa;209;;;*
;244787..245683;cds;;299;@diG cyclase;*   recomb;;;;;513212..514036;cds;;275;@DUF3618;*
;;;;;;;;;;;;;;;;*
;1399009..1399830;cds;301;274;hp;*   PL1D;;;;;931813..933912;cds;79;700;@membrane p;*   PL1D
comp;1400132..1400206;caa;79;;;*;;;;;933992..934066;caa;382;;;*
comp;1400286..1402379;cds;;698;@hp;*hp caracter;;;;comp;934449..935270;cds;;274;hp;*
;;;;;;;;;;;;;;;;*
comp;364473..365501;cds;200;343;Ppx/GppA;*   PL1E;;;;comp;948715..949743;cds;199;343;Ppx/GppA;*   PL1E
;365702..365775;cag;746;;;*;;;;;949943..950016;cag;246;;;*
;366522..367214;cds;;231;@FadR fam;*  comp;;;;comp;950263..950829;cds;;189;@IS3 fam;*
;;;;;;;;;;;;;;;;*
;1394614..1396740;cds;453;709;@PAS S-box;*   recomb;;;;>;971260..971532;cds;493;91;@P-hp;*   PL1F
;1397194..1397287;agc;52;;;*  PL1F;;;;comp;972026..972119;agc;197;;;*
comp;1397340..1397858;cds;;173;@Tyr rec/int;*   recomb;;;;;972317..972550;cds;;78;@hp;*
;;;;;;;;;;;;;;;;
comp;1098197..1098655;cds;675;153;MarR fam;*   PL1G;;;;comp;1302373..1303350;cds;166;326;fucosyl;*   PL1G
;1099331..1100821;$16s;107;§1491;;*;;;;comp;1303517..1303592;ttc;98;;;*
;1100929..1101005;@atc;31;;;*  insertion;;;;comp;1303691..1303876;cds;;62;gyrase YacG;*
;1101037..1101112;@gca;271;;;*;;;;;;;;;;*
;1101384..1104136;$23s;147;§2753;;*;;;;;1349823..1350929;cds;145;369;GNAT fam;*
comp;1104284..1105390;cds;;369;GNAT fam;*;;;;comp;1351075..1353828;$23s;262;§2754;;*
;;;;;;*;;;;comp;1354091..1355591;$16s;676;§1501;;*
;1157171..1157356;cds;98;62;gyrase YacG;*;;;;;1356268..1356726;cds;;153;MarR fam;*
;1157455..1157530;ttc;178;;;*;;;;;;;;;;*
;1157709..1158686;cds;;326;fucosyl;*;;;;;;;;;;
;;;;;;;;;;;;;;;;
comp;629856..631229;cds;154;458;tetratricopep;*   PL1H;;;;comp;1441708..1443066;cds;153;453;hp;*   PL1H
;631384..631458;acc;1;;;*;;;;;1443220..1443294;acc;1;;;*
;631460..631535;gcg;99;;;*;;;;;1443296..1443371;gcg;99;;;*
;631635..631711;gac;35;;;*;;;;;1443471..1443547;gac;44;;;*
;631747..631821;gtc;1;;;*;;;;;1443592..1443666;gtc;1;;;*
;631823..631896;cag;153;;;*;;;;;1443668..1443741;cag;137;;;*
;632050..632259;cds;;70;@hp;*   comp;;;;comp;1443879..1446428;cds;;850;@dip ABC;*
;;;;;;;;;;;;;;;;
;1577667..1578095;cds;457;143;DUF1489;*   PL1I;;;;;1566394..1566612;cds;193;73;@hp;*   PL1I
;1578553..1580043;$16s;110;§1491;@ ;*  bloc?;;;;comp;1566806..1566921;$5s;128;§116;;*
;1580154..1580230;atc;31;;;*;;;;comp;1567050..1569802;$23s;254;§2753;;*
;1580262..1580337;gca;269;;;*;;;;comp;1570057..1570132;gca;30;;;*
;1580607..1581986;&23s°;100;§1380;;*  réunion;;;;comp;1570163..1570239;atc;94;;;*
;1582087..1582616;&23s°;123;§530;;*;;;;comp;1570334..1571834;$16s;444;§1501;@ ;*
;1582740..1582855;$5s;100;§116;;*;;;;comp;1572279..1572707;cds;;143;DUF1489;*
;1582956..1583032;atgf;706;;;*  d’où?;;;;;;;;;;
;1583739..1585157;cds;;473;@pyruvate kin;*  comp;;;;;;;;;;
;;;;;;;;;;;;;;;;
;338004..339383;cds;116;460;hp;*   PL1J;;;;;1723583..1724962;cds;94;460;hp;*   PL1J
comp;339500..339586;ctc;257;;;*;;;;comp;1725057..1725143;ctc;475;;;*
comp;339844..340836;cds;;331;@ab hydrolase;*  comp;;;;;1725619..1726311;cds;;231;FadR fam;*
;;;;;;*;;;;;;;;;;*
;474173..477079;cds;298;969;PAS dom;*   PL1K;;;;;1757680..1760568;cds;308;963;PAS dom;*   PL1K
;477378..477464;ctg;30;;;*;;;;;1760877..1760963;ctg;29;;;*
;477495..477570;gcc;238;;;*;;;;;1760993..1761068;gcc;247;;;*
;477809..478123;cds;;105;@hp;*  comp;;;;comp;1761316..1761840;cds;;175;@Hx-t-Hx;*
;;;;;;*;;;;;;;;;;*
;599223..600230;cds;245;336;inorganic  P;*;;;;;1854042..1855049;cds;135;336;inorganic  P;*
comp;600476..600550;ggc;351;;;*;;;;comp;1855185..1855259;ggc;243;;;*
;600902..602071;cds;;390;@AG cyclase;*   recomb;;;;;1855503..1858685;cds;;1061;@AAA fam;*
;;;;;;;;;;;;;;;;
>comp;699265..699846;cds;210;194;p-hp;*   PL1L;;;;>comp;1883235..1883816;cds;210;194;P-hp;*   PL1L
;700057..700132;aac;4;;;*;;;;;1884027..1884102;aac;4;;;*
;700137..700213;gac;32;;;*;;;;;1884107..1884183;gac;32;;;*
comp;700246..700851;cds;;202;hp;*;;;;comp;1884216..1884821;cds;;202;hp;*
plasmide2;;;;;;*;;;;plasmide2;;;;;;*
;271302..272090;cds;529;263;@ATP bind;*  comp;;;;comp;51090..51836;cds;481;249;sigma-70 fam;*
;272620..272695;tgg;480;;;*;;;;comp;52318..52393;tgg;363;;;*
;273176..273922;cds;;249;sigma-70 fam;*;;;;;52757..53587;cds;;277;@hp;*
;;;;;;*;;;;;;;;;;*
;449562..450338;cds;465;259;@IclR fam;*    modif;;;;comp;809229..810019;cds;870;264;@IS5 fam;*
;450804..452289;$16s;584;§1486;;*;;;;comp;810890..810966;atgf;96;;;*
;452874..453640;&23s°;128;§767;;*;;;;comp;811063..811178;$5s;127;§116;;*
;453769..453884;$5s;101;§116;;*;;;;comp;811306..814058;$23s;266;§2753;;*
;453986..454062;atgf;359;;;*;;;;comp;814325..814400;gca;30;;;*
comp;454422..457751;cds;;1110;@NERD dom;*  comp;;;;comp;814431..814507;atc;108;;;*
;;;;;;;;;;comp;814616..816106;$16s;452;§1491;;*
;;;;;;;;;;comp;816559..817443;cds;;295;@Hx-t-Hx dom;*
plasmide4;;;;;;;;;;plasmide4;;;;;;*
;2176963..2177427;cds;107;155;@membrane p;*    comp;;;;;196992..199346;cds;148;785;mecano ion;*   PL4A
comp;2177535..2177610;gcc;30;;;*  ;;;;;199495..199581;ctg;30;;;*
comp;2177641..2177727;ctg;135;;;*  CH;;;;;199612..199687;gcc;188;;;*
comp;2177863..2180208;cds;;782;mecano ion;*;;;;;199876..201333;cds;;486;@hp;*
;;;;;;;;;;;;;;;;*
;246777..248687;cds;208;637;@polymerase;*   recomb;;;;;237538..238578;cds;92;347;@response reg;*  PL4B
comp;248896..248972;cgg;96;;;*;;;;comp;238671..238747;cgg;96;;;*
comp;249069..249983;cds;;305;ab hydrolase;*  PL4B;;;;comp;238844..239821;cds;;326;ab hydrolase;*
;;;;;;*;;;;;;;;;;*
;319641..319943;cds;134;101;STAS dom;*;;;;comp;257739..258470;cds;125;244;lipoyl LipB;*
comp;320078..320164;ctc;125;;;*;;;;;258596..258682;ctc;123;;;*
;320290..321018;cds;;243;lipoyl LipB;*;;;;comp;258806..259108;cds;;101;STAS dom;*
;;;;;;*;;;;;;;;;;*
comp;401067..402227;cds;281;387;PQQ;*;;;;comp;399367..400527;cds;278;387;PQQ;*
comp;402509..402624;$5s;129;§116;;*;;;;comp;400806..400921;$5s;129;§116;;*
comp;402754..403402;&23s°;106;§649;;*;;;;comp;401051..403803;$23s;255;§2753;;*
comp;403509..403880;&16s°;502;§372;;*;;;;comp;404059..404134;gca;30;;;*
comp;404383..404577;cds;;65;hp;*;;;;comp;404165..404241;atc;108;;;*
;;;;;;*;;;;comp;404350..405850;$16s;502;§1501;;*
;501394..501756;cds;95;121;response reg;*;;;;comp;406353..406547;cds;;65;hp;*
;501852..501927;aac;4;;;*;;;;;;;;;;*
;501932..502008;gac;4;;;*;;;;;504531..504893;cds;82;121;response reg;*
;502013..502087;ggc;102;;;*;;;;;504976..505051;aac;3;;;*
comp;502190..502957;cds;83;256;Hx-t-Hx;*;;;;;505055..505131;gac;4;;;*
;503041..503667;cds;249;209;pyridoxamine;*;;;;;505136..505210;ggc;102;;;*
comp;503917..504474;&16s°;547;§558;;*;;;;comp;505313..506080;cds;83;256;Hx-t-Hx;*
;505022..506005;cds;;328;@lytic dom;*    modif;;;;;506164..506790;cds;202;209;pyridoxamine;*
;;;;;;*;;;;comp;506993..507108;$5s;127;§116;;*
comp;601019..603679;cds;358;887;bif CoA;*;;;;comp;507236..509988;$23s;266;§2753;;*
;604038..604113;ttc;318;;;*;;;;comp;510255..510330;gca;30;;;*
>;604432..605613;cds;;394;@ss integrase;*   recomb;;;;comp;510361..510437;atc;110;;;*
;;;;;;;;;;comp;510548..512038;$16s;615;§1491;;*
>comp;131140..131621;cds;193;161;p-erythrose;*   ;;;;;512654..513568;cds;;305;@lytic dom;*
;131815..131891;atgf;202;;@ ;*  d’où?;;;;;;;;;;*
comp;132094..132276;cds;;61;hp;*;;;;comp;588108..590768;cds;340;887;bif CoA;*
;;;;;;;;;;;591109..591184;ttc;286;;;*
;;;;;;;;;;;591471..592979;cds;;503;@FAD bind;*
plasmide6;;;;;;;;;;plasmide5;;;;;;*
;88804..89472;cds;397;223;RraA fam;*;;;;;86421..87089;cds;455;223;RraA fam;*
;89870..89944;ggc;249;;;*;;;;;87545..87619;ggc;193;;;*
;90194..91186;cds;;331;UDP-N-acetyl;*;;;;;87813..88865;cds;;351;UDP-N-acetyl;*

agr[modifier | modifier le wikicode]

agr opérons[modifier | modifier le wikicode]

59.3%GC;29.12.19 Paris;16s  5 ;58 aas;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Agrobacterium sp. H13-3 ;;;;;;;;;;;;
chromosoml;;;;;;;;;;;;
comp;1064633..1065274;;cds;;296;296;;;214;;hp;*
;1065571..1065655;;ttg;;266;266;;;;;;*
;1065922..1066437;;cds;;;;;;172;;disulfide bond formation protein B;*
;;;;;;;;;;;;*
comp;1178605..1179114;;cds;;256;256;;;170;;prolyl-tRNA synthetase associated domain-containing protein;*
;1179371..1179445;;ggc;@1;793;;793;;;;;*
comp;1180239..1180315;;atgj;;135;135;;;;;;*
comp;1180451..1181647;;cds;;;;;;399;;tRNA 2-thiouridine(34) synthase MnmA;*
;;;;;;;;;;;;*
comp;1320644..1321006;;cds;;318;318;;;121;;hp;*
comp;1321325..1321414;;tcg;;197;197;;;;;;*
comp;1321612..1322493;;cds;;;;;;294;;dihydrodipicolinate synthase family protein;*
;;;;;;;;;;;;*
comp;1361929..1362942;;cds;;554;*554;;;338;;sugar ABC transporter substrate-binding protein;*
comp;1363497..1363571;;gtc;;81;81;;;;;;*
comp;1363653..1364015;;cds;;;;;;121;;response regulator;*
;;;;;;;;;;;;*
<comp;1426814..1427137;;cds;;105;105;;;108;;hp;*
;1427243..1428733;;16s;;337;;;;1491;;;*
;1429071..1429147;;atc;;59;;;59;;;;*
;1429207..1429282;;gca;;146;146;;;;;;*
<comp;1429429..1429626;;cds;@2;241;241;;;66;;P-hp;*
;1429868..1432681;;23s;;242;;;;2814;;;*
;1432924..1433038;;5s;;257;;;;115;;;*
;1433296..1433372;;atgf;;311;311;;;;;;*
;1433684..1434118;;cds;;;;;;145;;acetyl-CoA carboxylase biotin carboxyl carrier protein subunit;*
;;;;;;;;;;;;*
;1503534..1504520;;cds;;122;122;;;329;;beta-ketoacyl-ACP synthase III;*
comp;1504643..1504716;;cag;;123;123;;;;;;*
comp;1504840..1505277;;cds;;;;;;146;;Lrp/AsnC family transcriptional regulator;*
;;;;;;;;;;;;*
;1605356..1605856;;cds;;71;71;;;167;;hp;*
comp;1605928..1606003;;gcc;;152;152;;;;;;*
comp;1606156..1606545;;cds;;;;;;130;;TIGR02300 family protein;*
;;;;;;;;;;;;*
<comp;1687683..1688015;;cds;;105;105;;;111;;hp;*
;1688121..1689611;;16s;;337;;;;1491;;;*
;1689949..1690025;;atc;;59;;;59;;;;*
;1690085..1690160;;gca;;146;146;;;;;;*
<comp;1690307..1690504;;cds;;241;241;;;66;;P-hp;*
;1690746..1693559;;23s;;242;;;;2814;;;*
;1693802..1693916;;5s;;257;;;;115;;;*
;1694174..1694250;;atgf;;203;203;;;;;;*
comp;1694454..1694645;;cds;;;;;;64;;hp;*
;;;;;;;;;;;;*
<comp;2103153..2103404;;cds;;105;105;;;84;;P-hp;*
;2103510..2105000;;16s;;337;;;;1491;;;*
;2105338..2105414;;atc;;59;;;59;;;;*
;2105474..2105549;;gca;;146;146;;;;;;*
<comp;2105696..2105893;;cds;;241;241;;;66;;P-hp;*
;2106135..2108948;;23s;;242;;;;2814;;;*
;2109191..2109305;;5s;;257;;;;115;;;*
;2109563..2109639;;atgf;;633;*633;;;;;;*
;2110273..2110680;;cds;;;;;;136;;membrane protein;*
chromosomc;;;;;;;;;;;;*
<comp;56862..57137;;cds;;105;105;;;92;;P-hp;*
;57243..58733;;16s;;337;;;;1491;;;*
;59071..59147;;atc;;59;;;59;;;;*
;59207..59282;;gca;;146;146;;;;;;*
<comp;59429..59626;;cds;;241;241;;;66;;P-hp;*
;59868..62681;;23s;;242;;;;2814;;;*
;62924..63038;;5s;;257;;;;115;;;*
;63296..63372;;atgf;;196;196;;;;;;*
;63569..65377;;cds;;;;;;*603;;DNA helicase RecQ;*
;;;;;;;;;;;;*
comp;125821..127722;;cds;;287;287;;;*634;;molecular chaperone DnaK;*
comp;128010..128099;;tcc;;220;220;;;;;;*
;128320..128637;;cds;;;;;;106;;hp;*
;;;;;;;;;;;;*
;227621..228004;;cds;;240;240;;;128;;membrane protein;*
comp;228245..228331;;ctg;;120;120;;;;;;*
comp;228452..228757;;cds;;;;;;102;;SelT/SelW/SelH family protein;*
;;;;;;;;;;;;*
>;378307..378396;;cds;;40;40;;;30;;P-hp;*
;378437..378513;;cgt;;174;174;;;;;;*
;378688..379500;;cds;;;;;;271;;class I SAM-dependent methyltransferase;*
;;;;;;;;;;;;*
comp;407277..407435;;cds;;167;167;;;53;;YqaE/Pmp3 family membrane protein;*
comp;407603..407678;;acg;;137;137;;;;;;*
comp;407816..408778;;cds;;;;;;321;;nitronate monooxygenase;*
;;;;;;;;;;;;*
;425990..427087;;cds;;56;56;;;366;;2'-deoxycytidine 5'-triphosphate deaminase;*
;427144..427217;;ggg;;154;154;;;;;;*
;427372..428058;;cds;;;;;;229;;aquaporin Z;*
;;;;;;;;;;;;*
;458659..459081;;cds;;285;285;;;141;;hp;*
;459367..459442;;ttc;;246;246;;;;;;*
comp;459689..460033;;cds;;;;;;115;;cation:proton antiporter;*
;;;;;;;;;;;;*
comp;493759..494025;;cds;;155;155;;;89;;hp;*
;494181..494255;;acc;;195;195;;;;;;*
comp;494451..495686;;cds;;;;;;412;;flagellin;*
;;;;;;;;;;;;*
comp;564938..568684;;cds;;361;*361;;;*1249;;PAS domain S-box protein;*
;569046..569122;;cac;;79;79;;;;;;*
;569202..570920;;cds;;;;;;573;;Ppx/GppA family phosphatase;*
;;;;;;;;;;;;*
comp;763448..764356;;cds;;202;202;;;303;;MBL fold metallo-hydrolase;*
;764559..764633;;caa;;263;263;;;;;;*
comp;764897..766549;;cds;;;;;;551;;malate dehydrogenase (quinone);*
;;;;;;;;;;;;*
comp;767020..767439;;cds;;264;264;;;140;;hp;*
;767704..767780;;ccg;;159;159;;;;;;*
comp;767940..768260;;cds;;;;;;107;;hp;*
;;;;;;;;;;;;*
comp;960360..960701;;cds;;163;163;;;114;;hp;*
;960865..960955;;agc;;500;*500;;;;;;*
comp;961456..961671;;cds;;;;;;72;;hp;*
;;;;;;;;;;;;*
;1123408..1124136;;cds;;141;141;;;243;;hp;*
;1124278..1124363;;tta;;241;241;;;;;;*
;1124605..1127115;;cds;;;;;;*837;;copper-translocating P-type ATPase;*
;;;;;;;;;;;;*
;1154411..1154803;;cds;;91;91;;;131;;DUF2934 domain-containing protein;*
comp;1154895..1154969;;aac;;176;176;;;;;;*
;1155146..1155424;;cds;;;;;;93;;hp;*
;;;;;;;;;;;;*
comp;1162767..1163027;;cds;;138;138;;;87;;hp;*
comp;1163166..1163242;;ccc;;218;218;;;;;;*
;1163461..1163997;;cds;;;;;;179;;DUF1269 domain-containing protein;*
;;;;;;;;;;;;*
;1192452..1194650;;cds;;660;*660;;;*733;;esterase-like activity of phytase family protein;*
comp;1195311..1195386;;gta;+;446;;446;;;;;*
;1195833..1195909;;gac;2 gac;41;;41;;;;;*
;1195951..1196027;;gac;;435;*435;;;;;;*
;1196463..1196828;;cds;;;;;;122;;NADH-quinone oxidoreductase subunit A;*
;;;;;;;;;;;;*
;1421863..1422201;;cds;;134;134;;;113;;hp;*
comp;1422336..1422425;;tca;;88;88;;;;;;*
comp;1422514..1422678;;cds;;;;;;55;;hp;*
;;;;;;;;;;;;*
comp;1468229..1469110;;cds;;180;180;;;294;;HNH endonuclease;*
comp;1469291..1469367;;atgf;;132;132;;;;;;*
comp;1469500..1470450;;cds;;;;;;317;;hp;*
;;;;;;;;;;;;*
comp;1508458..1508883;;cds;;558;*558;;;142;;PAS domain-containing protein;*
comp;1509442..1509526;;ctc;;189;189;;;;;;*
;1509716..1510447;;cds;;;;;;244;;lipoyl(octanoyl) transferase LipB;*
;;;;;;;;;;;;*
;1531160..1531933;;cds;;447;*447;;;258;;amino acid ABC transporter ATP-binding protein;*
;1532381..1532455;;gaa;;121;121;;;;;;*
;1532577..1532818;;cds;;89;89;;;81;;P-hp;*
;1532908..1532982;;gaa;;129;129;;;;;;*
comp;1533112..1534920;;cds;;;;;;*603;;single-stranded-DNA-specific exonuclease RecJ;*
;;;;;;;;;;;;*
;1584509..1584763;;cds;;155;155;;;85;;GlsB/YeaQ/YmgE family stress response membrane protein;*
;1584919..1584994;;aag;;134;134;;;;;;*
comp;1585129..1585575;;cds;;;;;;149;;hp;*
;;;;;;;;;;;;*
comp;1612420..1613898;;cds;;240;240;;;493;;trigger factor;*
comp;1614139..1614221;;cta;;447;*447;;;;;;*
<;1614669..1614876;;cds;;;;;;69;;P-hp;*
;;;;;;;;;;;;*
comp;1672216..1672887;;cds;;245;245;;;224;;protein-L-isoaspartate O-methyltransferase;*
comp;1673133..1673206;;tgc;;240;240;;;;;;*
comp;1673447..1673599;;cds;;;;;;51;;DUF3309 family protein;*
;;;;;;;;;;;;*
comp;1744688..1745434;;cds;;341;341;;;249;;cytochrome c biogenesis protein CcdA;*
;1745776..1745851;;aaa;;310;310;;;;;;*
;1746162..1746743;;cds;;;;;;194;;DUF1003 domain-containing protein;*
;;;;;;;;;;;;*
comp;1770727..1772280;;cds;;91;91;;;518;;tyrosine-type recombinase/integrase;*
comp;1772372..1772448;;cca;;265;265;;;;;;*
;1772714..1773019;;cds;;51;51;;;102;;ETC complex I subunit;*
;1773071..1773147;;aga;;7;7;;;;;;*
comp;1773155..1773892;;cds;;;;;;246;;DUF429 domain-containing protein;*
;;;;;;;;;;;;*
comp;1902337..1902537;;cds;;184;184;;;67;;preprotein translocase subunit SecE;*
comp;1902722..1902797;;tgg;;241;241;;;;;;*
comp;1903039..1903845;;cds;;;;;;269;;glycosyltransferase;*
;;;;;;;;;;;;*
;1908698..1908892;;cds;;70;70;;;65;;hp;*
comp;1908963..1909036;;gga;;26;26;26;;;;;*
comp;1909063..1909147;;tac;;209;209;;;;;;*
;1909357..1910244;;cds;;;;;;296;;23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB;*
;;;;;;;;;;;;*
;1922447..1922800;;cds;;55;55;;;118;;hp;*
comp;1922856..1922931;;aca;;207;207;;;;;;*
;1923139..1924878;;cds;;;;;;580;;GGDEF domain-containing protein;*
;;;;;;;;;;;;*
;2079925..2080287;;cds;;156;156;;;121;;hp;*
comp;2080444..2080519;;atgi;;178;178;;;;;;*
;2080698..2081441;;cds;;;;;;248;;SIMPL domain-containing protein;*
;;;;;;;;;;;;*
comp;2275632..2276138;;cds;;522;*522;;;169;;winged helix-turn-helix transcriptional regulator;*
;2276661..2276737;;cgg;;287;287;;;;;;*
;2277025..2277264;;cds;;;;;;80;;hp;*
;;;;;;;;;;;;*
comp;2388300..2388497;;cds;;87;87;;;66;;hp;*
;2388585..2388659;;ggc;;361;*361;;;;;;*
;2389021..2391024;;cds;;;;;;*668;;methyl-accepting chemotaxis protein;*
;;;;;;;;;;;;*
comp;2490745..2491854;;cds;;535;*535;;;370;;2Fe-2S iron-sulfur cluster binding domain-containing protein;*
comp;2492390..2492466;;atgf;;287;;;;115;;;*
comp;2492754..2492868;;5s;;242;;;;2814;;;*
comp;2493111..2495924;;23s;;241;241;;;;;;*
>;2496166..2496363;;cds;;146;146;;;66;;P-hp;*
comp;2496510..2496585;;gca;;59;;;59;;;;*
comp;2496645..2496721;;atc;;337;;;;;;;*
comp;2497059..2498549;;16s;;105;105;;;1491;;;*
>;2498655..2498930;;cds;;;;;;92;;P-hp;*

agr cumuls[modifier | modifier le wikicode]

agr cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;5;1;;;1;0;1;;100;24;1;0
;16atcgca235;0;20;;;50;3;40;;200;30;30;1
;Id-atgf;5;40;1;;100;12;80;;300;14;60;3
;16s23s;0;60;1;5;150;22;120;;400;8;90;17
;max a;3;80;;;200;17;160;;500;2;120;13
;a doubles;0;100;;;250;18;200;;600;4;150;14
;spéciaux;0;120;;;300;9;240;;700;4;180;5
;total aas;15;140;;;350;4;280;;800;1;210;1
sans ;opérons;38;160;;;400;2;320;;900;1;240;3
;1 aa;35;180;;;450;3;360;;1000;0;270;7
;max a;3;200;;;500;1;400;;1100;0;300;4
;a doubles;1;;2;;;6;;;;1;;21
;total aas;42;;4;5;;97;;0;;89;;89
total aas;;57;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;;59;;213;;;;230;;
;;;variance;;0;;134;;;;209;;
sans jaune;;;moyenne;33;;;172;;;;185;;137
;;;variance;;;;76;;;;131;;71

agr blocs[modifier | modifier le wikicode]

agr blocs;;;;;;;;;
chromoml;intercal;cdsa;;intercal;cdsa;;intercal;cdsa;
cds;105;108;hp;105;111;hp;105;84;P-hp
16s;337;1491;;337;1491;;337;1491;
atc;59;;;59;;;59;;
gca;146;;;146;;;146;;
cds;241;66;P-hp;241;66;P-hp;241;66;P-hp
23s;242;2814;;242;2814;;242;2814;
5s;257;115;;257;115;;257;115;
atgf;311;;;203;;;633;;
cds;;145;CoA;;64;hp;;136;membrane
chromosomc;;;;;;;;;
cds;105;92;P-hp;105;92;P-hp;;;
16s;337;1491;;337;1491;;;;
atc;59;;;59;;;;;
gca;146;;;146;;;;;
cds;241;66;P-hp;241;66;P-hp;;;
23s;242;2814;;242;2814;;;;
5s;257;115;;287;115;;;;
atgf;196;;;535;;;;;
cds;;603;helicase;;370;2Fe-2S;;;
;;;;;;;;;
;;;;;;;;;
CoA;acetyl-CoA carboxylase biotin carboxyl carrier protein subunit;;;;;;;;
helicase;DNA helicase RecQ;;;;;;;;
2Fe-2S;2Fe-2S iron-sulfur cluster binding domain-containing protein;;;;;;;;
membrane;membrane protein;;;;;;;;

aua[modifier | modifier le wikicode]

aua opérons[modifier | modifier le wikicode]

https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP006367.1;aua;;genome;;pau20rrn;;;;;;;
67%GC;8.8.19 Paris;16s 1;;doubles;intercalaires;CDS;aa;avec aa;aas;cdsd;protéines;
Aureimonas sp. AU20;;;;;;;;;;;;
;;;;;;;;;;;;
pAU20rrn;;;;;;;;;;;;
;324..1028;;CDS rep;;461;;;;235;;replication initiation protein;*
comp;1490..1604;;5s;@1;82;;;;115;;;
comp;1687..4515;;23s;;-15;;;;2829;;;
comp;4501..4851;;CDS hp;;142;;;;117;;hp;
comp;4994..5069;;gca;;33;;;33;;;;
comp;5103..5179;;atc;;233;;;;;;;
comp;5413..6898;;16s;;1752;;;;1486;;;
comp;8651..9109;;CDS hp;;;;;;153;;hp;
;;;;;;;;;;;;
Chromosome;;;;;;;;;;;;
comp;170900..171925;;CDS;;368;368;;;342;;;
;172294..172378;;ctg;;130;130;;;;130;;
;172509..172772;;CDS;;;;;;88;;;
;;;;;;;;;;;;
comp;330094..330690;;CDS;;338;338;;;199;;;
;331029..331103;;ggc;@2;404;;*404;;;;;
comp;331508..331584;;atg;+;44;;44;;;;;
comp;331629..331705;;atg;2 atg;255;255;;;;255;;
comp;331961..333217;;CDS;;;;;;419;;;
;;;;;;;;;;;;
;344949..346025;;CDS;;589;589;;;359;589;;
;346615..346704;;tcg;;609;609;;;;;;
;347314..348471;;CDS;;;;;;386;;;
;;;;;;;;;;;;
comp;393335..395356;;CDS;;800;*800;;;*674;;;
comp;396157..396232;;gcc;;439;439;;;;439;;
comp;396672..397094;;CDS;;;;;;141;;;
;;;;;;;;;;;;
;635177..637537;;CDS;;640;640;;;*787;;;
comp;638178..638253;;gcg;;182;182;;;;182;;
;638436..638738;;CDS;;;;;;101;;;
;;;;;;;;;;;;
comp;924507..925466;;CDS;;529;529;;;320;;;
comp;925996..926085;;tcc;;349;349;;;;349;;
;926435..926767;;CDS;;;;;;111;;;
;;;;;;;;;;;;
;1216789..1217439;;CDS;;60;60;;;217;60;;
;1217500..1217576;;agg;;68;68;;;;;;
comp;1217645..1218760;;CDS;;;;;;372;;;
;;;;;;;;;;;;
;1350534..1352180;;CDS;@4;-30;*-30;;;*549;;;
comp;1352151..1352227;;cgt;+;51;;51;;;;;
comp;1352279..1352355;;cgt;2 cgt;169;169;;;;;;
comp;1352525..1353967;;CDS;;;;;;*481;;;
;;;;;;;;;;;;
;1401921..1402442;;CDS;;142;142;;;174;142;;
;1402585..1402661;;cac;;585;585;;;;;;
;1403247..1404875;;CDS;;;;;;*543;;;
;;;;;;;;;;;;
;1544580..1546277;;CDS;;455;455;;;*566;;;
comp;1546733..1546808;;ttc;@2;161;;161;;;;;
;1546970..1547044;;acc;;414;414;;;;414;;
;1547459..1549516;;CDS;;;;;;*686;;;
;;;;;;;;;;;;
;1609269..1610216;;CDS;;278;278;;;316;;;
comp;1610495..1610571;;cgg;;121;121;;;;121;;
comp;1610693..1611427;;CDS;;;;;;245;;;
;;;;;;;;;;;;
>;1683255..1683581;;CDS;;209;209;;;109;209;;
comp;1683791..1683864;;cag;;580;580;;;;;;
;1684445..1685734;;CDS;;;;;;430;;;
;;;;;;;;;;;;
;1700827..1701852;;CDS;;300;300;;;342;;;
comp;1702153..1702227;;gtc;+;128;;128;;;;;
comp;1702356..1702430;;gtc;3 gtc;186;;186;;;;;
comp;1702617..1702691;;gtc;;68;68;;;;68;;
comp;1702760..1703125;;CDS;;;;;;122;;;
;;;;;;;;;;;;
;1946715..1946936;;CDS;;6;6;;;74;6;;
comp;1946943..1947018;;atgi;;105;105;;;;;;
;1947124..1947345;;CDS;;;;;;74;;;
;;;;;;;;;;;;
;1981934..1983139;;CDS;;139;139;;;402;139;;
;1983279..1983368;;agc;;825;*825;;;;;;
;1984194..1985339;;CDS;;;;;;382;;;
;;;;;;;;;;;;
;1996083..1997171;;CDS;;243;243;;;363;;;
comp;1997415..1997490;;acg;;112;112;;;;112;;
comp;1997603..1998583;;CDS;;;;;;327;;;
;;;;;;;;;;;;
comp;2263930..2264781;;CDS;;30;30;;;284;30;;
comp;2264812..2264886;;gtg;;111;111;;;;;;
comp;2264998..2265768;;CDS;;;;;;257;;;
;;;;;;;;;;;;
;2363764..2364786;;CDS;;18;18;;;341;18;;
comp;2364805..2364879;;gaa;+;140;;140;;;;;
comp;2365020..2365094;;gaa;2 gaa;69;69;;;;69;;
comp;2365164..2366144;;CDS;;;;;;327;;;
;;;;;;;;;;;;
;2367774..2368247;;CDS;;105;105;;;158;;;
;2368353..2368429;;cca;@3;43;43;;;;43;;
;2368473..2368778;;CDS;;36;36;;;102;36;;
;2368815..2368890;;aga;;448;448;;;;;;
;2369339..2369929;;CDS;;;;;;197;;;
;;;;;;;;;;;;
comp;2401620..2402732;;CDS;;155;155;;;371;155;;
comp;2402888..2402963;;aaa;;169;169;;;;;;
;2403133..2403870;;CDS;;;;;;246;;;
;;;;;;;;;;;;
;2419689..2420852;;CDS;;13;13;;;388;13;;
;2420866..2420955;;tca;;238;238;;;;;;
;2421194..2421934;;CDS;;;;;;247;;;
;;;;;;;;;;;;
comp;2601493..2601858;;CDS;;287;287;;;122;287;;
comp;2602146..2602222;;gac;+;58;;58;;;;;
comp;2602281..2602357;;gac;2 gac;270;;270;;;;;
;2602628..2602703;;gta;@2;330;330;;;;;;
comp;2603034..2603312;;CDS;;;;;;93;;;
;;;;;;;;;;;;
comp;2608494..2609852;;CDS;;73;73;;;*453;73;;
comp;2609926..2610009;;cta;;307;307;;;;;;
;2610317..2610460;;CDS;;;;;;48;;;
;;;;;;;;;;;;
comp;2641174..2641824;;CDS;@3;125;125;;;217;125;;
comp;2641950..2642023;;tgc;;153;153;;;;;;
comp <;2642177..2642443;;CDS;;296;296;;;89;;;
;2642740..2642814;;aac;;269;269;;;;269;;
;2643084..2644127;;CDS;;;;;;348;;;
;;;;;;;;;;;;
comp;2651145..2652935;;CDS;;239;239;;;*597;239;;
;2653175..2653259;;tta;;265;265;;;;;;
;2653525..2653725;;CDS;;;;;;67;;;
;;;;;;;;;;;;
comp;2749758..2750318;;CDS;;3102;*3102;;;187;;;
comp;2753421..2753497;;atg;;83;83;;;;83;;
comp;2753581..2754180;;CDS;;;;;;200;;;
;;;;;;;;;;;;
;2768127..2769224;;CDS;;63;63;;;366;63;;
comp;2769288..2769364;;ccg;@2;173;;173;;;;;
;2769538..2769612;;caa;;528;528;;;;;;
comp;2770141..2770566;;CDS;;;;;;142;;;
;;;;;;;;;;;;
comp;2787112..2788920;;CDS;;217;217;;;*603;217;;
comp;2789138..2789214;;ccc;;265;265;;;;;;
comp;2789480..2790022;;CDS;;;;;;181;;;
;;;;;;;;;;;;
;2927857..2928789;;CDS;;136;136;;;311;136;;
comp;2928926..2929010;;ctc;+;132;;132;;;;;
comp;2929143..2929227;;ctc;2 ctc;175;175;;;;;;
;2929403..2930164;;CDS;;;;;;254;;;
;;;;;;;;;;;;
comp;2971057..2971257;;CDS;;130;130;;;67;;;
comp;2971388..2971463;;tgg;;53;53;;;;53;;
comp;2971517..2972374;;CDS;;;;;;286;;;
;;;;;;;;;;;;
comp;2973322..2974497;;CDS;;291;291;;;392;;;
comp;2974789..2974862;;gga;;24;;24;;;;;
comp;2974887..2974971;;tac;;259;259;;;;259;;
;2975231..2976097;;CDS;;;;;;289;;;
;;;;;;;;;;;;
comp;2979955..2981049;;CDS;;221;221;;;365;;;
;2981271..2981346;;aca;;55;55;;;;55;;
comp;2981402..2981752;;CDS;;;;;;117;;;
;;;;;;;;;;;;
comp;3063743..3064045;;CDS;;106;106;;;101;106;;
comp;3064152..3064227;;aag;;147;147;;;;;;
comp;3064375..3064803;;CDS;;;;;;143;;;
;;;;;;;;;;;;
comp;3194307..3194906;;CDS;;249;249;;;200;;;
;3195156..3195232;;atg;;173;173;;;;173;;
;3195406..3196356;;CDS;;;;;;317;;;
;;;;;;;;;;;;
comp;3206006..3206455;;CDS;;743;*743;;;150;;;
comp;3207199..3207273;;gag;;50;50;;;;50;;
comp;3207324..3207689;;CDS;;;;;;122;;;
;;;;;;;;;;;;
;3398165..3399901;;CDS;;554;554;;;*579;;;
;3400456..3400530;;aac;;115;115;;;;115;;
;3400646..3400924;;CDS;;;;;;93;;;
;;;;;;;;;;;;
;3401737..3403497;;CDS;;227;227;;;*587;;;
comp;3403725..3403799;;ggc;;208;;208;;;;;
comp;3404008..3404082;;ggg;;74;74;;;;74;;
comp;3404157..3404819;;CDS;;;;;;221;;;
;;;;;;;;;;;;
comp;3597872..3598414;;CDS;;370;370;;;181;;;
;3598785..3598869;;ttg;;151;151;;;;151;;
comp;3599021..3599251;;CDS;;;;;;77;;;

aua cumuls[modifier | modifier le wikicode]

aua cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds chromosome;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;1;1;0;-;1;1;1;0;100;10;1;0
;16 aas 23 5s ;0;20;0;;50;7;40;7;200;22;30;0
;16 atc gca hp;1;40;1;;100;10;80;9;300;11;60;1
;16 cds 23 5s ;0;60;3;;150;14;120;9;400;20;90;7
;max a;2;80;0;;200;8;160;4;500;5;120;8
;a doubles;0;100;0;;250;8;200;3;600;6;150;7
;spéciaux;0;120;0;;300;10;240;4;700;3;180;2
;total aas;2;140;3;;350;4;280;1;800;1;210;7
sans ;opérons;38;160;0;;400;2;320;0;900;0;240;3
;1 aa;26;180;2;;450;3;360;2;1000;0;270;5
;max a;3;200;1;;500;1;400;0;1100;0;300;3
;a doubles;6;;3;;;12;;1;;0;;35
;total aas;53;;13;0;;80;;40;;78;;78
total aas;;55;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;;;;;;;;;;
;;;variance;;;;;;;;;;
sans jaune;;;moyenne;131;;;226;;153;;235;;158
;;;variance;75;;;165;;128;;125;;69

aua blocs[modifier | modifier le wikicode]

CDS ;1752;153;hp
16s;233;1486;
atc;33;;
gca;142;;
CDS;-15;117;hp
23s;82;2829;
5s;461;115;
CDS ;;235;replication initiation protein

cvi[modifier | modifier le wikicode]

cvi opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Chro_viol_ATCC_12472/chroViol-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_005085.1;cvi;genome;;;
65%GC;30.6.19 Paris;16s  8;98;doubles;intercalaires
;Chromobacterium violaceum ATCC 12472;;;;
;421217..422762;;16s;@1;179
;422942..423018;;atc;;86
;423105..423180;;gca;;249
;423430..426324;;23s;;125
;426450..426564;;5s;;
;;;;;
;502182..503727;;16s;;79
;503807..503883;;atc;;12
;503896..503971;;gca;;250
;504222..507116;;23s;;122
;507239..507353;;5s;;
;;;;;
comp;682034..682118;;ttg;;
;;;;;
;759824..759908;;tac;;
;;;;;
comp;878775..878849;;agg;;
;;;;;
;955155..955230;;gcg;;
;;;;;
;975612..975696;;ctc;;
;;;;;
;1006822..1006897;;ttc;+;6
;1006904..1006979;;ttc;2 ttc;
;;;;;
;1058518..1058611;;agc;;6
;1058618..1058694;;cgt;;3
;1058698..1058772;;gaa;;
;;;;;
comp;1061741..1061815;;gaa;+;3
comp;1061819..1061895;;cgt;2 gaa;7
comp;1061903..1061977;;gaa;2cgt;5
comp;1061983..1062059;;cgt;;
;;;;;
;1154020..1155565;;16s;;179
;1155745..1155821;;atc;;86
;1155908..1155983;;gca;;250
;1156234..1159128;;23s;;122
;1159251..1159365;;5s;;
;;;;;
comp;1263556..1263645;;tcg;;
;;;;;
;1273710..1273786;;atgf;;
;;;;;
;1377435..1377510;;ggc;+;23
;1377534..1377609;;ggc;5 ggc;22
;1377632..1377707;;ggc;;24
;1377732..1377807;;ggc;;29
;1377837..1377912;;ggc;;45
;1377958..1378031;;tgc;;
;;;;;
;1387010..1387094;;tta;;
;;;;;
;1420085..1420161;;gtc;;
;;;;;
;1427771..1427847;;ccc;;
;;;;;
comp;1433244..1433319;;aac;+;32
comp;1433352..1433427;;aac;3 aac;31
comp;1433459..1433534;;aac;;
;;;;;
;1646821..1648366;;16s;;179
;1648546..1648622;;atc;;86
;1648709..1648784;;gca;;249
;1649034..1651928;;23s;;122
;1652051..1652165;;5s;;89
;1652255..1652369;;5s;;
;;;;;
;1746117..1746207;;tcc;+;53
;1746261..1746351;;tcc;2 tcc;
;;;;;
;1978844..1978919;;aac;;
;;;;;
comp;2094372..2094447;;cac;+;26
comp;2094474..2094549;;cac;3 cac;45
comp;2094595..2094670;;cac;;27
comp;2094698..2094774;;aga;;18
comp;2094793..2094869;;cca;;
;;;;;
comp;2511625..2511712;;tca;;
;;;;;
comp;2747299..2747375;;gac;;7
comp;2747383..2747458;;gta;;
;;;;;
;2853221..2853305;;cta;;
;;;;;
;3187082..3187157;;aca;;
;;;;;
;3257362..3257437;;gcc;;
;;;;;
;3262246..3262321;;gcc;+;8
;3262330..3262405;;gaa;2 gcc;11
;3262417..3262492;;gcc;;
;;;;;
comp;3371478..3371592;;5s;;122
comp;3371715..3374609;;23s;;250
comp;3374860..3374935;;gca;;12
comp;3374948..3375024;;atc;;79
comp;3375104..3376649;;16s;;
;;;;;
;3472822..3472897;;gta;+;12
;3472910..3472986;;gac;5 gta;26
;3473013..3473088;;gta;6 gac;12
;3473101..3473177;;gac;1gtg;26
;3473204..3473279;;gta;;12
;3473292..3473368;;gac;;26
;3473395..3473470;;gta;;12
;3473483..3473559;;gac;;27
;3473587..3473663;;gtg;;6
;3473670..3473746;;gac;;27
;3473774..3473850;;gtg;;6
;3473857..3473933;;gac;;
;;;;;
;3622292..3622365;;ggg;;
;;;;;
comp;3820120..3820234;;5s;;122
comp;3820357..3823251;;23s;;249
comp;3823501..3823576;;gca;;86
comp;3823663..3823739;;atc;;179
comp;3823919..3825464;;16s;;
;;;;;
;3828836..3828922;;ctg;+;51
;3828974..3829060;;ctg;4 ctg;33
;3829094..3829180;;ctg;;57
;3829238..3829324;;ctg;;
;;;;;
;3854547..3854622;;caa;@2;*557
;3855180..3855255;;acg;;61
;3855317..3855393;;ccg;+;78
;3855472..3855548;;ccg;2 ccg;
;;;;;
comp;4059834..4059912;;atgi;;
;;;;;
comp;4244591..4244705;;5s;;122
comp;4244828..4247722;;23s;;249
comp;4247972..4248047;;gca;;86
comp;4248134..4248210;;atc;;179
comp;4248390..4249935;;16s;;
;;;;;
comp;4325718..4325794;;atgf;;
;;;;;
comp;4389268..4389342;;caa;;
;;;;;
;4402077..4402153;;cgg;;
;;;;;
comp;4434130..4434244;;5s;;122
comp;4434367..4437261;;23s;;249
comp;4437511..4437586;;gca;;86
comp;4437673..4437749;;atc;;179
comp;4437929..4439474;;16s;;
;;;;;
;4474196..4474272;;atg;+;35
;4474308..4474384;;atg;2 atg;
;;;;;
comp;4529616..4529690;;acc;;
;;;;;
comp;4532053..4532128;;tgg;;
;;;;;
comp;4533370..4533444;;acc;;24
comp;4533469..4533542;;gga;;52
comp;4533595..4533679;;tac;;
;;;;;
comp;4586712..4586787;;aaa;+;38
comp;4586826..4586901;;aag;3 aaa;35
comp;4586937..4587012;;aaa;2 aag;28
comp;4587041..4587116;;aag;;37
comp;4587154..4587229;;aaa;;

cvi cumuls[modifier | modifier le wikicode]

cvi cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;8;1;0;-
;16 23 5s 0;0;20;16;2
;16 atc gca;8;40;20;
;16 23 5s a;0;60;6;
;max a;2;80;2;
;a doubles;0;100;0;6
;spéciaux;0;120;0;
;total aas;16;140;0;
sans ;opérons;37;160;0;
;1 aa;22;180;0;
;max a;12;200;0;
;a doubles;12;;1;
;total aas;82;;45;8
total aas;;98;;;
remarques;;2;;;
avec jaune;;;moyenne;;
;;;variance;;
sans jaune;;;moyenne;26;86
;;;variance;18;0

cvi blocs[modifier | modifier le wikicode]

cvi blocs;;;;;;
16s;179;1546;79;1546;179;1546
atc;86;;12;;86;
gca;249;;250;;250;
23s;125;2895;122;2895;122;2895
5s;;115;;115;;115
;;;;;;
;;;;;;
5s;122;115;122;115;122;115
23s;250;2895;249;2895;249;2895
gca;12;;86;;86;
atc;79;;179;;179;
16s;;1546;;1546;;1546
;;;;;;
16s;179;1546;;5s;122;115
atc;86;;;23s;249;2895
gca;249;;;gca;86;
23s;122;2895;;atc;179;
5s;89;115;;16s;;1546
5s;;115;;;;

cvi remarques[modifier | modifier le wikicode]

cvi;;;;;98;;99
atgi;1;tct;;tat;;atgf;3
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;2;tac;2;tgc;1
atc;8;acc;2;aac;4;agc;1
ctc;1;ccc;1;cac;3;cgt;3
gtc;1;gcc;3;gac;7;ggc;5
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;3;aga;1
cta;1;cca;1;caa;2;cga;
gta;5;gca;8;gaa;4;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;2;acg;1;aag;2;agg;1
ctg;4;ccg;2;cag;;cgg;1
gtg;2;gcg;1;gag;;ggg;1

ade[modifier | modifier le wikicode]

ade opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Anae_deha_2CP_C/anaeDeha_2CP_C-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_011891.1;ade;genome;;;
75%GC;30.6.19 Paris;16s  2;49;doubles;intercalaires
;Anaeromyxobacter dehalogenans 2CP-C;;;;
;8147..8220;;caa;;
;;;;;
;21040..21112;;ttc;;
;;;;;
comp;433303..433378;;ggg;;
;;;;;
comp;666509..666585;;gac;;6
comp;666592..666666;;gta;;
;;;;;
comp;693146..693229;;ctg;;
;;;;;
;851483..851555;;atg;;
;;;;;
comp;1057311..1057386;;gcg;;
;;;;;
comp;1306222..1306295;;ccc;;
;;;;;
;1442379..1442450;;tgc;;
;;;;;
;1495545..1497102;;16s;@1;187
;1497290..1497367;;atc;;22
;1497390..1497465;;gca;;194
;1497660..1500648;;23s;;152
;1500801..1500917;;5s;;
;;;;;
;1509186..1509259;;cag;;60
;1509320..1509394;;gag;;
;;;;;
;1691085..1691160;;gcc;;
;;;;;
;819377..1819453;;atg;;
;;;;;
;2235670..2235741;;gtc;;
;;;;;
comp;2314981..2315079;;tga;;
;;;;;
comp;2337031..2337104;;atg;;
;;;;;
;2376009..2376080;;gtg;;
;;;;;
comp;2429718..2429790;;acg;;
;;;;;
comp;2623942..2624017;;tgg;;
;;;;;
comp;2625463..2625535;;acc;;22
comp;2625558..2625633;;gga;;63
comp;2625697..2625779;;tac;;46
comp;2625826..2625898;;aca;;
;;;;;
;2653452..2653535;;ttg;;
;;;;;
;2680790..2680871;;ctc;;
;;;;;
comp;2747806..2747879;;agg;;
;;;;;
;3029047..3029122;;acc;;
;;;;;
comp;3076236..3076352;;5s;;152
comp;3076505..3079493;;23s;;194
comp;3079688..3079763;;gca;;22
comp;3079786..3079863;;atc;;187
comp;3080051..3081608;;16s;;
;;;;;
comp;3144286..3144357;;aaa;;
;;;;;
;3156732..3156804;;gaa;;
;;;;;
;3253990..3254063;;cgg;;
;;;;;
comp;3793996..3794069;;ccg;;
;;;;;
;3806164..3806249;;tta;;
;;;;;
comp;3915708..3915789;;cta;;
;;;;;
comp;3920245..3920317;;aag;@2;*248
comp;3920566..3920639;;aga;;*140
comp;3920780..3920854;;cac;;18
comp;3920873..3920946;;cga;;*134
comp;3921081..3921154;;cca;;
;;;;;
comp;4121675..4121749;;ggc;;
;;;;;
comp;4195371..4195460;;tcc;;*278
comp;4195739..4195829;;tcg;;
;;;;;
;4456675..4456764;;tca;;27
;4456792..4456883;;agc;;73
;4456957..4457033;;cgt;;

ade cumuls[modifier | modifier le wikicode]

cvi cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;2;1;0;
;16 23 5s 0;0;20;2;
;16 atc gca;2;40;2;2
;16 23 5s a;0;60;2;
;max a;2;80;2;
;a doubles;0;100;0;
;spéciaux;0;120;0;
;total aas;4;140;2;
sans ;opérons;33;160;0;
;1 aa;27;180;0;
;max a;5;200;0;
;a doubles;0;;2;
;total aas;45;;12;2
total aas;;49;;;
remarques;;2;;;
avec jaune;;;moyenne;93;
;;;variance;90;
sans jaune;;;moyenne;39;22
;;;variance;24;0

ade blocs[modifier | modifier le wikicode]

ade blocs;;;;;
16s;187;1558;5s;152;117
atc;22;;23s;194;2989
gca;194;;gca;22;
23s;152;2989;atc;187;
5s;;117;16s;;1558

ade remarques[modifier | modifier le wikicode]

ade;;;;;;;49
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;2;acc;1;aac;1;agc;1
ctc;1;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;1
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;2;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;1;ccg;1;cag;1;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

actino[modifier | modifier le wikicode]

Actinoplanes sp. SE50/110[modifier | modifier le wikicode]

ase opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Acti_SE50_110/actiSp_SE50_110-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_017803.1;ase;;genome;;;;;;;;
71.15%GC;13.8.19 Paris;16s 6;;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd;protéines
Actinoplanes sp. SE50/110;;;;;;;;;;;
;12658..13392;;CDS;;78;78;;;245;;
;13471..13547;;atc;@1;242;;*242;;;;
;13790..13862;;gca;;202;202;;;;;
comp;14065..14607;;CDS;;;;;;181;;
;;;;;;;;;;;
;153733..155094;;CDS;;556;*556;;;454;;
;155651..157174;;16s;;308;;;;1524;;
;157483..160591;;23s;;99;;;;3109;;
;160691..160807;;5s;;134;134;;;117;;
comp;160942..161988;;CDS;;;;;;349;;
;;;;;;;;;;;
comp;45153..45968;;CDS;;276;276;;;272;;
comp;46245..46330;;ctg;;257;257;;;;;
;46588..47385;;CDS;;;;;;266;;
;;;;;;;;;;;
;568633..569007;;CDS;;492;*492;;;125;;
;569500..571022;;16s;;308;;;;1523;;
;571331..574439;;23s;;108;;;;3109;;
;574548..574664;;5s;;245;245;;;117;;
;574910..576340;;CDS;;;;;;477;;
;;;;;;;;;;;
comp;66324..66533;;CDS;;177;177;;;70;;
comp;66711..66784;;ggg;;151;151;;;;;
comp;66936..67442;;CDS;;;;;;169;;
;;;;;;;;;;;
comp;145264..145572;;CDS;;595;*595;;;103;;
comp;146168..146244;;ttc;;12;;12;;;;
comp;146257..146333;;gac;;62;;62;;;;
comp;146396..146468;;gaa;;338;338;;;;;
comp;146807..148066;;CDS;;;;;;420;;
;;;;;;;;;;;
;164168..164716;;CDS;;92;92;;;183;;
;164809..164883;;aaa;;250;250;;;;;
;165134..166444;;CDS;;;;;;437;;
;;;;;;;;;;;
comp;457033..458760;;CDS;;116;116;;;*576;;
;458877..458950;;acg;;74;74;;;;;
comp;459025..460758;;CDS;;;;;;*578;;
;;;;;;;;;;;
;627485..628396;;CDS;;42;42;;;304;;
;628439..628515;;gac;;5;5;;;;;
comp;628521..629174;;CDS;;;;;;218;;
;;;;;;;;;;;
;645098..645421;;CDS;;355;355;;;108;;
;645777..645849;;agg;;459;*459;;;;;
comp;646309..648462;;CDS;;;;;;*718;;
;;;;;;;;;;;
;747312..748337;;CDS;;430;*430;;;342;;
comp;748768..748851;;tac;;148;148;;;;;
;749000..749491;;CDS;;;;;;164;;
;;;;;;;;;;;
;752175..754703;;CDS;;94;94;;;*843;;
;754798..754873;;acc;;44;;44;;;;
;754918..754990;;atg;;138;138;;;;;
;755129..755296;;CDS;;;;;;56;;
;;;;;;;;;;;
;755829..756224;;CDS;;79;79;;;132;;
;756304..756376;;tgg;;103;103;;;;;
;756480..756857;;CDS;;;;;;126;;
;;;;;;;;;;;
;940643..942004;;CDS;;55;55;;;454;;
;942060..942142;;taa;;221;221;;;;;
;942364..943218;;CDS;;;;;;285;;
;;;;;;;;;;;
comp;1155560..1155901;;CDS;;200;200;;;114;;
comp;1156102..1156177;;gcc;;89;89;;;;;
comp;1156267..1156824;;CDS;;;;;;186;;
;;;;;;;;;;;
;1222705..1223634;;CDS;;259;259;;;310;;
comp;1223894..1223980;;cta;;244;244;;;;;
comp;1224225..1224701;;CDS;;;;;;159;;
;;;;;;;;;;;
;1237525..1238115;;CDS;;91;91;;;197;;
;1238207..1238282;;cac;;54;54;;;;;
comp;1238337..1238684;;CDS;;;;;;116;;
;;;;;;;;;;;
comp;1248040..1249266;;CDS;;132;132;;;409;;
;1249399..1249474;;aag;+;118;;*118;;;;
;1249593..1249668;;aag;2 aag;-15;*-15;;;;;
comp;1249654..1249878;;CDS;@2;;;;;75;;
;;;;;;;;;;;
;1335812..1336096;;CDS;;296;296;;;95;;
comp;1336393..1336465;;aga;;13;13;;;;;
comp;1336479..1337558;;CDS;;;;;;360;;
;;;;;;;;;;;
comp;1399552..1400070;;CDS;;376;376;;;173;;
comp;1400447..1400520;;gga;;130;;*130;;;;
;1400651..1400724;;cca;;38;38;;;;;
;1400763..1402112;;CDS;;;;;;450;;
;;;;;;;;;;;
comp;1406634..1406849;;CDS;;586;*586;;;72;;
;1407436..1408958;;16s;;307;;;;1523;;
;1409266..1412374;;23s;;99;;;;3109;;
;1412474..1412590;;5s;;122;122;;;117;;
comp;1412713..1413510;;CDS;;;;;;266;;
;;;;;;;;;;;
comp;1519931..1520254;;CDS;;217;217;;;108;;
;1520472..1520544;;aac;;315;315;;;;;
;1520860..1522122;;CDS;;236;236;;;421;;
;1522359..1522432;;atg;;1097;*1097;;;;;
< comp;1523530..1523919;;CDS;;;;;;130;;
;;;;;;;;;;;
;1604562..1605026;;CDS;;38;38;;;155;;
;1605065..1605139;;gta;;357;357;;;;;
<>;1605497..1605583;;CDS;;;;;;29;;
;;;;;;;;;;;
comp;1935668..1936510;;CDS;;317;317;;;281;;
comp;1936828..1936904;;ttg;;131;131;;;;;
;1937036..1937656;;CDS;;;;;;207;;
;;;;;;;;;;;
;2434408..2435559;;CDS;;19;19;;;384;;
comp;2435579..2435661;;ctc;;151;151;;;;;
;2435813..2438881;;CDS;;;;;;*1023;;
;;;;;;;;;;;
comp;2570204..2570824;;CDS;;794;*794;;;207;;
;2571619..2573141;;16s;;315;;;;1523;;
;2573457..2576562;;23s;;98;;;;3106;;
;2576661..2576777;;5s;;247;247;;;117;;
comp;2577025..2577462;;CDS;;;;;;146;;
;;;;;;;;;;;
comp;4900233..4901780;;CDS;;19;19;;;*516;;
comp;4901800..4901878;;tgc;;29;;29;;;;
comp;4901908..4901981;;gcg;;19;19;;;;;
comp;4902001..4902321;;CDS;;23;23;;;107;;
comp;4902345..4902417;;gac;;31;31;;;;;
comp;4902449..4903369;;CDS;;;;;;307;;
;;;;;;;;;;;
;5443888..5444526;;CDS;;409;*409;;;213;;
;5444936..5445012;;ctc;;17;;17;;;;
;5445030..5445114;;tac;;29;29;;;;;
comp;5445144..5446565;;CDS;;;;;;474;;
;;;;;;;;;;;
;6208479..6209489;;CDS;;101;101;;;337;;
comp;6209591..6209666;;cgg;;9;;9;;;;
comp;6209676..6209749;;cca;;17;;17;;;;
comp;6209767..6209859;;agc;;5;;5;;;;
comp;6209865..6209939;;ctg;;4;;4;;;;
comp;6209944..6210015;;cag;;8;;8;;;;
comp;6210024..6210100;;ggc;;4;;4;;;;
comp;6210105..6210177;;cgt;;3;;3;;;;
comp;6210181..6210254;;gcc;;43;;43;;;;
comp;6210298..6210369;;tgg;;562;*562;;;;;
comp;6210932..6212365;;CDS;;;;;;478;;
;;;;;;;;;;;
;6397923..6398423;;CDS;;699;*699;;;167;;
;6399123..6399196;;tgg;;199;;*199;;;;
;6399396..6399468;;ggg;;157;;*157;;;;
;6399626..6399701;;gcc;;61;;61;;;;
;6399763..6399837;;gag;;78;;78;;;;
;6399916..6399992;;gga;;359;;*359;;;;
;6400352..6400426;;ttg;;1;;1;;;;
;6400428..6400500;;acc;;5;;5;;;;
;6400506..6400577;;ggc;;25;25;;;;;
;6400603..6401055;;CDS;;35;35;;;151;;
;6401091..6401163;;cag;;110;;*110;;;;
;6401274..6401350;;ctc;;1;;1;;;;
;6401352..6401427;;acg;;1;;1;;;;
;6401429..6401503;;ctg;;5;;5;;;;
;6401509..6401584;;gcg;;30;;30;;;;
;6401615..6401686;;gac;;5;;5;;;;
;6401692..6401779;;agc;;1;;1;;;;
;6401781..6401854;;atc;;6;6;;;;;
;6401861..6402227;;ncRNA;@3;7;7;;;;;
;6402235..6402309;;cgt;;10;;10;;;;
;6402320..6402395;;other;@4;11;;11;;;;
;6402407..6402477;;aag;;14;;14;;;;
;6402492..6402565;;aga;;11;;11;;;;
;6402577..6402650;;aaa;;1;;1;;;;
;6402652..6402727;;atg;;1;;1;;;;
;6402729..6402804;;gtc;;1;;1;;;;
;6402806..6402879;;gaa;;5;;5;;;;
;6402885..6402958;;aac;;44;;44;;;;
;6403003..6403088;;tcc;;1;;1;;;;
;6403090..6403163;;gtg;;2;;2;;;;
;6403166..6403239;;cac;;93;;*93;;;;
;6403333..6403405;;other;;411;*411;;;;;
comp;6403817..6404185;;CDS;;;;;;123;;
;;;;;;;;;;;
;6543230..6543619;;CDS;;412;*412;;;130;;
;6544032..6544106;;ctg;;152;;*152;;;;
;6544259..6544331;;gca;;410;*410;;;;;
;6544742..6545917;;CDS;;;;;;392;;
;;;;;;;;;;;
;6934653..6935819;;CDS;;69;69;;;389;;
comp;6935889..6935962;;ccc;;51;51;;;;;
comp;6936014..6937450;;CDS;;;;;;479;;
;;;;;;;;;;;
comp;6991952..6992437;;CDS;;174;174;;;162;;
comp;6992612..6992728;;5s;;170;;;;117;;
comp;6992899..6996006;;23s;;307;;;;3108;;
comp;6996314..6997836;;16s;;531;*531;;;1523;;
comp;6998368..6999624;;CDS;;;;;;419;;
;;;;;;;;;;;
;7455514..7456608;;CDS;;167;167;;;365;;
comp;7456776..7456847;;gtg;;55;55;;;;;
comp;7456903..7457310;;CDS;;;;;;136;;
;;;;;;;;;;;
;7481671..7483989;;CDS;;83;83;;;*773;;
comp;7484073..7484189;;5s;;169;;;;117;;
comp;7484359..7487466;;23s;;315;;;;3108;;
comp;7487782..7489304;;16s;;800;*800;;;1523;;
comp;7490105..7490731;;CDS;;;;;;209;;
;;;;;;;;;;;
;7670534..7671652;;CDS;;136;136;;;373;;
comp;7671789..7671863;;gtc;;18;;18;;;;
comp;7671882..7671952;;tgc;;38;;38;;;;
comp;7671991..7672063;;ggc;;116;116;;;;;
comp;7672180..7674045;;CDS;;;;;;*622;;
;;;;;;;;;;;
;7710075..7711193;;CDS;;136;136;;;373;;
comp;7711330..7711404;;gtc;;28;;28;;;;
comp;7711433..7711503;;tgc;;38;;38;;;;
comp;7711542..7711614;;ggc;;112;112;;;;;
;7711727..7712905;;CDS;;;;;;393;;
;;;;;;;;;;;
;8111157..8111843;;CDS;;546;*546;;;229;;
comp;8112390..8112465;;gag;+;532;;*532;;;;
comp;8112998..8113070;;gag;2 gag;57;;57;;;;
comp;8113128..8113199;;cag;;451;*451;;;;;
comp;8113651..8114457;;CDS;;;;;;269;;
;;;;;;;;;;;
;8275151..8275810;;CDS;;65;65;;;220;;
;8275876..8275950;;cgg;;416;*416;;;;;
comp;8276367..8276921;;CDS;;;;;;185;;
;;;;;;;;;;;
comp;8391343..8392530;;CDS;;255;255;;;396;;
comp;8392786..8392862;;atg;;296;296;;;;;
comp;8393159..8394607;;CDS;;;;;;483;;
;;;;;;;;;;;
comp;8397029..8399113;;CDS;;596;*596;;;*695;;
comp;8399710..8399786;;atg;;71;71;;;;;
comp;8399858..8402857;;CDS;;;;;;*1000;;
;;;;;;;;;;;
comp;8601686..8603128;;CDS;;81;81;;;481;;
comp;8603210..8603280;;caa;;37;37;;;;;
comp;8603318..8604199;;CDS;;;;;;294;;
;;;;;;;;;;;
;8623005..8623730;;CDS;;64;64;;;242;;
comp;8623795..8623871;;gcg;;171;171;;;;;
comp;8624043..8624792;;CDS;;;;;;250;;
;;;;;;;;;;;
comp;8821061..8822146;;CDS;;136;136;;;362;;
;8822283..8822356;;aca;;175;175;;;;;
comp;8822532..8824421;;CDS;;;;;;*630;;
;;;;;;;;;;;
;8945870..8946763;;CDS;;190;190;;;298;;
;8946954..8947030;;ccg;;204;204;;;;;
comp;8947235..8947531;;CDS;;;;;;99;;
;;;;;;;;;;;
comp;8963177..8966704;;CDS;;104;104;;;*1176;;
comp;8966809..8966904;;ncRNA;;83;83;*83;;;;
;8966988..8967075;;tcc;;270;270;;;;;
comp;8967346..8967687;;CDS;;;;;;114;;
;;;;;;;;;;;
;8968639..8969070;;CDS;;521;*521;;;144;;
comp;8969592..8969681;;tcg;;116;116;;;;;
;8969798..8970505;;CDS;;;;;;236;;
;;;;;;;;;;;
;9077764..9078855;;CDS;;326;326;;;364;;
comp;9079182..9079256;;cgt;;370;370;;;;;
comp;9079627..9082830;;CDS;;;;;;*1068;;
;;;;;;;;;;;
comp;9084051..9086675;;CDS;;560;*560;;;*875;;
comp;9087236..9087311;;cgt;;40;;40;;;;
comp;9087352..9087442;;agc;;399;399;;;;;
;9087842..9089017;;CDS;;;;;;392;;
;;;;;;;;;;;
comp;9100587..9101549;;CDS;;77;77;;;321;;
;9101627..9101714;;tca;;144;144;;;;;
comp;9101859..9102145;;CDS;;;;;;96;;

ase cumuls[modifier | modifier le wikicode]

ase cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;6;1;8;-;1;1;1;;100;8;30;1
;16 23 5s 0;6;20;19;;50;16;20;;200;29;60;1
;16 atc gca;0;40;6;;100;19;40;;300;19;90;3
;16 23 5s a;0;60;4;;150;17;60;;400;19;120;10
;max a;0;80;3;;200;9;80;;500;14;150;9
;a doubles;0;100;2;;250;9;100;;600;3;180;8
;autres;0;120;2;;300;7;120;;700;3;210;8
;total aas;0;140;1;;350;4;140;;800;2;240;5
sans ;opérons;45;160;2;;400;5;160;;900;2;270;6
;1 aa;31;180;0;;450;6;180;;1000;1;300;5
;max a;29;200;1;;500;3;200;;1100;2;330;4
;a doubles;2;;3;;;13;;;;1;;43
;total aas;98;;51;0;;109;;0;;103;;103
total aas;;98;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;58;;;229;;;;328;;
;;;variance;98;;;206;;;;173;;
sans jaune;;;moyenne;19;;;147;;;;254;;179
;;;variance;21;;;104;;;;111;;62

ase blocs[modifier | modifier le wikicode]

ase blocs;;;;;;
CDS;556;454;492;125;586;72
16s;308;1524;308;1523;307;1523
23s;99;3109;108;3109;99;3109
5s;134;117;245;117;122;117
CDS;;349;;477;;266
;;;;;;
CDS;794;207;531;419;800;209
16s;315;1523;307;1523;315;1523
23s;98;3106;170;3108;169;3108
5s;247;117;174;117;83;117
CDS;;146;;162;;773

blo[modifier | modifier le wikicode]

blo opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Bifi_long_NCC2705/bifiLong-tRNAs.fa;gtRNAdb;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_004307.2;blo;genome;57;;;
60%GC;30.6.19 Paris;16s  4;NCBI;gtRNAdb;doubles;intercalaires
;Bifidobacterium longum NCC2705;;;;;
;115187..115260;;val;gta;;
;;;;;;
;159243..160772;;16s;;@1;430
;161203..164268;;23s;;;168
;164437..164556;;5s;;;
;;;;;;
comp;207382..207457;;tgg;tgg;;
;;;;;;
comp;382849..382924;;aac;aac;+;43
comp;382968..383040;;aac;aac;2 aac;
;;;;;;
comp;440078..440150;;aac;aac;;
;;;;;;
;503549..503624;;gly;ggc;+;24
;503649..503719;;tgc;tgc;2 ggc;41
;503761..503835;;val;gtc;;45
;503881..503953;;val;gtg;;31
;503985..504060;;gly;ggc;;
;;;;;;
;521008..521084;;pro;ccc;;
;;;;;;
;648764..648851;;leu;ctc;;
;;;;;;
comp;747296..747369;;arg;cgt;+;29
comp;747399..747472;;arg;cgt;2 cgt;
;;;;;;
;775646..775716;;gln;caa;;
;;;;;;
;778709..778784;;ala;gcc;+;86
;778871..778946;;ala;gcc;2 gcc;
;;;;;;
;793729..793805;;pro;cca;;
;;;;;;
comp;804390..804463;;leu;ttg;;
;;;;;;
comp;841055..841136;;leu;tta;;
;;;;;;
;937056..937131;;cac;cac;;
;;;;;;
comp;981177..981253;;arg;aga;;
;;;;;;
;1202433..1202505;;thr;acg;;87
;1202593..1202676;;leu;cta;;
;;;;;;
;1208139..1208211;;thr;acg;;
;;;;;;
comp;1264390..1264465;;val;gtg;;48
comp;1264514..1264585;;val;gtc;;46
comp;1264632..1264704;;gly;ggc;;
;;;;;;
comp;1280591..1280666;;arg;cgg;;
;;;;;;
;1295466..1295542;;atg;atgf;;
;;;;;;
comp;1350001..1350074;;lys;aag;;
;;;;;;
comp;1388875..1388950;;lys;aaa;;
;;;;;;
;1410594..1410681;;ser;tcc;;
;;;;;;
comp;1424793..1424867;;gln;cag;;36
comp;1424904..1424979;;glu;gag;;
;;;;;;
comp;1524142..1524215;;gly;ggg;;
;;;;;;
;1534802..1534887;;leu;ctg;;
;;;;;;
;1606163..1606236;;ile;atc;;42
;1606279..1606351;;ala;gca;;
;;;;;;
comp;1646835..1646911;;thr;aca;;
;;;;;;
;1705902..1707431;;16s;;;429
;1707861..1710926;;23s;;;168
;1711095..1711215;;5s;;;
;;;;;;
;1712083..1713614;;16s;;;422
;1714037..1717102;;23s;;;168
;1717271..1717390;;5s;;;
;;;;;;
;1769952..1770027;;ala;gcg;;
;;;;;;
;1905665..1905740;;tgg;tgg;;
;;;;;;
;1908902..1910431;;16s;;;428
;1910860..1913926;;23s;;;168
;1914095..1914214;;5s;;;
;;;;;;
;1936132..1936205;;gly;gga;;
;;;;;;
;1971396..1971477;;tac;tac;;1
;1971479..1971550;;thr;acc;;4
;1971555..1971631;;atg;atgj;;
;;;;;;
;1979312..1979401;;ser;agc;;
;;;;;;
;2016025..2016112;;ser;tcg;;
;;;;;;
;2047072..2047159;;ser;tca;;
;;;;;;
comp;2068637..2068713;;pro;ccg;;
;;;;;;
comp;2085402..2085473;;glu;gaa;;
;;;;;;
;2087969..2088042;;gac;gac;;47
;2088090..2088165;;ttc;ttc;;
;;;;;;
;2110850..2110926;;gac;gac;;
;;;;;;
;2130626..2130699;;atg;atgi;;
;;;;;;
;2171440..2171512;;arg;agg;;

blo cumuls[modifier | modifier le wikicode]

blo cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;4;1;1;-
;16 23 5s 0;4;20;1;
;16 atc gca;0;40;4;
;16 23 5s a;0;60;7;
;max a;0;80;0;
;a doubles;0;100;2;
;spéciaux;0;120;0;
;total aas;0;140;0;
sans ;opérons;41;160;0;
;1 aa;31;180;0;
;max a;5;200;0;
;a doubles;4;;0;
;total aas;55;;15;0
total aas;;55;;;
remarques;;1;;;
avec jaune;;;moyenne;41;
;;;variance;24;
sans jaune;;;moyenne;34;
;;;variance;16;

blo blocs[modifier | modifier le wikicode]

blo blocs;;;;
16s;430;1530;422;1532
23s;168;3066;168;3066
5s;;120;;120
;;;;
16s;429;1530;428;1530
23s;168;3066;168;3067
5s;;121;;120

sma[modifier | modifier le wikicode]

sma opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Stre_aver_MA_4680_NBRC_14893/streAver_MA_4680_NBRC_14893-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_003155.5;sma;;;;
70%GC;30.6.19 Paris;16s  6;74;doubles;intercalaires
;Streptomyces avermitilis MA-4680;;;;
;357776..357847;;gtg;;
;;;;;
comp;1219274..1219346;;gga;;
;;;;;
comp;1225751..1225823;;gga;;
;;;;;
;1675869..1675942;;atgf;;
;;;;;
comp;1965347..1965423;;ccc;;
;;;;;
comp;1992012..1992088;;ccc;;
;;;;;
comp;2222599..2222686;;ctc;;
;;;;;
comp;3072632..3072707;;acc;;
;;;;;
comp;3073568..3073684;;5s;@1;84
comp;3073769..3076918;;23s;;288
comp;3077207..3078737;;16s;;
;;;;;
comp;3295252..3295324;;gag;+;20
comp;3295345..3295416;;cag;3 gag ;21
comp;3295438..3295510;;gag;2 cag;62
comp;3295573..3295645;;gag;;42
comp;3295688..3295759;;cag;;
;;;;;
;3655871..3655942;;cgg;;
;;;;;
comp;3813093..3813166;;atgf;;
;;;;;
comp;3815457..3815530;;atgf;;
;;;;;
comp;4362610..4362695;;tta;;
;;;;;
;4410534..4410608;;caa;;
;;;;;
comp;4542466..4542542;;gcg;;
;;;;;
;4589760..4589835;;agg;;
;;;;;
comp;4886830..4886906;;aca;;
;;;;;
comp;5024109..5024225;;5s;;84
comp;5024310..5027458;;23s;;288
comp;5027747..5029277;;16s;;
;;;;;
comp;5051970..5052043;;atgf;;
;;;;;
comp;5055486..5055561;;aaa;;
;;;;;
;5063087..5063159;;gaa;;47
;5063207..5063281;;gac;;24
;5063306..5063382;;ttc;;
;;;;;
;5068123..5068197;;gac;;
;;;;;
;5081640..5081711;;gga;;79
;5081791..5081866;;ggc;;
;;;;;
;5085779..5085854;;ggc;;
;;;;;
;5095224..5095311;;tcc;;
;;;;;
;5129698..5129782;;tcg;;
;;;;;
comp;5154937..5155009;;cgt;;205
comp;5155215..5155305;;agc;;
;;;;;
comp;5177691..5177777;;tca;;
;;;;;
comp;5206939..5207028;;agc;;
;;;;;
comp;5299302..5299378;;atc;;
;;;;;
;5304905..5304977;;gca;;
;;;;;
;5322106..5322192;;ctg;;
;;;;;
comp;5452769..5452842;;ggg;;
;;;;;
comp;5594481..5594554;;ccg;;
;;;;;
;5650316..5650389;;acg;;
;;;;;
;5759342..5760872;;16s;;288
;5761161..5764309;;23s;;84
;5764394..5764510;;5s;;
;;;;;
;5950170..5950251;;tac;;
;;;;;
;5956602..5956674;;acc;;46
;5956721..5956793;;atg;;
;;;;;
;5964532..5964607;;tgg;;
;;;;;
;6124386..6125916;;16s;;288
;6126205..6129353;;23s;;84
;6129438..6129554;;5s;;
;;;;;
comp;6242261..6242335;;tgc;;
;;;;;
comp;6279029..6279112;;cta;;
;;;;;
comp;6329202..6329278;;aag;;
;;;;;
comp;6335068..6335141;;aag;;
;;;;;
comp;6349312..6349385;;aag;;
;;;;;
comp;6372705..6372777;;cac;;
;;;;;
comp;6501509..6501584;;aga;;
;;;;;
comp;6604435..6604508;;gga;;153
comp;6604662..6604738;;cca;;
;;;;;
;6653846..6653918;;gcc;;
;;;;;
;6658303..6658375;;gcc;;
;;;;;
;6875603..6875675;;aac;+;5
;6875681..6875753;;aac;2 aac;166
;6875920..6875996;;atgi;;
;;;;;
;7021984..7022058;;gta;;
;;;;;
;7025336..7025415;;gtg;;
;;;;;
comp;7471270..7471342;;ttg;;
;;;;;
;7765513..7767043;;16s;;284
;7767328..7770477;;23s;;133
;7770611..7770727;;5s;;
;;;;;
comp;7937463..7937550;;ctc;;
;;;;;
comp;8122352..8122426;;gtc;+;40
comp;8122467..8122538;;gtc;3 gtc;19
comp;8122558..8122629;;gtc;;1
comp;8122631..8122704;;tgc;;38
comp;8122743..8122815;;ggc;;
;;;;;
;8129564..8129635;;gtg;;
;;;;;
;8139938..8140012;;gtg;;
;;;;;
;8328596..8330126;;16s;;288
;8330415..8333563;;23s;;84
;8333648..8333764;;5s;;
;;;;;
;8576989..8577062;;ccc;;

sma cumuls[modifier | modifier le wikicode]

sma cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;6;1;1;-
;16 23 5s 0;6;20;3;
;16 atc gca;0;40;4;
;16 23 5s a;0;60;3;
;max a;0;80;2;
;a doubles;0;100;0;
;spéciaux;0;120;0;
;total aas;0;140;0;
sans ;opérons;56;160;1;
;1 aa;48;180;1;
;max a;5;200;0;
;a doubles;3;;1;
;total aas;72;;16;0
total aas;;72;;;
remarques;;1;;;
avec jaune;;;moyenne;61;
;;;variance;61;
sans jaune;;;moyenne;34;
;;;variance;22;

sma blocs[modifier | modifier le wikicode]

sma blocs;;;;;;
5s;84;117;84;117;288;1531
23s;288;3150;288;3149;84;3149
16s;;1531;;1531;;117
;;;;;;
16s;288;1531;284;1531;288;1531
23s;84;3149;133;3150;84;3149
5s;;117;;117;;117

ksk[modifier | modifier le wikicode]

ksk opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Kita_seta_KM_6054/kitaSeta_KM_6054-tRNAs.fa;gtRNAdb;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_016109.1;ksk;;;;
72%GC;30.6.19 Paris;16s  9;74;doubles;intercalaires
;Kitasatospora setae KM-6054;;;;
comp;631024..631098;;act;;
;;;;;
;976172..976245;;tgc;;
;;;;;
comp;1615691..1615765;;gtg;+;206
comp;1615972..1616046;;gtg;2 gtg;
;;;;;
;1621501..1621576;;ggc;;76
;1621653..1621726;;tgc;;36
;1621763..1621834;;gtc;+;34
;1621869..1621940;;gtc;3 gtc;37
;1621978..1622052;;gtc;;
;;;;;
comp;1707344..1707460;;5s;@1;73
comp;1707534..1710667;;23s;;267
comp;1710935..1712463;;16s;;
;;;;;
comp;1888620..1888736;;5s;;73
comp;1888810..1891942;;23s;;267
comp;1892210..1893738;;16s;;
;;;;;
;1970574..1970661;;ctc;;
;;;;;
;2264495..2264580;;ttg;;
;;;;;
comp;2741186..2741257;;gta;;
;;;;;
comp;2788071..2788147;;atg;;
;;;;;
comp;2790422..2790494;;aac;+;5
comp;2790500..2790572;;aac;2 aac;
;;;;;
comp;2887231..2887303;;gcc;+;269
comp;2887573..2887645;;gcc;3 gcc;38
comp;2887684..2887756;;gcc;@2;
;;;;;
comp;2932411..2932487;;cca;;151
direct;2932639..2932712;;gga;;
;;;;;
comp;2982955..2983071;;5s;;73
comp;2983145..2986276;;23s;;266
comp;2986543..2988071;;16s;;
;;;;;
;3018063..3018138;;cac;;
;;;;;
;3036654..3036730;;aag;;
;;;;;
;3044201..3044277;;aag;;
;;;;;
;3111827..3111900;;aag;;129
;3112030..3112103;;aag;;
;;;;;
;3157748..3157834;;cta;;
;;;;;
;3210241..3210315;;tgc;;
;;;;;
comp;3289891..3290007;;5s;;73
comp;3290081..3293213;;23s;;267
comp;3293481..3295009;;16s;;
;;;;;
comp;3608705..3608777;;tgg;;
;;;;;
comp;3616894..3616969;;atg;;42
comp;3617012..3617084;;acc;;
;;;;;
comp;3618677..3618757;;tac;;
;;;;;
comp;3851412..3851488;;aca;;
;;;;;
comp;3987214..3987290;;acg;;
;;;;;
;4071208..4071281;;ccg;;
;;;;;
;4095099..4095186;;tcc;;
;;;;;
;4142544..4142633;;tcg;;
;;;;;
comp;4160864..4160939;;cgt;+;35
comp;4160975..4161050;;cgt;2 cgt;240
comp;4161291..4161381;;agc;@;
;;;;;
comp;4177523..4177608;;tca;;
;;;;;
comp;4240397..4240470;;ggg;;
;;;;;
;4285828..4285900;;ggc;+;51
;4285952..4286027;;ggc;2 ggc;
;;;;;
;4383368..4383444;;atc;;
;;;;;
;4385556..4385631;;gca;;
;;;;;
;4401492..4401575;;ctg;;
;;;;;
comp;4622975..4623048;;gac;;
;;;;;
comp;4640883..4640959;;ttc;;34
comp;4640994..4641067;;gac;;42
comp;4641110..4641182;;gaa;;
;;;;;
;4651832..4651904;;aaa;;
;;;;;
comp;4773547..4773620;;atg;;
;;;;;
comp;4774128..4774201;;atg;;
;;;;;
;4796510..4798038;;16s;;267
;4798306..4801439;;23s;;71
;4801511..4801627;;5s;;
;;;;;
;5027433..5027508;;agg;;
;;;;;
;5076388..5076464;;gcg;;
;;;;;
;5123784..5123856;;acc;;
;;;;;
;5132819..5132892;;caa;;
;;;;;
comp;5216466..5216550;;tta;;
;;;;;
;5430075..5430148;;atg;;
;;;;;
comp;5530949..5531020;;cgg;;
;;;;;
;5714968..5715039;;cag;;21
;5715061..5715133;;gag;+;38
;5715172..5715244;;gag;3 gag;13
;5715258..5715330;;gag;2 cag;4
;5715335..5715409;;cag;;
;;;;;
;5853168..5854696;;16s;;256
;5854953..5858085;;23s;;73
;5858159..5858275;;5s;;
;;;;;
;5932168..5933696;;16s;;256
;5933953..5937085;;23s;;71
;5937157..5937273;;5s;;
;;;;;
;6074082..6075610;;16s;;264
;6075875..6079006;;23s; ;73
;6079080..6079196;;5s;;
;;;;;
comp;6104344..6104419;;aga;;
;;;;;
;6400221..6401749;;16s;;267
;6402017..6405146;;23s; ;106
;6405253..6405369;;5s;;
;;;;;
;6485836..6485909;;ccc;;
;;;;;
;7355279..7355354;;tgc;;19
;7355374..7355449;;ggc;;
;;;;;
comp;7461078..7461165;;ctc;;

ksk cumuls[modifier | modifier le wikicode]

ksk cumuls;;;;;
;opérons;;Fréquences intercalaires tRNAs;;
;;effectif;gammes;sans rRNAs;avec rRNAs
avec rRNA;opérons;9;1;0;-
;16 23 5s 0;9;20;4;
;16 atc gca;0;40;8;
;16 23 5s a;0;60;3;
;max a;0;80;1;
;a doubles;0;100;0;
;spéciaux;0;120;0;
;total aas;0;140;1;
sans ;opérons;49;160;1;
;1 aa;37;180;0;
;max a;5;200;0;
;a doubles;7;;3;
;total aas;70;;21;0
total aas;;70;;;
remarques;;2;;;
avec jaune;;;moyenne;72;
;;;variance;79;
sans jaune;;;moyenne;33;
;;;variance;18;

ksk blocs[modifier | modifier le wikicode]

ksk blocs;;;;;;
;;;;;;
5s;73;117;73;117;73;117
23s;267;3134;267;3133;266;3132
16s;;1529;;1529;;1529
;;;;;;
16s;73;117;267;1529;256;1529
23s;267;3133;71;3134;73;3133
5s;;1529;;117;;117
;;;;;;
16s;256;1529;264;1529;267;1529
23s;71;3133;73;3132;106;3130
5s;;117;;117;;117

cyano[modifier | modifier le wikicode]

npu[modifier | modifier le wikicode]

npu opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Nost_punc_PCC_73102_ATCC_29133/nostPunc_PCC_73102_ATCC29133-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_010628.1;npu;;genome;;;;;;;;
41.4%GC;12.8.19 Paris;16s 4;79;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines
Nostoc punctiforme PCC 73102 ATCC 29133 ;;;;;;;;;;;
;199270..199464;;CDS;;237;237;;;65;;
comp;199702..199775;;agg;;33;33;;;;;
comp;199809..200906;;CDS;;;;;;366;;
;;;;;;;;;;;
comp;352653..353060;;CDS;;690;*690;;;136;;
comp;353751..353822;;ggc;;147;147;;;;;
comp;353970..354548;;CDS;;;;;;193;;
;;;;;;;;;;;
;503259..503606;;CDS;;145;145;;;116;;
;503752..503827;;atgj;+;-1;;*-1;;;;
;503827..503901;;atgj;2 atg;397;397;;;;;
;504299..505384;;CDS;@1;;;;;362;;
;;;;;;;;;;;
comp;777899..778429;;CDS;;34;34;;;177;;
;778464..778537;;cgt;;38;38;;;;;
comp;778576..779829;;CDS;;;;;;418;;
;;;;;;;;;;;
;878016..878609;;CDS;;384;384;;;198;;
;878994..879064;;tgc;;205;205;;;;;
;879270..879491;;CDS;;;;;;74;;
;;;;;;;;;;;
comp;951559..952671;;CDS;;53;53;;;371;;
;952725..952796;;acc;;310;310;;;;;
comp;953107..953340;;CDS;;;;;;78;;
;;;;;;;;;;;
comp;954493..955170;;CDS;;72;72;;;226;;
comp;955243..955315;;aga;;356;356;;;;;
;955672..956331;;CDS;;;;;;220;;
;;;;;;;;;;;
; 1054005..1054811;;CDS;;290;290;;;269;;
comp;1055102..1055172;;gga;;50;50;;;;;
comp;1055223..1056383;;CDS;;;;;;387;;
;;;;;;;;;;;
comp;1175326..1175523;;CDS;;247;247;;;66;;
comp;1175771..1175844;;ccg;;138;138;;;;;
;1175983..1176855;;CDS;;;;;;291;;
;;;;;;;;;;;
;1380042..1380593;;CDS;;226;226;;;184;;
comp;1380820..1380904;;tcc;;107;107;;;;;
;1381012..1381380;;CDS;;;;;;123;;
;;;;;;;;;;;
;1442145..1442867;;CDS;;32;32;;;241;;
;1442900..1442974;;ttc;;362;362;;;;;
;1443337..1444770;;CDS;;;;;;478;;
;;;;;;;;;;;
comp;1650791..1652236;;CDS;;133;133;;;482;;
comp;1652370..1652443;;gac;;111;111;;;;;
comp;1652555..1653088;;CDS;;;;;;178;;
;;;;;;;;;;;
comp;2020233..2021171;;CDS;;317;317;;;313;;
;2021489..2022985;;16s;;123;;;;1497;;
;2023109..2023185;;atc;;79;;;79;;;
;2023265..2023340;;gca;;249;;;;;;
;2023590..2026486;;23s;;59;;;;2897;;
;2026546..2026663;;5s;;230;230;;;118;;
> comp;2026894..2027373;;CDS;;;;;;160;;
;;;;;;;;;;;
comp;2303766..2304149;;CDS;;124;124;;;128;;
;2304274..2304349;;cac;;1362;*1362;;;;;
;2305712..2308132;;CDS;;;;;;*807;;
;;;;;;;;;;;
comp;3372671..3373291;;CDS;;143;143;;;207;;
;3373435..3373507;;gta;;415;*415;;;;;
;3373923..3374555;;CDS;;;;;;211;;
;;;;;;;;;;;
comp;3434121..3435443;;CDS;;204;204;;;441;;
comp;3435648..3435739;;agc;;141;141;;;;;
comp;3435881..3436813;;CDS;;;;;;311;;
;;;;;;;;;;;
;3439846..3440202;;CDS;@2;-19;*-19;;;119;;
comp;3440184..3440257;;gca;;48;;48;;;;
comp;3440306..3440378;;aca;+;8;;8;;;;
comp;3440387..3440462;;atgf;2 aca;11;;11;;;;
comp;3440474..3440546;;cta;;4;;4;;;;
comp;3440551..3440623;;ccg;;6;;6;;;;
comp;3440630..3440706;;ctc;;2;;2;;;;
comp;3440709..3440785;;ctg;;3;;3;;;;
comp;3440789..3440861;;cca;;1;;1;;;;
comp;3440863..3440940;;tta;;6;;6;;;;
comp;3440947..3441023;;ttg;;6;;6;;;;
comp;3441030..3441105;;caa;;3;;3;;;;
comp;3441109..3441181;;cag;;5;;5;;;;
comp;3441187..3441261;;aac;;6;;6;;;;
comp;3441268..3441365;;aca;;81;;*81;;;;
comp;3441447..3441521;;cgt;;4;;4;;;;
comp;3441526..3441615;;agc;;113;;*113;;;;
comp;3441729..3441800;;gaa;;58;;58;;;;
comp;3441859..3441933;;tgg;;88;;*88;;;;
comp;3442022..3442095;;tgc;;132;;*132;;;;
comp;3442228..3442301;;gac;;118;118;;;;;
comp;3442420..3442614;;CDS;;;;;;65;;
;;;;;;;;;;;
;3448311..3448919;;CDS;;80;80;;;203;;
comp;3449000..3449072;;gaa;;120;120;;;;;
;3449193..3449375;;CDS;;;;;;61;;
;;;;;;;;;;;
;4538041..4538745;;CDS;;151;151;;;235;;
;4538897..4538981;;tcg;;194;194;;;;;
;4539176..4540357;;CDS;;;;;;394;;
;;;;;;;;;;;
comp;4869164..4869988;;CDS;;584;*584;;;275;;
comp;4870573..4870646;;cca;;298;298;;;;;
comp;4870945..4871493;;CDS;;;;;;183;;
;;;;;;;;;;;
comp;5426384..5427841;;CDS;;100;100;;;486;;
comp;5427942..5428018;;atgf;;46;46;;;;;
comp;5428065..5429018;;CDS;;;;;;318;;
;;;;;;;;;;;
comp;5480844..5481563;;CDS;;407;*407;;;240;;
comp;5481971..5482043;;gcc;;94;94;;;;;
comp;5482138..5482332;;CDS;;;;;;65;;
;;;;;;;;;;;
;5510568..5511620;;CDS;;319;319;;;351;;
comp;5511940..5512057;;5s;;59;;;;118;;
comp;5512117..5515016;;23s;;249;;;;2900;;
comp;5515266..5515341;;gca;;82;;;82;;;
comp;5515424..5515497;;atc;;123;;;;;;
comp;5515621..5517117;;16s;;682;*682;;;1497;;
comp;5517800..5519035;;CDS;;;;;;412;;
;;;;;;;;;;;
comp;5572068..5572769;;CDS;;290;290;;;234;;
;5573060..5573132;;atgi;;153;153;;;;;
comp;5573286..5573720;;CDS;;;;;;145;;
;;;;;;;;;;;
;5573827..5574450;;CDS;;93;93;;;208;;
comp;5574544..5574615;;aca;;345;345;;;;;
;5574961..5575881;;CDS;;;;;;307;;
;;;;;;;;;;;
< comp;5655591..5655800;;CDS;;21;21;;;70;;
comp;5655822..5655893;;aac;;144;144;;;;;
comp;5656038..5656589;;CDS;;;;;;184;;
;;;;;;;;;;;
;5688669..5689538;;CDS;;75;75;;;290;;
;5689614..5689689;;ttc;;663;*663;;;;;
comp;5690353..5692080;;CDS;;;;;;*576;;
;;;;;;;;;;;
;5756596..5757801;;CDS;;66;66;;;402;;
;5757868..5757940;;cgg;;400;400;;;;;
comp;5758341..5759045;;CDS;;;;;;235;;
;;;;;;;;;;;
comp;6075820..6077016;;CDS;;175;175;;;399;;
comp;6077192..6077263;;ggg;;171;171;;;;;
comp;6077435..6078052;;CDS;;;;;;206;;
;;;;;;;;;;;
comp;6083633..6084493;;CDS;;676;*676;;;287;;
;6085170..6086666;;16s;;123;;;;1497;;
;6086790..6086866;;atc;;79;;;79;;;
;6086946..6087021;;gca;;249;;;;;;
;6087271..6090169;;23s;;59;;;;2899;;
;6090229..6090346;;5s;;176;176;;;118;;
comp;6090523..6090720;;CDS;;;;;;66;;
;;;;;;;;;;;
comp;6498176..6499135;;CDS;;149;149;;;320;;
comp;6499285..6499402;;5s;;59;;;;118;;
comp;6499462..6502360;;23s;;249;;;;2899;;
comp;6502610..6502685;;atc;;79;;;79;;;
comp;6502765..6502841;;gca;;123;;;;;;
comp;6502965..6504461;;16s;;315;315;;;1497;;
;6504777..6505643;;CDS;;;;;;289;;
;;;;;;;;;;;
;6889916..6890785;;CDS;;61;61;;;290;;
;6890847..6890918;;aaa;;294;294;;;;;
comp;6891213..6892148;;CDS;;;;;;312;;
;;;;;;;;;;;
;6948457..6949644;;CDS;;162;162;;;396;;
;6949807..6949888;;cta;;400;400;;;;;
;6950289..6950609;;CDS;;;;;;107;;
;;;;;;;;;;;
comp;6980662..6982233;;CDS;;171;171;;;*524;;
;6982405..6982478;;gtc;;1521;*1521;;;;;
comp;6984000..6985919;;CDS;;;;;;*640;;
;;;;;;;;;;;
;7066111..7067829;;CDS;;232;232;;;*573;;
comp;7068062..7068133;;caa;;270;270;;;;;
comp;7068404..7069606;;CDS;;;;;;401;;
;;;;;;;;;;;
comp;7071719..7071991;;CDS;;39;39;;;91;;
comp;7072031..7072114;;ttg;;109;109;;;;;
comp;7072224..7073345;;CDS;;;;;;374;;
;;;;;;;;;;;
comp;7074644..7076011;;CDS;;409;*409;;;456;;
;7076421..7076502;;ctg;;95;95;;;;;
;7076598..7077374;;CDS;;;;;;259;;
;;;;;;;;;;;
;7130044..7131132;;CDS;;131;131;;;363;;
comp;7131264..7131335;;acg;;33;33;;;;;
;7131369..7131662;;CDS;;;;;;98;;
;;;;;;;;;;;
;7224805..7225167;;CDS;;146;146;;;121;;
;7225314..7225386;;tgg;;378;378;;;;;
;7225765..7225986;;CDS;;;;;;74;;
;;;;;;;;;;;
comp;7346902..7348245;;CDS;;396;396;;;448;;
;7348642..7348724;;ctc;;127;127;;;;;
;7348852..7349475;;CDS;;;;;;208;;
;;;;;;;;;;;
;7506243..7506593;;CDS;;747;*747;;;117;;
comp;7507341..7507414;;ccc;;50;50;;;;;
comp;7507465..7507830;;CDS;;;;;;122;;
;;;;;;;;;;;
;7517008..7519347;;CDS;;167;167;;;*780;;
;7519515..7519588;;atgj;;213;213;;;;;
<> comp;7519802..7520109;;CDS;;;;;;103;;
;;;;;;;;;;;
comp;7571389..7571706;;CDS;;895;*895;;;106;;
comp;7572602..7572676;;aag;;63;63;;;;;
comp;7572740..7574992;;CDS;;;;;;*751;;
;;;;;;;;;;;
comp;7610323..7610769;;CDS;;481;*481;;;149;;
comp;7611251..7611323;;gca;;71;71;;;;;
;7611395..7612312;;CDS;;;;;;306;;
;;;;;;;;;;;
;7936008..7936736;;CDS;;65;65;;;243;;
;7936802..7936874;;gcg;;437;*437;;;;;
;7937312..7938874;;CDS;;;;;;*521;;
;;;;;;;;;;;
;7972961..7973239;;CDS;;313;313;;;93;;
comp;7973553..7973624;;acc;;88;;*88;;;;
comp;7973713..7973798;;tac;;124;124;;;;;
comp;7973923..7974897;;CDS;;;;;;325;;
;;;;;;;;;;;
;7975047..7975976;;CDS;;100;100;;;310;;
;7976077..7976161;;tca;;374;374;;;;;
;7976536..7978545;;CDS;;;;;;*670;;

npu cumuls[modifier | modifier le wikicode]

npu cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds chromosome;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;4;1;2;;1;1;1;;100;13;30;0
;16 23 5s 0;0;20;12;;50;10;40;;200;21;60;0
;16 atc gca;4;40;0;;100;14;80;;300;22;90;10
;16 23 5s a;0;60;2;;150;18;120;;400;19;120;9
;max a;2;80;0;3;200;9;160;;500;10;150;7
;a doubles;0;100;3;1;250;8;200;;600;4;180;3
;autres;0;120;1;;300;5;240;;700;2;210;10
;total aas;8;140;1;;350;6;280;;800;2;240;7
sans ;opérons;43;160;0;;400;9;320;;900;1;270;4
;1 aa;40;180;0;;450;4;360;;1000;0;300;6
;max a;20;200;0;;500;1;400;;1100;0;330;9
;a doubles;2;;0;;;9;;;;0;;29
;total aas;64;;21;4;;94;;0;;94;;94
total aas;;72;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;32;79;;254;;;;279;;
;;;variance;43;0;;254;;;;171;;
sans jaune;;;moyenne;11;;;176;;;;240;;188
;;;variance;17;;;111;;;;122;;85

npu blocs[modifier | modifier le wikicode]

npu blocs;;;;
CDS;317;313;676;287
16s;123;1497;123;1497
atc;79;;79;
gca;249;;249;
23s;59;2897;59;2899
5s;230;118;176;118
CDS;;160;;66
;;;;
CDS;319;351;149;320
5s;59;118;59;118
23s;249;2900;249;2899
gca;82;;79;
atc;123;;123;
16s;682;1497;315;1497
CDS;;412;;289

npu remarques[modifier | modifier le wikicode]

gtRNAdb;;;;;;;79;;cumuls;;;;;;;72
atgi;2;tct;;tat;;atgf;2;;atgi;1;tct;;tat;;atgf;2
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;2;tgc;2;;ttc;2;tcc;1;tac;1;tgc;2
atc;4;acc;1;aac;2;agc;2;;atc;4;acc;2;aac;2;agc;2
ctc;2;ccc;2;cac;2;cgt;2;;ctc;2;ccc;1;cac;1;cgt;2
gtc;1;gcc;1;gac;2;ggc;1;;gtc;1;gcc;1;gac;2;ggc;1
tta;1;tca;2;taa;;tga;;;tta;1;tca;1;taa;;tga;
ata;1;aca;2;aaa;2;aga;1;;ata;;aca;3;aaa;1;aga;1
cta;2;cca;2;caa;2;cga;;;cta;2;cca;2;caa;2;cga;
gta;1;gca;6;gaa;2;gga;1;;gta;1;gca;6;gaa;2;gga;1
ttg;3;tcg;1;tag;;tgg;2;;ttg;2;tcg;1;tag;;tgg;2
atgj;3;acg;1;aag;2;agg;1;;atgj;3;acg;1;aag;1;agg;1
ctg;2;ccg;2;cag;1;cgg;1;;ctg;2;ccg;2;cag;1;cgg;1
gtg;;gcg;1;gag;;ggg;1;;gtg;;gcg;1;gag;;ggg;1

pmg[modifier | modifier le wikicode]

pmg opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Proc_mari_MIT_9301/procMari_MIT_9301-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_009091.1;pmg;;genome;;;;;;;;
31.3%GC;13.8.19 Paris;16s 1;37;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd;protéines
Prochlorococcus marinus str. MIT 9301;;;;;;;;;;;
comp;74235..75521;;CDS;;4;4;;;429;;
comp;75526..75607;;ctt;;259;259;;;;;
;75867..77216;;CDS;;;;;;450;;
;;;;;;;;;;;
;132034..132708;;CDS;;49;49;;;225;;
;132758..132829;;aac;;566;*566;;;;;
;133396..133845;;CDS;;;;;;150;;
;;;;;;;;;;;
comp;239249..240268;;CDS;;170;170;;;340;;
comp;240439..240520;;cta;;71;71;;;;;
;240592..241041;;CDS;;;;;;150;;
;;;;;;;;;;;
comp;257573..258844;;CDS;;77;77;;;424;;
comp;258922..258995;;cgt;;86;86;;;;;
;259082..259333;;CDS;;;;;;84;;
;;;;;;;;;;;
comp;272771..274039;;CDS;;18;18;;;423;;
comp;274058..274130;;atgi;;141;141;;;;;
;274272..274832;;CDS;;;;;;187;;
;;;;;;;;;;;
;305431..305850;;CDS;;84;84;;;140;;
comp;305935..306010;;ttc;;91;91;;;;;
comp;306102..307331;;CDS;;;;;;410;;
;;;;;;;;;;;
;313891..314472;;CDS;;178;178;;;194;;
comp;314651..314722;;aca;;65;65;;;;;
comp;314788..315120;;CDS;;;;;;111;;
;;;;;;;;;;;
comp;320549..321988;;CDS;;603;*603;;;480;;
;322592..324074;;16s;;125;;;;;;
;324200..324273;;atc;;12;;;12;;;
;324286..324358;;gca;;256;;;;;;
;324615..327496;;23s;;60;;;;;;
;327557..327673;;5s;;43;43;;;;;
comp;327717..328595;;CDS;;;;;;293;;
;;;;;;;;;;;
comp;354976..355167;;CDS;;88;88;;;64;;
comp;355256..355327;;acc;;10;;10;;;;
comp;355338..355419;;tac;;102;102;;;;;
;355522..355962;;CDS;;;;;;147;;
;;;;;;;;;;;
comp;434230..435660;;CDS;;17;17;;;477;;
comp;435678..435751;;gac;;149;149;;;;;
comp;435901..436095;;CDS;;35;35;;;65;;
comp;436131..436203;;tgg;;53;53;;;;;
comp;436257..436727;;CDS;;;;;;157;;
;;;;;;;;;;;
;521448..522497;;CDS;;99;99;;;350;;
;522597..522682;;tta;;78;78;;;;;
;522761..522994;;CDS;;;;;;78;;
;;;;;;;;;;;
comp;609397..609897;;CDS;;249;249;;;167;;
comp;610147..610233;;tca;;404;*404;;;;;
;610638..611399;;CDS;;;;;;254;;
;;;;;;;;;;;
;774440..775240;;CDS;;210;210;;;267;;
comp;775451..775524;;ccc;;27;27;;;;;
comp;775552..776280;;CDS;;;;;;243;;
;;;;;;;;;;;
comp;828018..828392;;CDS;;49;49;;;125;;
;828442..828528;;tcc;;214;214;;;;;
;828743..830740;;CDS;;;;;;*666;;
;;;;;;;;;;;
;868731..869213;;CDS;;29;29;;;161;;
;869243..869316;;atgj;;67;67;;;;;
;869384..869671;;CDS;;;;;;96;;
;;;;;;;;;;;
;909742..910707;;CDS;;45;45;;;322;;
;910753..910829;;atgf;;591;*591;;;;;
;911421..911810;;CDS;;;;;;130;;
;;;;;;;;;;;
;996073..996609;;CDS;;16;16;;;179;;
comp;996626..996698;;gaa;;41;41;;;;;
comp;996740..997858;;CDS;;;;;;373;;
;;;;;;;;;;;
comp;1040019..1040135;;CDS;;177;177;;;39;;
;1040313..1040384;;aaa;;512;*512;;;;;
;1040897..1041004;;CDS;;;;;;36;;
;;;;;;;;;;;
;1044863..1045423;;CDS;;276;276;;;187;;
;1045700..1045773;;cca;;188;188;;;;;
comp;1045962..1046666;;CDS;;;;;;235;;
;;;;;;;;;;;
;1134197..1134427;;CDS;;251;251;;;77;;
comp;1134679..1134763;;tcg;;63;63;;;;;
comp;1134827..1135849;;CDS;;;;;;341;;
;;;;;;;;;;;
comp;1163424..1164092;;CDS;;138;138;;;223;;
;1164231..1164304;;aga;;27;27;;;;;
;1164332..1165600;;CDS;;;;;;423;;
;;;;;;;;;;;
;1212124..1212894;;CDS;;58;58;;;257;;
comp;1212953..1213025;;gcc;;129;129;;;;;
comp;1213155..1214180;;CDS;;;;;;342;;
;;;;;;;;;;;
;1253753..1255123;;CDS;;525;*525;;;457;;
;1255649..1255730;;ttg;;5;5;;;;;
;1255736..1256911;;CDS;;;;;;392;;
;;;;;;;;;;;
comp;1259549..1260784;;CDS;;131;131;;;412;;
;1260916..1260988;;cac;;72;72;;;;;
;1261061..1262455;;CDS;;;;;;465;;
;;;;;;;;;;;
;1275239..1277272;;CDS;;0;*0;;;*678;;
comp;1277273..1277343;;gga;;112;112;;;;;
;1277456..1278802;;CDS;;;;;;449;;
;;;;;;;;;;;
;1308006..1308797;;CDS;;50;50;;;264;;
;1308848..1308919;;gtc;;67;67;;;;;
;1308987..1309604;;CDS;;;;;;206;;
;;;;;;;;;;;
comp;1419657..1419893;;CDS;;54;54;;;79;;
;1419948..1420019;;acg;;100;100;;;;;
;1420120..1420440;;CDS;;;;;;107;;
;;;;;;;;;;;
;1453287..1454075;;CDS;;35;35;;;263;;
comp;1454111..1454199;;agc;;61;61;;;;;
comp;1454261..1455460;;CDS;;;;;;400;;
;;;;;;;;;;;
;1472925..1473932;;CDS;;94;94;;;336;;
;1474027..1474098;;caa;;16;16;;;;;
;1474115..1474891;;CDS;;;;;;259;;
;;;;;;;;;;;
comp;1485558..1486649;;CDS;;77;77;;;364;;
;1486727..1486800;;cgg;;11;11;;;;;
comp;1486812..1487258;;CDS;;;;;;149;;
;;;;;;;;;;;
comp;1500099..1501325;;CDS;;42;42;;;409;;
;1501368..1501438;;tgc;@1;364;364;;;;;
comp;1501803..1502447;;CDS;;;;;;215;;
;;;;;;;;;;;
comp;1517796..1518128;;CDS;;78;78;;;111;;
comp;1518207..1518280;;agg;;38;38;;;;;
;1518319..1518700;;ncRNA;;21;21;;;;;
;1518722..1519471;;CDS;;;;;;250;;
;;;;;;;;;;;
comp;1554202..1554633;;CDS;;45;45;;;144;;
comp;1554679..1554750;;ggc;;61;61;;;;;
comp;1554812..1555288;;CDS;;;;;;159;;
;;;;;;;;;;;
comp;1600898..1601284;;CDS;@2;-30;*-30;;;129;;
comp;1601255..1601326;;gta;;98;98;;;;;
;1601425..1602279;;CDS;;;;;;285;;

pmg cumuls[modifier | modifier le wikicode]

pmg cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds chromosome;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 300
avec rRNA;opérons;1;1;;;1;2;1;;100;9;30;0
;16 23 5s 0;0;20;1;1;50;22;40;;200;20;60;2
;16 atc gca;1;40;;;100;23;80;;300;15;90;6
;16 23 5s a;0;60;;;150;7;120;;400;10;120;4
;max a;2;80;;;200;4;160;;500;13;150;9
;a doubles;0;100;;;250;3;200;;600;0;180;5
;autres;0;120;;;300;3;240;;700;2;210;4
;total aas;2;140;;;350;0;280;;800;0;240;4
sans ;opérons;34;160;;;400;1;320;;900;0;270;8
;1 aa;33;180;;;450;1;360;;1000;0;300;2
;max a;2;200;;;500;0;400;;1100;0;330;1
;a doubles;0;;;;;5;;;;0;;24
;total aas;35;;1;1;;71;;0;;69;;69
total aas;;37;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;10;12;;127;;;;260;;
;;;variance;0;0;;146;;;;147;;
sans jaune;;;moyenne;;;;93;;;;248;;170
;;;variance;;;;76;;;;130;;74

pmg blocs[modifier | modifier le wikicode]

pmg bloc;;
CDS;603;480
16s;125;1483
atc;12;
gca;256;
23s;60;2882
5s;43;117
CDS;;293

pmg remarques[modifier | modifier le wikicode]

Remarques;;;;;;;37
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;1;cct;;cat;;cgc; 
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;1;acc;1;aac;1;agc;1
ctc;;ccc;1;cac;1;cgt;1
gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;
ata; ;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;
gta;1;gca;1;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;;agg;1
ctg;;ccg;;cag;;cgg;1
gtg;;gcg;;gag;;ggg;

bacteroide[modifier | modifier le wikicode]

myr[modifier | modifier le wikicode]

myr opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/bacteria/Myro_A21/myroSp_A21-tRNAs.fa;gtRNAdb;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP010327.1;myr;;genome;;;;;;;
34.1%GC;14.8.19 Paris;16s 8;101;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd
Myroides sp. A21;;;;;;;;;;
comp;151454..152776;;CDS;;270;270;;;441;
comp;153047..153134;;tca;;208;208;;;;
comp;153343..154476;;CDS;;;;;;378;
;;;;;;;;;;
;211346..212332;;CDS;;123;123;;;329;
comp;212456..212530;;gta;+;27;;27;;;
comp;212558..212635;;gta;5 gta;27;;27;;;
comp;212663..212740;;gta;;27;;27;;;
comp;212768..212845;;gta;;42;;42;;;
comp;212888..212965;;gta;;92;92;;;;
comp;213058..214275;;CDS;;;;;;406;
;;;;;;;;;;
comp;294948..295334;;CDS;;146;146;;;129;
comp;295481..295554;;aga;;28;;28;;;
comp;295583..295660;;cca;;7;;7;;;
comp;295668..295751;;agc;;280;280;;;;
;296032..297210;;CDS;;;;;;393;
;;;;;;;;;;
;327067..328053;;CDS;;112;112;;;329;
comp;328166..328241;;aaa;+;698;;*698;;;
comp;328940..329021;;ctc;6 aaa;87;;*87;;;
comp;329109..329184;;aaa;@1;31;;31;;;
comp;329216..329291;;aaa;;36;;36;;;
comp;329328..329403;;aaa;;45;;45;;;
comp;329449..329524;;aaa;;33;;33;;;
comp;329558..329633;;aaa;;129;129;;;;
;329763..330281;;CDS;;;;;;173;
;;;;;;;;;;
comp;353908..354384;;CDS;;259;259;;;159;
comp;354644..354753;;5s;;107;;;;110;
comp;354861..357744;;23s;;150;;;;2884;
comp;357895..357971;;gca;;88;;;88;;
comp;358060..358136;;atc;;75;;;;;
comp;358212..359735;;16s;;265;;;;1524;
comp;360001..360110;;5s;;103;;;;110;
comp;360214..363107;;23s;;150;;;;2894;
comp;363258..363334;;gca;;88;;;88;;
comp;363423..363499;;atc;;75;;;;;
comp;363575..365098;;16s;;687;*687;;;1524;
comp;365786..366973;;CDS;;;;;;396;
;;;;;;;;;;
comp;407344..408819;;CDS;;141;141;;;492;
comp;408961..409037;;aca;+;33;;33;;;
comp;409071..409147;;aca;5 aca;38;;38;;;
comp;409186..409262;;aca;;39;;39;;;
comp;409302..409378;;aca;;41;;41;;;
comp;409420..409493;;aca;;81;81;;;;
comp;409575..409838;;CDS;;;;;;88;
;;;;;;;;;;
comp;550792..551043;;CDS;;37;37;;;84;
comp;551081..551155;;gaa;+;40;;40;;;
comp;551196..551267;;gaa;6 gaa;37;;37;;;
comp;551305..551376;;gaa;;38;;38;;;
comp;551415..551486;;gaa;;35;;35;;;
comp;551522..551596;;gaa;;38;;38;;;
comp;551635..551706;;gaa;;75;75;;;;
comp;551782..553257;;CDS;;;;;;492;
;;;;;;;;;;
comp;571079..574315;;CDS;;165;165;;;*1079;
comp;574481..574590;;5s;;107;;;;110;
comp;574698..577581;;23s;;118;;;;2884;
comp;577700..577776;;gca;;88;;;88;;
comp;577865..577941;;atc;;76;;;;;
comp;578018..579541;;16s;;264;;;;1524;
comp;579806..579915;;5s;;106;;;;110;
comp;580022..582915;;23s;;150;;;;2894;
comp;583066..583142;;gca;;88;;;88;;
comp;583231..583307;;atc;;77;;;;;
comp;583385..584908;;16s;;1070;*1070;;;1524;
comp;585979..586545;;CDS;;;;;;189;
;;;;;;;;;;
comp;719558..719755;;CDS;;13;13;;;66;
comp;719769..719842;;tgg;;60;60;;;;
comp;719903..721090;;CDS;;58;58;;;396;
comp;721149..721220;;acc;;20;;20;;;
comp;721241..721321;;tac;;27;;27;;;
comp;721349..721425;;aca;;93;93;;;;
comp;721519..721818;;CDS;;;;;;100;
;;;;;;;;;;
;781522..782178;;CDS;;76;76;;;219;
;782255..782330;;atgf;;93;93;;;;
;782424..782978;;CDS;;;;;;185;
;;;;;;;;;;
comp;783008..783451;;CDS;;332;332;;;148;
;783784..783859;;atgf;;110;110;;;;
comp;783970..785886;;CDS;;;;;;*639;
;;;;;;;;;;
comp;814859..815281;;CDS;;541;*541;;;141;
comp;815823..815899;;cga;;10;10;;;;
comp;815910..816362;;CDS;;;;;;151;
;;;;;;;;;;
;868515..869267;;CDS;;37;37;;;251;
comp;869305..869380;;gga;+;34;;34;;;
comp;869415..869490;;gga;6 gga;34;;34;;;
comp;869525..869600;;gga;;34;;34;;;
comp;869635..869710;;gga;;34;;34;;;
comp;869745..869820;;gga;;37;;37;;;
comp;869858..869930;;gga;;242;242;;;;
;870173..870646;;CDS;;;;;;158;
;;;;;;;;;;
;1010425..1011210;;CDS;;92;92;;;262;
comp;1011303..1011376;;caa;+;221;;*221;;;
comp;1011598..1011668;;caa;2 caa;183;183;;;;
;1011852..1015055;;CDS;;;;;;*1068;
;;;;;;;;;;
comp;1110980..1111921;;CDS;;158;158;;;314;
;1112080..1112162;;ttg;;44;44;;;;
comp;1112207..1112701;;CDS;;;;;;165;
;;;;;;;;;;
;1113809..1114273;;CDS;;158;158;;;155;
comp;1114432..1114541;;5s;;105;;;;110;
comp;1114647..1117530;;23s;;150;;;;2884;
comp;1117681..1117757;;gca;;88;;;88;;
comp;1117846..1117922;;atc;;75;;;;;
comp;1117998..1119521;;16s;;266;;;;1524;
comp;1119788..1119897;;5s;;105;;;;110;
comp;1120003..1122896;;23s;;150;;;;2894;
comp;1123047..1123123;;gca;;88;;;88;;
comp;1123212..1123288;;atc;;77;;;;;
comp;1123366..1124889;;16s;;77;;;;1524;
comp;1126238..1126311;;aac;;90;90;;;;
comp;1126402..1127745;;CDS;;;;;;448;
;;;;;;;;;;
;1214932..1215615;;CDS;;101;101;;;228;
comp;1215717..1215790;;tgc;;88;88;;;;
comp;1215879..1216235;;CDS;;;;;;119;
;;;;;;;;;;
;1391184..1391825;;CDS;;85;85;;;214;
;1391911..1391987;;aac;+;370;;*370;;;
;1392358..1392434;;aac;2 aac;590;*590;;;;
comp;1393025..1393459;;CDS;;;;;;145;
;;;;;;;;;;
;1597909..1598226;;CDS;;635;*635;;;106;
;1598862..1598938;;gac;+;148;;*148;;;
;1599087..1599163;;gac;3 gac;202;;*202;;;
;1599366..1599442;;gac;;169;169;;;;
comp;1599612..1600157;;CDS;;;;;;182;
;;;;;;;;;;
comp;1643091..1644479;;CDS;;132;132;;;463;
;1644612..1644696;;cta;+;183;;*183;;;
;1644880..1644961;;cta;2 cta;314;314;;;;
;1645276..1646115;;CDS;;;;;;280;
;;;;;;;;;;
;1721814..1722689;;CDS;;66;66;;;292;
comp;1722756..1722826;;tgg;;51;51;;;;
comp;1722878..1723252;;CDS;;;;;;125;
;;;;;;;;;;
comp;1738209..1739033;;CDS;;183;183;;;275;
comp;1739217..1739293;;atgi;+;24;;24;;;
comp;1739318..1739394;;atgi;2 atgi;69;69;;;;
comp;1739464..1739865;;CDS;;;;;;134;
;;;;;;;;;;
>;1924596..1926158;;CDS;+;-41;*-41;;;*521;
comp;1926118..1926206;;tta;2 tta;341;;*341;;;
comp;1926548..1926633;;tta;@2;320;320;;;;
<;1926954..1927025;;CDS;;;;;;24;
;;;;;;;;;;
;1928728..1929714;;CDS;;125;125;;;329;
comp;1929840..1929925;;tta;;147;147;;;;
comp;1930073..1930444;;CDS;;108;108;;;124;
comp;1930553..1930638;;tta;;6;;6;;;
comp;1930645..1930720;;ggc;;201;201;;;;
comp;1930922..1933519;;CDS;;;;;;*866;
;;;;;;;;;;
comp;1961822..1962571;;CDS;;128;128;;;250;
;1962700..1962775;;ttc;+;32;;32;;;
;1962808..1962883;;ttc;3 ttc;23;;23;;;
;1962907..1962982;;ttc;;97;97;;;;
comp;1963080..1964066;;CDS;;;;;;329;
;;;;;;;;;;
;2082191..2082733;;CDS;;1103;*1103;;;181;
;2083837..2085360;;16s;;77;;;;1524;
;2085438..2085514;;atc;;88;;;88;;
;2085603..2085679;;gca;;150;;;;;
;2085830..2088713;;23s;;106;;;;2884;
;2088820..2088929;;5s;;156;156;;;110;
;2089086..2089943;;CDS;;;;;;286;
;;;;;;;;;;
;2147912..2148241;;CDS;;286;286;;;110;
;2148528..2148604;;cgt;+;49;;49;;;
;2148654..2148730;;cgt;2 cgt;69;69;;;;
;2148800..2149288;;CDS;;;;;;163;
;;;;;;;;;;
comp;2207990..2208685;;CDS;;111;111;;;232;
comp;2208797..2208872;;atgf;;106;106;;;;
comp;2208979..2209605;;CDS;;147;147;;;209;
comp;2209753..2209829;;atgj;;145;145;;;;
;2209975..2210361;;CDS;;;;;;129;
;;;;;;;;;;
comp;2425634..2426896;;CDS;;299;299;;;421;
comp;2427196..2427270;;cca;;353;353;;;;
;2427624..2428565;;CDS;;;;;;314;
;;;;;;;;;;
comp;2434061..2435053;;CDS;;125;125;;;331;
comp;2435179..2435252;;atgj;;366;366;;;;
;2435619..2436269;;CDS;;;;;;217;
;;;;;;;;;;
;2561350..2563341;;CDS;;1072;*1072;;;*664;
;2564414..2565937;;16s;;74;;;;1524;
;2566012..2566088;;atc;;90;;;90;;
;2566179..2566255;;gca;;118;;;;;
;2566374..2569256;;23s;;105;;;;2883;
;2569362..2569471;;5s;;279;279;;;110;
;2569751..2571682;;CDS;;;;;;*610;
;;;;;;;;;;
comp;2676791..2678620;;CDS;;235;235;;;*610;
comp;2678856..2678940;;tca;;497;*497;;;;
;2679438..2681390;;CDS;;;;;;*651;
;;;;;;;;;;
comp;2977513..2977920;;CDS;;497;*497;;;136;
comp;2978418..2978492;;gta;;61;61;;;;
comp;2978554..2978928;;CDS;;;;;;125;
;;;;;;;;;;
;3228192..3228908;;CDS;;79;79;;;239;
;3228988..3229064;;cac;+;23;;23;;;
;3229088..3229164;;cac;4 cac;22;;22;;;
;3229187..3229263;;cac;;21;;21;;;
;3229285..3229361;;cac;;40;40;;;;
comp;3229402..3230577;;CDS;;;;;;392;
;;;;;;;;;;
comp;3394869..3395093;;CDS;;90;90;;;75;
comp;3395184..3395268;;tca;;215;215;;;;
comp;3395484..3396884;;CDS;;;;;;467;
;;;;;;;;;;
;3457542..3458360;;CDS;;150;150;;;273;
;3458511..3458594;;tac;+;49;;49;;;
;3458644..3458727;;tac;4 tac;48;;48;;;
;3458776..3458859;;tac;;41;;41;;;
;3458901..3458984;;tac;;309;309;;;;
comp;3459294..3460415;;CDS;;;;;;374;
;;;;;;;;;;
;3951958..3953367;;CDS;;595;*595;;;470;
;3953963..3954039;;aga;+;80;;80;;;
;3954120..3954196;;aga;2 aga;36;36;;;;
comp;3954233..3954712;;CDS;;;;;;160;
;;;;;;;;;;
;3975219..3976205;;CDS;;99;99;;;329;
comp;3976305..3976379;;cca;+;36;;36;;;
comp;3976416..3976493;;cca;2 cca;7;;7;;;
comp;3976501..3976587;;agc;;965;*965;;;;
;3977553..3978161;;CDS;;;;;;203;

myr cumuls[modifier | modifier le wikicode]

myr cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;8;1;0;;1;1;1;;100;6;30;1
;16 23 5s 0;0;20;4;;50;7;20;;200;25;60;0
;16 atc gca;8;40;28;;100;21;40;;300;16;90;4
;16 23 5s a;0;60;7;;150;18;60;;400;14;120;4
;max a;2;80;1;;200;7;80;;500;9;150;10
;a doubles;0;100;1;8;250;5;100;;600;1;180;8
;autres;0;120;0;;300;6;120;;700;5;210;6
;total aas;16;140;0;;350;4;140;;800;0;240;6
sans ;opérons;34;160;1;;400;2;160;;900;1;270;3
;1 aa;13;180;0;;450;0;180;;1000;0;300;5
;max a;7;200;1;;500;2;200;;1100;2;330;6
;a doubles;17;;5;;;9;;;;0;;26
;total aas;85;;48;8;;82;;0;;79;;79
total aas;;101;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;74;88;;223;;;;302;;
;;;variance;120;0;;242;;;;209;;
sans jaune;;;moyenne;33;;;144;;;;244;;189
;;;variance;13;;;90;;;;122;;78

myr blocs[modifier | modifier le wikicode]

myr blocs;;;;;;;
CDS;259;159;165;1079;CDS;158;155
5s;107;110;107;110;5s;105;110
23s;150;2884;118;2884;23s;150;2884
gca;88;;88;;gca;88;
atc;75;;76;;atc;75;
16s;265;1524;264;1524;16s;266;1524
5s;103;110;106;110;5s;105;110
23s;150;2894;150;2894;23s;150;2894
gca;88;;88;;gca;88;
atc;75;;77;;atc;77;
16s;687;1524;1070;1524;16s;77;1524
CDS;;396;;189;aac;90;
;;;;;CDS;;448
;;;;;;;
CDS;1103;181;1072;664;;;
16s;77;1524;74;1524;;;
atc;88;;90;;;;
gca;150;;118;;;;
23s;106;2884;105;2883;;;
5s;156;110;279;110;;;
CDS;;286;;644;;;

myr remarques[modifier | modifier le wikicode]

myr;;;;;;;101
atgi;2;tct;;tat;;atgf;3
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;3;tcc;;tac;5;tgc;1
atc;8;acc;1;aac;3;agc;2
ctc;1;ccc;;cac;4;cgt;2
gtc;;gcc;;gac;3;ggc;1
tta;4;tca;3;taa;;tga;
ata;;aca;6;aaa;6;aga;3
cta;2;cca;4;caa;2;cga;1
gta;6;gca;8;gaa;6;gga;6
ttg;1;tcg;;tag;;tgg;2
atgj;2;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;

fps[modifier | modifier le wikicode]

fps opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Flav_psyc_JIP02_86/flavPsyc-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_009613.3;fps;;genome;;;;;;;;
32.4%GC;14.8.19 Paris;16s 6;49;doubles;intercalaires;cds;aa;avec aa;cdsa;cdsd;protéines
Flavobacterium psychrophilum JIP02/86;;;;;;;;;;;
;3517..4200;;CDS;;43;43;;;228;;
comp;4244..4317;;tgc;;104;104;;;;;
comp;4422..4781;;CDS;;;;;;120;;
;;;;;;;;;;;
;113561..114154;;CDS;;107;107;;;198;;
comp;114262..114335;;aac;;147;147;;;;;
comp;114483..115817;;CDS;;;;;;445;;
;;;;;;;;;;;
comp;190346..191287;;CDS;;175;175;;;314;;
;191463..191545;;ttg;@1;290;;*290;;;;
comp;191836..191920;;cta;;132;132;;;;;
;192053..193441;;CDS;;;;;;463;;
;;;;;;;;;;;
comp;295744..295950;;CDS;;179;179;;;69;;
comp;296130..296203;;atgi;;86;86;;;;;
comp;296290..296694;;CDS;;;;;;135;;
;;;;;;;;;;;
comp;318122..319414;;CDS;;896;*896;;;431;;
comp;320311..320387;;gac;;86;86;;;;;
comp;320474..321400;;CDS;;;;;;309;;
;;;;;;;;;;;
comp;371118..374348;;CDS;;154;154;;;1077;;
;374503..374576;;caa;;47;47;;;;;
comp;374624..375631;;CDS;;;;;;336;;
;;;;;;;;;;;
comp;464114..466717;;CDS;;125;125;;;868;;
comp;466843..466920;;cca;;163;163;;;;;
;467084..468346;;CDS;;;;;;421;;
;;;;;;;;;;;
;507944..508621;;CDS;;1042;*1042;;;226;;
;509664..511163;;16s;;110;;;;1500;;
;511274..511350;;atc;;158;;;158;;;
;511509..511585;;gca;;213;;;;;;
;511799..514683;;23s;;156;;;;2885;;
;514840..514945;;5s;;204;204;;;106;;
;515150..515902;;CDS;;;;;;251;;
;;;;;;;;;;;
;596537..597679;;CDS;;312;312;;;381;;
comp;597992..598074;;ctc;+;40;;40;;;;
comp;598115..598190;;aaa;2 aaa;23;;23;;;;
comp;598214..598289;;aaa;;128;128;;;;;
;598418..598936;;CDS;;;;;;173;;
;;;;;;;;;;;
;642117..643595;;CDS;;91;91;;;493;;
;643687..643758;;gaa;+;31;;31;;;;
;643790..643864;;gaa;2 gaa;162;162;;;;;
;644027..644278;;CDS;;1149;*1149;;;84;;
;645428..646927;;16s;;110;;;;1500;;
;647038..647114;;atc;;158;;;158;;;
;647273..647349;;gca;;213;;;;;;
;647563..650447;;23s;;156;;;;2885;;
;650604..650709;;5s;;931;*931;;;106;;
;651641..653437;;CDS;;;;;;599;;
;;;;;;;;;;;
;726614..727399;;CDS;;207;207;;;262;;
comp;727607..727684;;gta;;81;81;;;;;
comp;727766..728980;;CDS;;;;;;405;;
;;;;;;;;;;;
;852715..853170;;CDS;;128;128;;;152;;
comp;853299..853375;;cac;;75;75;;;;;
comp;853451..854167;;CDS;;;;;;239;;
;;;;;;;;;;;
;897041..897184;;CDS;;75;75;;;48;;
;897260..897336;;cgt;;46;46;;;;;
;897383..897955;;CDS;;;;;;191;;
;;;;;;;;;;;
comp;982868..984043;;CDS;;254;254;;;392;;
;984298..984384;;agc;;15;;15;;;;
;984400..984477;;cca;;30;;30;;;;
;984508..984584;;aga;;93;93;;;;;
;984678..985880;;CDS;;;;;;401;;
;;;;;;;;;;;
comp;1110660..1112606;;CDS;;1082;*1082;;;649;;
;1113689..1115188;;16s;;110;;;;1500;;
;1115299..1115375;;atc;;158;;;158;;;
;1115534..1115610;;gca;;213;;;;;;
;1115824..1118708;;23s;;156;;;;2885;;
;1118865..1118970;;5s;;282;282;;;106;;
comp;1119253..1120218;;CDS;;;;;;322;;
;;;;;;;;;;;
comp;1123344..1124324;;CDS;;-981;*-981;;;327;;
comp;1123344..1124324;;rpr;@2;191;191;;;981;;
comp;1124516..1124698;;rpr;;20;20;;;183;;
comp;1124719..1124862;;rpr;;289;289;;;144;;
comp;1125152..1125229;;gta;;82;82;;;;;
comp;1125312..1125686;;CDS;;;;;;125;;
;;;;;;;;;;;
;1285199..1285477;;CDS;;148;148;;;93;;
;1285626..1285710;;tac;;473;*473;;;;;
;1286184..1286810;;CDS;;;;;;209;;
;;;;;;;;;;;
;1309373..1310833;;CDS;;1079;*1079;;;487;;
comp;1311913..1312018;;5s;;156;;;;106;;
comp;1312175..1315059;;23s;;213;;;;2885;;
comp;1315273..1315349;;gca;;158;;;158;;;
comp;1315508..1315584;;atc;;110;;;;;;
comp;1315695..1317194;;16s;;1276;*1276;;;1500;;
;1318471..1319160;;CDS;;;;;;230;;
;;;;;;;;;;;
comp;1395138..1395728;;CDS;;73;73;;;197;;
comp;1395802..1396536;;rpr;;93;93;;;735;;
comp;1396630..1397052;;rpr;;248;248;;;423;;
comp;1397301..1397388;;tca;;135;135;;;;;
comp;1397524..1398660;;CDS;;;;;;379;;
;;;;;;;;;;;
comp;1622342..1622755;;CDS;;100;100;;;138;;
comp;1622856..1622929;;aca;;79;79;;;;;
comp;1623009..1623275;;CDS;;;;;;89;;
;;;;;;;;;;;
comp;1815453..1816334;;CDS;;239;239;;;294;;
;1816574..1816649;;atgf;+;31;;31;;;;
;1816681..1816756;;atgf;2 atgf;591;*591;;;;;
;1817348..1817794;;CDS;;;;;;149;;
;;;;;;;;;;;
;1859580..1860149;;CDS;;305;305;;;190;;
comp;1860455..1860531;;atgj;;143;143;;;;;
;1860675..1861067;;CDS;;;;;;131;;
;;;;;;;;;;;
comp;1904719..1905537;;CDS;;26;26;;;273;;
comp;1905564..1905637;;cga;;70;70;;;;;
comp;1905708..1906157;;CDS;;;;;;150;;
;;;;;;;;;;;
;1995546..1996253;;CDS;;35;35;;;236;;
comp;1996289..1996361;;gga;;281;281;;;;;
;1996643..1997074;;CDS;;;;;;144;;
;;;;;;;;;;;
;2088032..2088418;;CDS;;105;105;;;129;;
;2088524..2089369;;rpr;;116;;;;846;;
comp;2089486..2089591;;5s;;156;;;;106;;
comp;2089748..2092632;;23s;;213;;;;2885;;
comp;2092846..2092922;;gca;;158;;;158;;;
comp;2093081..2093157;;atc;;110;;;;;;
comp;2093268..2094767;;16s;;1570;*1570;;;1500;;
comp;2096338..2099241;;CDS;;;;;;968;;
;;;;;;;;;;;
;2182840..2185440;;CDS;;138;138;;;867;;
;2185579..2185654;;ggc;;40;;40;;;;
;2185695..2185782;;tta;;93;93;;;;;
comp;2185876..2190132;;CDS;;;;;;1419;;
;;;;;;;;;;;
comp;2295987..2296184;;CDS;;14;14;;;66;;
comp;2296199..2296272;;tgg;;61;61;;;;;
comp;2296334..2297521;;CDS;;55;55;;;396;;
comp;2297577..2297651;;acc;;83;;*83;;;;
comp;2297735..2297818;;tac;;138;;*138;;;;
comp;2297957..2298033;;aca;;90;90;;;;;
comp;2298124..2298426;;CDS;;;;;;101;;
;;;;;;;;;;;
;2506720..2507055;;CDS;;288;288;;;112;;
comp;2507344..2507449;;5s;;156;;;;106;;
comp;2507606..2510490;;23s;;213;;;;2885;;
comp;2510704..2510780;;gca;;158;;;158;;;
comp;2510939..2511015;;atc;;110;;;;;;
comp;2511126..2512625;;16s;;1010;*1010;;;1500;;
comp;2513636..2514889;;CDS;;;;;;418;;
;;;;;;;;;;;
;2632307..2633335;;CDS;;53;53;;;343;;
;2633389..2633476;;tcc;;246;246;;;;;
;2633723..2634982;;CDS;;;;;;420;;
;;;;;;;;;;;
comp;2752993..2753322;;CDS;;64;64;;;110;;
;2753387..2753463;;gcc;;105;105;;;;;
comp;2753569..2757033;;CDS;;;;;;1155;;
;;;;;;;;;;;
comp;2800796..2801521;;CDS;;98;98;;;242;;
;2801620..2801695;;ttc;;299;299;;;;;
comp;2801995..2802723;;gene;@3;406;*406;;;243;;
comp;2803130..2803444;;CDS;;;;;;105;;

fps cumuls[modifier | modifier le wikicode]

fps cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;6;1;0;;1;1;1;;100;6;30;0
;16 23 5s 0;0;20;1;;50;7;20;;200;19;60;1
;16 atc gca;6;40;6;;100;20;40;;300;12;90;4
;16 23 5s a;0;60;0;;150;13;60;;400;10;120;6
;max a;2;80;0;;200;6;80;;500;10;150;8
;a doubles;0;100;1;;250;5;100;;600;1;180;2
;autres;0;120;0;;300;6;120;;700;1;210;5
;total aas;12;140;1;;350;2;140;;800;0;240;5
sans ;opérons;26;160;0;6;400;0;160;;900;2;270;4
;1 aa;19;180;0;;450;1;180;;1000;1;300;2
;max a;3;200;0;;500;1;200;;1100;1;330;4
;a doubles;3;;1;;;10;;;;2;;24
;total aas;37;;10;6;;72;;0;;65;;65
total aas;;49;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;72;158;;257;;;;333;;
;;;variance;85;0;;374;;;;276;;
sans jaune;;;moyenne;30;;;135;;;;246;;181
;;;variance;9;;;82;;;;126;;78

fps blocs[modifier | modifier le wikicode]

fps blocs;;;;;;
CDS;1042;226;1149;84;1082;649
16s;110;1500;110;1500;110;1500
atc;158;;158;;158;
gca;213;;213;;213;
23s;156;2885;156;2885;156;2885
5s;204;106;931;106;282;106
CDS;;251;;599;;322
;;;;;;
;;;105;129;;
CDS;1079;487;116;846;288;112
5s;156;106;156;106;156;106
23s;213;2885;213;2885;213;2885
gca;158;;158;;158;
atc;110;;110;;110;
16s;1276;1500;1570;1500;1010;1500
CDS;;230;;968;;418

fps remarques[modifier | modifier le wikicode]

fps;;;;;;;49
atgi;1;tct;;tat;;atgf;2
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;2;tgc;1
atc;6;acc;1;aac;1;agc;1
ctc;1;ccc;;cac;1;cgt;1
gtc;;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;2;aaa;2;aga;1
cta;1;cca;2;caa;1;cga;1
gta;2;gca;6;gaa;2;gga;1
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;

tenericutes[modifier | modifier le wikicode]

abra[modifier | modifier le wikicode]

abra opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Acho_bras_O502/achoBras_O502-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_022549.1;abra;;genome;;;;;;;;
35.8%GC;15.8.19 Paris;16s 4;45;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines
Acholeplasma brassicae;;;;;;;;;;;
;253257..253430;;CDS;;86;86;;;58;;
;253517..253601;;tac;;214;;;;;;
;253816..255351;;16s;;137;;;;1536;;
;255489..255565;;atc;;88;;;;;;
;255654..258507;;23s;;34;;;;2854;;
;258542..258652;;5s;;11;;;;111;;
;258664..258740;;aac;;149;;;;;;
;258890..259000;;5s;;11;;;;111;;
;259012..259088;;aac;;860;*860;;;;;
;259949..260053;;CDS;;432;;;;35;;
;260486..262021;;16s;;137;;;;1536;;
;262159..262235;;atc;;88;;;;;;
;262324..265177;;23s;;34;;;;2854;;
;265212..265322;;5s;@1;14;;;;111;;
;265337..265412;;gta;;44;;;44;;;
;265457..265532;;aca;;11;;;11;;;
;265544..265619;;aaa;;7;;;7;;;
;265627..265713;;tta;;8;;;8;;;
;265722..265797;;gca;;72;;;72;;;
;265870..265946;;atgj;;7;;;7;;;
;265954..266030;;atgi;;44;;;44;;;
;266075..266165;;tca;;8;;;8;;;
;266174..266250;;atgf;;4;;;4;;;
;266255..266330;;gac;;11;;;11;;;
;266342..266417;;ttc;;137;137;;;;;
;266555..267409;;CDS;;;;;;285;;
;;;;;;;;;;;
;582446..584125;;CDS;;49;49;;;*560;;
;584175..584260;;ctc;;170;170;;;;;
;584431..586110;;CDS;;;;;;*560;;
;;;;;;;;;;;
;625631..626317;;CDS;;84;84;;;229;;
comp;626402..626476;;ggc;;66;;66;;;;
comp;626543..626619;;cca;;17;;17;;;;
comp;626637..626713;;cga;;13;;13;;;;
comp;626727..626802;;gac;;149;149;;;;;
;626952..627599;;CDS;;;;;;216;;
;;;;;;;;;;;
;633526..634710;;CDS;;63;63;;;395;;
comp;634774..634847;;acc;;76;76;;;;;
;634924..636651;;CDS;;;;;;*576;;
;;;;;;;;;;;
;755442..756548;;CDS;;64;64;;;369;;
comp;756613..756688;;aag;;130;130;;;;;
;756819..757373;;CDS;;;;;;185;;
;;;;;;;;;;;
;807788..808216;;CDS;;108;108;;;143;;
;808325..808401;;aga;;216;216;;;;;
;808618..808854;;CDS;;;;;;79;;
;;;;;;;;;;;
;829563..829871;;CDS;;155;155;;;103;;
;830027..830102;;agg;;27;27;;;;;
;830130..831458;;CDS;;;;;;443;;
;;;;;;;;;;;
comp;1176200..1176799;;CDS;;398;398;;;200;;
comp;1177198..1177291;;tcg;;8;;8;;;;
comp;1177300..1177375;;gcc;;569;*569;;;;;
comp;1177945..1179252;;CDS;;;;;;436;;
;;;;;;;;;;;
;1187918..1188148;;CDS;;382;382;;;77;;
;1188531..1188621;;tcc;;66;66;;;;;
;1188688..1189761;;CDS;;;;;;358;;
;;;;;;;;;;;
comp;1194077..1194568;;CDS;;206;206;;;164;;
comp;1194775..1194859;;ttg;;10;10;;;;;
comp;1194870..1196045;;CDS;;;;;;392;;
;;;;;;;;;;;
comp;1251487..1252329;;CDS;;68;68;;;281;;
;1252398..1252472;;gtc;;44;44;;;;;
comp;1252517..1252873;;CDS;;;;;;119;;
;;;;;;;;;;;
comp;1416224..1416484;;CDS;;301;301;;;87;;
comp;1416786..1416859;;tgc;;92;92;;;;;
comp;1416952..1418427;;CDS;;;;;;492;;
;;;;;;;;;;;
comp;1427372..1427890;;CDS;@2;379;379;;;173;;
comp;1428270..1428343;;gga;;9;;9;;;;
comp;1428353..1428429;;cca;;1;;1;;;;
comp;1428431..1428507;;cgt;;8;;8;;;;
comp;1428516..1428591;;gaa;;73;73;;;;;
comp;1428665..1429210;;CDS;;;;;;182;;
;;;;;;;;;;;
comp;1431948..1432259;;CDS;;96;96;;;104;;
comp;1432356..1432432;;aac;;11;;;;;;
comp;1432444..1432554;;5s;;34;;;;111;;
comp;1432589..1435442;;23s;;158;;;;2854;;
comp;1435601..1437135;;16s;;432;;;;1535;;
comp;1437568..1437672;;CDS;;860;*860;;;35;;
comp;1438533..1438609;;aac;;11;;;;;;
comp;1438621..1438731;;5s;@3;149;;;;111;;
comp;1438881..1438957;;aac;;11;;;;;;
comp;1438969..1439079;;5s;;34;;;;111;;
comp;1439114..1441967;;23s;;159;;;;2854;;
comp;1442127..1443662;;16s;;431;*431;;;1536;;
comp;1444094..1444624;;CDS;;;;;;177;;
;;;;;;;;;;;
comp;1532381..1533052;;CDS;;262;262;;;224;;
comp;1533315..1533399;;cta;;46;46;;;;;
comp;1533446..1535560;;CDS;;;;;;*705;;
;;;;;;;;;;;
comp;1540295..1540534;;CDS;;171;171;;;80;;
comp;1540706..1540780;;tgg;;47;47;;;;;
comp;1540828..1541754;;CDS;;137;137;;;;;
;1541892..1541967;;cac;;63;;63;;;;
;1542031..1542104;;caa;;37;37;;;;;
comp;1542142..1542357;;CDS;;;;;;72;;
;;;;;;;;;;;
comp;1716869..1717186;;CDS;;854;*854;;;106;;
comp;1718041..1718116;;acg;;87;87;;;;;
comp;1718204..1718947;;CDS;;;;;;248;;
;;;;;;;;;;;
comp;1742909..1743664;;CDS;;487;*487;;;252;;
comp;1744152..1744227;;gaa;;109;109;;;;;
comp;1744337..1744720;;CDS;;;;;;128;;
;;;;;;;;;;;
comp;1747424..1747726;;CDS;;100;100;;;101;;
comp;1747827..1747919;;agc;;102;102;;;;;
comp;1748022..1750199;;CDS;;;;;;*726;;

abra cumuls[modifier | modifier le wikicode]

abra cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;4;1;1;0;1;0;1;;100;8;30;0
;16 23 5s 0;0;20;5;7;50;7;20;;200;13;60;3
;16 atc 235 a;2;40;0;0;100;12;40;;300;7;90;5
;16 23 5s a;2;60;0;2;150;7;60;;400;4;120;5
;max a;12;80;2;1;200;3;80;;500;3;150;2
;a doubles;0;100;0;0;250;2;100;;600;3;180;3
;autres;0;120;0;0;300;1;120;;700;0;210;3
;total aas;19;140;0;0;350;1;140;;800;2;240;3
sans ;opérons;18;160;0;0;400;3;160;;900;0;270;2
;1 aa;14;180;0;0;450;1;180;;1000;0;300;2
;max a;4;200;0;0;500;1;200;;1100;0;330;0
;a doubles;0;;0;0;;4;;;;0;;12
;total aas;26;;8;10;;42;;0;;40;;40
total aas;;45;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;;;;209;;;;254;;
;;;variance;;;;226;;;;187;;
sans jaune;;;moyenne;23;22;;131;;;;201;;148
;;;variance;26;23;;101;;;;127;;74

abra blocs[modifier | modifier le wikicode]

abra blocs;;
CDS;86;58
tac;214;
16s;137;1536
atc;88;
23s;34;2854
5s;11;111
aac;149;
5s;11;111
aac;860;
CDS;432;35
16s;137;1536
atc;88;
23s;34;2854
5s;14;111
gta;44;
;;
CDS;96;104
aac;11;
5s;34;111
23s;158;2854
16s;432;1535
CDS;860;35
aac;11;
5s;149;111
aac;11;
5s;34;111
23s;159;2854
16s;431;1536
CDS;;177

abra remarques[modifier | modifier le wikicode]

abra;;;;;;;45
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;2;acc;1;aac;5;agc;1
ctc;1;ccc;;cac;1;cgt;1
gtc;1;gcc;1;gac;2;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1
cta;1;cca;2;caa;1;cga;1
gta;1;gca;1;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;;ccg;;cag;;cgg;
gtg;;gcg;;gag;;ggg;

apal[modifier | modifier le wikicode]

apal opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/GtRNAdb2/genomes/bacteria/Acho_palm_J233/achoPalm_J233-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_022538.1;apal;;genome;;;;;;;;
29%GC;16.8.19 Paris;16s  2 ;35;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines
Acholeplasma palmae J233;;;;;;;;;;;
;161706..162593;;CDS;;132;132;;;296;;
;162726..162816;;agc;;9;;9;;;;
;162826..162901;;gaa;;126;126;;;;;
;163028..163522;;CDS;;;;;;165;;
;;;;;;;;;;;
comp;205002..205226;;CDS;;72;72;;;75;;
comp;205299..205373;;tgg;;73;73;;;;;
comp;205447..206382;;CDS;;133;133;;;;;
;206516..206591;;cac;;14;;14;;;;
;206606..206680;;caa;;34;;34;;;;
;206715..206797;;cta;;168;168;;;;;
;206966..207208;;CDS;;;;;;81;;
;;;;;;;;;;;
;294770..296290;;CDS;;347;347;;;*507;;
;296638..298160;;16s;;128;;;;1523;;
;298289..301126;;23s;;34;;;;2838;;
;301161..301268;;5s;;51;;;;108;;
;301320..301396;;aac;;118;118;;;;;
;301515..301835;;CDS;;;;;;107;;
;;;;;;;;;;;
;303638..304993;;CDS;;70;70;;;452;;
;305064..305139;;gaa;@1;9;;9;;;;
;305149..305225;;cgt;;71;;71;;;;
;305297..305373;;cca;;13;;13;;;;
;305387..305461;;gga;;86;86;;;;;
;305548..308184;;CDS;;;;;;*879;;
;;;;;;;;;;;
;326174..327313;;CDS;;91;91;;;380;;
;327405..327478;;tgc;;527;*527;;;;;
comp;328006..328539;;CDS;;;;;;178;;
;;;;;;;;;;;
;435096..436751;;CDS;;48;48;;;*552;;
;436800..436885;;ctc;;214;214;;;;;
;437100..438890;;CDS;;;;;;*597;;
;;;;;;;;;;;
;441323..442294;;CDS;;38;38;;;324;;
comp;442333..442407;;ggc;;100;100;;;;;
;442508..443650;;CDS;;;;;;381;;
;;;;;;;;;;;
;443640..444197;;CDS;;93;93;;;186;;
comp;444291..444364;;acc;;133;133;;;;;
;444498..444695;;CDS;;;;;;66;;
;;;;;;;;;;;
;644468..646315;;CDS;;124;124;;;*616;;
;646440..646516;;aga;;251;251;;;;;
;646768..647322;;CDS;;;;;;185;;
;;;;;;;;;;;
;669786..670511;;CDS;;45;45;;;242;;
;670557..670632;;cgg;;1;;;;;;
;670634..670722;;tcc;;133;133;;;;;
;670856..671359;;CDS;;;;;;168;;
;;;;;;;;;;;
comp;837575..837796;;CDS;;157;157;;;74;;
comp;837954..838029;;aag;;214;214;;;;;
;838244..838888;;CDS;;;;;;215;;
;;;;;;;;;;;
comp;1172026..1173090;;CDS;;112;112;;;355;;
comp;1173203..1173285;;ttg;;82;82;;;;;
comp;1173368..1175038;;CDS;;;;;;*557;;
;;;;;;;;;;;
comp;1456398..1457315;;CDS;;72;72;;;306;;
comp;1457388..1457463;;gac;;40;40;;;;;
comp;1457504..1458355;;CDS;;154;154;;;284;;
comp;1458510..1458585;;ttc;;7;;;7;;;
comp;1458593..1458668;;gac;;4;;;4;;;
comp;1458673..1458749;;atgf;;55;;;55;;;
comp;1458805..1458895;;tca;;22;;;22;;;
comp;1458918..1458994;;atgi;;4;;;4;;;
comp;1458999..1459075;;atgj;;45;;;45;;;
comp;1459121..1459196;;gca;;5;;;5;;;
comp;1459202..1459286;;tta;;20;;;20;;;
comp;1459307..1459382;;aaa;;6;;;6;;;
comp;1459389..1459464;;aca;;15;;;15;;;
comp;1459480..1459555;;gta;;21;;;;;;
comp;1459577..1459684;;5s;@2;34;;;;108;;
comp;1459719..1462556;;23s;;50;;;;2838;;
comp;1462607..1462682;;gca;;6;;;6;;;
comp;1462689..1462765;;atc;;110;;;;;;
comp;1462876..1464398;;16s;;206;;;;1523;;
comp;1464605..1464688;;tac;;114;114;;;;;

apal cumuls[modifier | modifier le wikicode]

apal cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;2;1;0;0;1;0;1;;100;5;30;0
;16 23 5s 0;0;20;4;8;50;4;20;;200;6;60;1
;16 atc gca;1;40;1;1;100;9;40;;300;4;90;4
;16 23 5s a;1;60;0;2;150;9;60;;400;5;120;1
;max a;14;80;1;0;200;3;80;;500;1;150;0
;a doubles;0;100;0;0;250;2;100;;600;4;180;3
;autres;0;120;0;0;300;1;120;;700;1;210;2
;total aas;15;140;0;0;350;1;140;;800;0;240;1
sans ;opérons;14;160;0;0;400;0;160;;900;1;270;1
;1 aa;9;180;0;0;450;0;180;;1000;0;300;2
;max a;4;200;0;0;500;0;200;;1100;0;330;2
;a doubles;0;;0;0;;1;;;;0;;10
;total aas;20;;6;11;;30;;0;;27;;27
total aas;;35;;;;;;;;;;;
remarques;;2;;;;;;;;;;;
avec jaune;;;moyenne;;;;136;;;;307;;
;;;variance;;;;100;;;;208;;
sans jaune;;;moyenne;25;17;;122;;;;218;;177
;;;variance;24;18;;68;;;;120;;91

apal blocs[modifier | modifier le wikicode]

apal blocs;;;;;
gta;21;;CDS;347;
5s;34;108;16s;128;1523
23s;50;2838;23s;34;2838
gca;6;;5s;51;108
atc;110;;aac;118;
16s;206;1523;CDS;;
tac;114;;;;
CDS;;;;;

apal remarques[modifier | modifier le wikicode]

apal;;;;;;;35
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;1;acc;1;aac;1;agc;1
ctc;1;ccc;;cac;1;cgt;1
gtc;;gcc;;gac;2;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;
gta;1;gca;2;gaa;2;gga;1
ttg;1;tcg;;tag;;tgg;1
atgj;1;acg;;aag;1;agg;
ctg;;ccg;;cag;;cgg;1
gtg;;gcg;;gag;;ggg;

archeo[modifier | modifier le wikicode]

mfi[modifier | modifier le wikicode]

mfi opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/archaea/Meth_form/methForm-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_LN515531.1;mfi;;genome;;;;;;;;
41.2%GC;17.8.19 Paris;16s  2 ;47;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines
Methanobacterium formicicum DSM1535;;;;;;;;;;;
;157153..157563;;CDS;;36;36;;;137;;
comp;157600..157683;;ctc;;246;246;;;;;
;157930..158232;;CDS;;;;;;101;;
;;;;;;;;;;;
comp;211693..213681;;CDS;;206;206;;;*663;;
;213888..213971;;tcg;;281;281;;;;;
;214253..215677;;CDS;;;;;;475;;
;;;;;;;;;;;
comp;314088..314264;;CDS;;50;50;;;59;;
comp;314315..314487;;caa;@1;-1;*-1;;;;;
comp;314487..314654;;CDS;;;;;;56;;
;;;;;;;;;;;
comp;317759..318211;;CDS;;198;198;;;151;;
comp;318410..318494;;tcc;;177;177;;;;;
comp;318672..319634;;CDS;;;;;;321;;
;;;;;;;;;;;
comp;419250..419975;;CDS;;156;156;;;242;;
comp;420132..420204;;aac;;29;29;;;;;
comp;420234..420545;;CDS;;;;;;104;;
;;;;;;;;;;;
comp;466570..467484;;CDS;;223;223;;;305;;
comp;467708..467792;;agc;;186;186;;;;;
comp;467979..468294;;ncRNA;@2;122;122;;;316;;
;468417..469397;;CDS;;;;;;327;;
;;;;;;;;;;;
;681116..681676;;CDS;;37;37;;;187;;
comp;681714..681786;;gcg;;195;195;;;;;
comp;681982..682488;;CDS;;;;;;169;;
;;;;;;;;;;;
;695936..696538;;CDS;;939;*939;;;201;;
comp;697478..697600;;5s;;305;;;;123;;
comp;697906..700772;;23s;;233;;;;2867;;
comp;701006..701079;;gca;;87;;;;;;
comp;701167..702646;;16s;;724;*724;;;1480;;
;703371..704336;;CDS;;;;;;322;;
;;;;;;;;;;;
comp;746487..747290;;CDS;;155;155;;;268;;
comp;747446..747518;;acc;;85;;*85;;;;
comp;747604..747686;;tta;;303;303;;;;;
;747990..748163;;CDS;;;;;;58;;
;;;;;;;;;;;
comp;800615..801820;;CDS;;43;43;;;402;;
comp;801864..801935;;caa;;72;72;;;;;
comp;802008..802697;;CDS;;;;;;230;;
;;;;;;;;;;;
comp;963425..964432;;CDS;;273;273;;;336;;
;964706..964778;;aac;;5;;5;;;;
;964784..964857;;atgi;;58;;58;;;;
;964916..964990;;gaa;;53;;53;;;;
;965044..965127;;cta;;29;;29;;;;
;965157..965232;;cac;;146;146;;;;;
;965379..965717;;CDS;;;;;;113;;
;;;;;;;;;;;
comp;974621..974842;;CDS;;564;*564;;;74;;
;975407..975480;;aag;;90;;*90;;;;
;975571..975653;;ttg;;504;;*504;;;;
;976158..976231;;aaa;;148;148;;;;;
comp;976380..976679;;CDS;;;;;;100;;
;;;;;;;;;;;
comp;1006329..1008095;;CDS;;397;397;;;*589;;
;1008493..1008614;;5s;@3;748;;;;122;;
;1009363..1009485;;5s;;286;;;;123;;
;1009772..1012638;;23s;;233;;;;2867;;
;1012872..1012945;;gca;;72;;;;;;
;1013018..1014497;;16s;;454;*454;;;1480;;
;1014952..1016097;;CDS;;;;;;382;;
;;;;;;;;;;;
comp;1088211..1088831;;CDS;;53;53;;;207;;
comp;1088885..1089038;;tgg;@1;40;;40;;;;
comp;1089079..1089150;;tgc;;212;212;;;;;
comp;1089363..1089746;;CDS;;;;;;128;;
;;;;;;;;;;;
;1143658..1144137;;CDS;;166;166;;;160;;
comp;1144304..1144610;;ncRNA;@2;14;14;;;307;;
comp;1144625..1144699;;atgf;;139;139;;;;;
comp;1144839..1145162;;CDS;;;;;;108;;
;;;;;;;;;;;
;1153368..1154087;;CDS;;56;56;;;240;;
;1154144..1154217;;aga;;62;;62;;;;
;1154280..1154354;;agg;;552;*552;;;;;
comp;1154907..1156157;;CDS;;;;;;417;;
;;;;;;;;;;;
;1247204..1247659;;CDS;;4;4;;;152;;
comp;1247664..1247739;;cga;;133;133;;;;;
comp;1247873..1248481;;CDS;;;;;;203;;
;;;;;;;;;;;
comp;1320721..1321641;;CDS;;183;183;;;307;;
;1321825..1321896;;gta;;99;;*99;;;;
;1321996..1322067;;gtg;;228;228;;;;;
comp;1322296..1323084;;CDS;;;;;;263;;
;;;;;;;;;;;
comp;1403886..1409507;;CDS;;351;351;;;*1874;;
comp;1409859..1409930;;cgc;;222;222;;;;;
comp;1410153..1410620;;CDS;;;;;;156;;
;;;;;;;;;;;
;1532795..1533088;;CDS;;127;127;;;98;;
comp;1533216..1533325;;atgj;@1;246;246;;;;;
;1533572..1534402;;CDS;;;;;;277;;
;;;;;;;;;;;
;1541929..1542321;;CDS;;127;127;;;131;;
;1542449..1542522;;ggg;;1;*1;;;;;
comp;1542524..1543528;;CDS;;;;;;335;;
;;;;;;;;;;;
;1602054..1603277;;CDS;;257;257;;;408;;
;1603535..1603608;;aca;;76;;76;;;;
;1603685..1603759;;cca;;44;;44;;;;
;1603804..1603877;;tac;;170;;*170;;;;
;1604048..1604119;;gac;;7;;7;;;;
;1604127..1604200;;aaa;;24;24;;;;;
;1604225..1604461;;CDS;;;;;;79;;
;;;;;;;;;;;
;1617553..1617861;;CDS;;187;187;;;103;;
;1618049..1618133;;tca;;252;252;;;;;
;1618386..1619444;;CDS;;;;;;353;;
;;;;;;;;;;;
comp;1692202..1692552;;CDS;;271;271;;;117;;
comp;1692824..1692895;;cag;;156;156;;;;;
comp;1693052..1693972;;CDS;;;;;;307;;
;;;;;;;;;;;
;1887796..1888038;;CDS;;136;136;;;81;;
;1888175..1888257;;ctg;;193;193;;;;;
;1888451..1891267;;CDS;;;;;;*939;;
;;;;;;;;;;;
;2057488..2057883;;CDS;;230;230;;;132;;
;2058114..2058184;;tgc;;143;143;;;;;
;2058328..2059713;;CDS;;;;;;462;;
;;;;;;;;;;;
;2128536..2129312;;CDS;;123;123;;;259;;
;2129436..2129509;;acg;;362;362;;;;;
comp;2129872..2130963;;CDS;;;;;;;;
;;;;;;;;;;;
comp;2204492..2204932;;CDS;;178;178;;;147;;
;2205111..2205182;;gtc;;4;;4;;;;
;2205187..2205259;;ttc;;283;283;;;;;
comp;2205543..2205875;;CDS;;;;;;111;;
;;;;;;;;;;;
;2317208..2317498;;CDS;;271;271;;;97;;
;2317770..2317842;;atc;;460;*460;;;;;
;2318303..2318863;;CDS;;;;;;187;;
;;;;;;;;;;;
comp;2414821..2415903;;CDS;;491;*491;;;361;;
;2416395..2416468;;gcc;;303;303;;;;;
comp;2416772..2417797;;CDS;;;;;;342;;
;;;;;;;;;;;
comp;2432399..2432848;;CDS;;537;*537;;;150;;
;2433386..2433459;;ggc;;2;;2;;;;
;2433462..2433535;;gga;;326;326;;;;;
comp;2433862..2434263;;CDS;;;;;;134;;

mfi cumuls[modifier | modifier le wikicode]

mfi cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;2;1;0;-;1;2;1;;100;9;30;0
;16 23 5s 0;0;20;4;;50;8;20;;200;21;60;3
;16 gca 235;2;40;2;;100;3;40;;300;10;90;3
;16 23 5s a;0;60;3;;150;10;60;;400;12;120;10
;max a;1;80;2;;200;12;80;;500;5;150;7
;a doubles;0;100;3;;250;8;100;;600;1;180;5
;autres;2;120;0;;300;7;120;;700;1;210;5
;total aas;2;140;0;;350;3;140;;800;0;240;2
sans ;opérons;29;160;0;;400;3;160;;900;0;270;4
;1 aa;20;180;1;;450;0;180;;1000;1;300;1
;max a;5;200;0;;500;3;200;;1100;0;330;6
;a doubles;0;;1;;;5;;;;1;;15
;total aas;45;;16;0;;64;;0;;61;;61
total aas;;47;;;;;;;;;;;
remarques;;3;;;;;;;;;;;
avec jaune;;;moyenne;83;;;224;;;;266;;
;;;variance;121;;;176;;;;265;;
sans jaune;;;moyenne;35;;;178;;;;213;;171
;;;variance;27;;;96;;;;115;;81

mfi blocs[modifier | modifier le wikicode]

mfi blocs;;
CDS;939;201
5s;305;123
23s;233;2867
gca;87;
16s;724;1480
CDS;;322
;;
CDS;397;589
5s;748;122
5s;286;123
23s;233;2867
gca;72;
16s;454;1480
CDS;;382

mfi remarques[modifier | modifier le wikicode]

mfi;;;;;;;47
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgt;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;2
atc;1;acc;1;aac;2;agc;1
ctc;1;ccc;;cac;1;cgc;1
gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;2;aga;1
cta;1;cca;1;caa;2;cga;1
gta;1;gca;2;gaa;1;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;1;ccg;;cag;1;cgg;
gtg;1;gcg;1;gag;;ggg;1

mja[modifier | modifier le wikicode]

mja opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/archaea/Meth_jann_DSM_2661/methJann1-tRNAs.fa;gtRNAdb;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_000909.1;mja;;genome;;;;;;;;
31.3%GC;17.8.19 Paris;16s  2 ;37;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines
Methanocaldococcus jannaschii DSM 2661;;;;;;;;;;;
comp;96499..97053;;CDS;;372;372;;;185;;
comp;97426..97537;;atgj;@1;91;;*91;;;;
;97629..97716;;ctc;;241;241;;;;;
;97958..99259;;CDS;;;;;;434;;
;;;;;;;;;;;
comp;110328..111545;;CDS;;222;222;;;406;;
;111768..111852;;tga ;;21;21;;;;;
;111874..112785;;CDS;;;;;;304;;
;;;;;;;;;;;
;137244..138245;;CDS;;98;98;;;334;;
comp;138344..138419;;gtg;;59;59;;;;;
comp;138479..138781;;CDS;;;;;;101;;
;;;;;;;;;;;
;153070..154479;;CDS;;182;182;;;470;;
comp;154662..157639;;23s;;207;;;;2978;;
comp;157847..157919;;gca;;64;;;;;;
comp;157984..159463;;16s;;340;340;;;1480;;
;159804..160085;;CDS;;;;;;94;;
;;;;;;;;;;;
comp;185874..186671;;CDS;;306;306;;;266;;
;186978..187066;;tcc;;71;71;;;;;
;187138..187590;;CDS;;;;;;151;;
;;;;;;;;;;;
;190579..190800;;CDS;;31;31;;;74;;
;190832..190908;;ccc;;32;32;;;;;
;190941..191114;;CDS;;;;;;58;;
;;;;;;;;;;;
comp;214560..215060;;CDS;;149;149;;;167;;
;215210..215297;;tta;;154;154;;;;;
;215452..216240;;CDS;;;;;;263;;
;;;;;;;;;;;
;226386..227639;;CDS;;64;64;;;418;;
comp;227704..227780;;gcc;;239;239;;;;;
;228020..229720;;CDS;;;;;;*567;;
;;;;;;;;;;;
;303613..303927;;CDS;;64;64;;;105;;
;303992..304081;;tca;;230;230;;;;;
comp;304312..304752;;CDS;;;;;;147;;
;;;;;;;;;;;
comp;357984..358547;;CDS;;220;220;;;188;;
;358768..358845;;aga;;23;;23;;;;
;358869..358943;;gaa;;164;164;;;;;
;359108..359923;;CDS;;;;;;272;;
;;;;;;;;;;;
;359108..359923;;CDS;;48;48;;;272;;
comp;359972..360047;;atgf;;103;103;;;;;
comp;360151..361485;;CDS;;;;;;445;;
;;;;;;;;;;;
;401945..402796;;CDS;;171;171;;;284;;
comp;402968..403044;;gtc;;229;229;;;;;
;403274..403834;;CDS;;;;;;187;;
;;;;;;;;;;;
comp;618311..618757;;CDS;;402;*402;;;149;;
comp;619160..619234;;tgc;;63;63;;;;;
comp;619298..619915;;CDS;;;;;;206;;
;;;;;;;;;;;
;636394..637449;;CDS;;133;133;;;352;;
;637583..637659;;ttc;;7;;;7;;;
;637667..637742;;aac;;29;;;29;;;
;637772..637849;;atgi;;18;;;18;;;
;637868..637942;;gaa;;39;;;39;;;
;637982..638069;;cta;;11;;;11;;;
;638081..638152;;cac;;295;;;;;;
;638448..639930;;16s;;64;;;;1483;;
;639995..640067;;gca;;207;;;;;;
;640275..643254;;23s;;78;;;;2980;;
;643333..643447;;5s;;56;;;;115;;
;643504..643761;;ncRNA;@2;232;232;;;258;;
;643994..644962;;CDS;;;;;;323;;
;;;;;;;;;;;
;762859..763608;;CDS;;157;157;;;250;;
comp;763766..763842;;acc;;178;;*178;;;;
;764021..764096;;caa;;50;50;;;;;
;764147..764818;;CDS;;;;;;224;;
;;;;;;;;;;;
;862207..862410;;CDS;;179;179;;;68;;
;862590..862661;;cga;;41;41;;;;;
;862703..863392;;CDS;;86;86;;;230;;
;863479..863555;;aca;;14;;;14;;;
;863570..863647;;cca;;8;;;8;;;
;863656..863732;;tac;;83;;;83;;;
;863816..863889;;aaa;;13;;;;;;
;863903..864017;;5s;@3;46;;;;115;;
;864064..864141;;gac;;80;80;;;;;
;864222..864842;;CDS;;;;;;207;;
;;;;;;;;;;;
;871492..873447;;CDS;;238;238;;;*652;;
comp;873686..873763;;atc;;102;102;;;;;
comp;873866..875110;;CDS;;;;;;415;;
;;;;;;;;;;;
comp;882566..883615;;CDS;;65;65;;;350;;
;883681..883754;;gta;;123;123;;;;;
comp;883878..884297;;CDS;;;;;;140;;
;;;;;;;;;;;
comp;1037197..1038504;;CDS;;39;39;;;436;;
comp;1038544..1038620;;cgc;@4;1;*1;;;;;
comp;1038622..1039386;;CDS;;;;;;255;;
;;;;;;;;;;;
comp;1148669..1149934;;CDS;;210;210;;;422;;
;1150145..1150220;;ggc;;34;;34;;;;
;1150255..1150330;;gga;;243;243;;;;;
;1150574..1151254;;CDS;;;;;;227;;
;;;;;;;;;;;
comp;1188906..1189772;;CDS;;172;172;;;289;;
;1189945..1190055;;tgg;@1;95;95;;;;;
;1190151..1190684;;CDS;;;;;;178;;
;;;;;;;;;;;
comp;1312335..1312781;;CDS;;383;383;;;149;;
;1313165..1313249;;agc;;177;177;;;;;
;1313427..1314617;;CDS;;;;;;397;;

mja cumuls[modifier | modifier le wikicode]

mja cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;2;1;0;0;1;1;1;;100;4;30;0
;16 23 5s 0;0;20;0;5;50;7;20;;200;12;60;1
;16 atc gca;0;40;2;2;100;10;40;;300;13;90;2
;16 23 5s a;0;60;0;0;150;5;60;;400;6;120;3
;max a;7;80;0;0;200;8;80;;500;8;150;4
;a doubles;0;100;1;1;250;10;100;;600;1;180;3
;autres;2;120;0;0;300;0;120;;700;1;210;5
;total aas;13;140;0;0;350;2;140;;800;0;240;3
sans ;opérons;20;160;0;0;400;2;160;;900;0;270;4
;1 aa;16;180;1;0;450;1;180;;1000;0;300;4
;max a;2;200;0;0;500;0;200;;1100;0;330;2
;a doubles;0;;0;0;;0;;;;0;;14
;total aas;24;;4;8;;46;;0;;45;;45
total aas;;37;;;;;;;;;;;
remarques;;4;;;;;;;;;;;
avec jaune;;;moyenne;82;26;;154;;;;269;;
;;;variance;71;25;;102;;;;137;;
sans jaune;;;moyenne;29;18;;152;;;;253;;194
;;;variance;8;12;;95;;;;117;;74

mja blocs[modifier | modifier le wikicode]

mja blocs;;
CDS;182;
23s;207;2978
gca;64;
16s;340;1480
CDS;;
;;
cac;295;
16s;64;1483
gca;207;
23s;78;2980
5s;56;115
ncRNA;232;258
CDS;;
;;
aaa;13;
5s;46;115
gac;80;
CDS;;

mja remarques[modifier | modifier le wikicode]

mja;;;;;;;37
atgi;1;tct;;tat;;atgf;1
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgt;
gtt;;gct;;gat;;ggt;
ttc;1;tcc;1;tac;1;tgc;1
atc;1;acc;1;aac;1;agc;1
ctc;1;ccc;1;cac;1;cgc;1
gtc;1;gcc;1;gac;1;ggc;1
tta;1;tca;1;taa;;tga;1
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;2;gaa;2;gga;1
ttg;;tcg;;tag;;tgg;1
atgj;1;acg;;aag;;agg;
ctg;;ccg;;cag;;cgg;
gtg;1;gcg;;gag;;ggg;

mba[modifier | modifier le wikicode]

mba opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/archaea/Meth_bark_Fusaro/methBark1-tRNAs.fa;gtRNAdb;;;;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NC_007355.1;mba;;genome;;;;;;;;;
39.2%GC;2.2.20 Paris;16s 3 ;62;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Methanosarcina barkeri str. Fusaro;;;;;;;;;;;;
;91192..91938;;cds;;137;137;;;249;;DUF429 domain-containing protein;*
comp;92076..92160;;ctc;+;132;;*132;;;;;*
comp;92293..92377;;ctc;2 ctc;298;298;;;;;;*
comp;92676..93476;;cds;;;;;;267;;DNA-directed RNA polymerase subunit D;*
;;;;;;;;;;;;*
comp;98630..99337;;cds;;535;*535;;;236;;ABC transporter ATP-binding protein;*
comp;99873..99955;;tcc;;222;222;;;;;;*
comp;100178..101194;;cds;;;;;;339;;RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5;*
;;;;;;;;;;;;*
comp;146979..147518;;cds;;80;80;;;180;;tyrosine-type recombinase/integrase;*
comp;147599..147670;;acc;;198;198;;;;;;*
comp;147869..148381;;cds;;;;;;171;;DUF98 domain-containing protein;*
;;;;;;;;;;;;*
comp;199345..200268;;cds;;492;*492;;;308;;aldolase;*
comp;200761..200833;;aac;+;71;;71;;;;;*
comp;200905..200979;;atgi;2 aac;119;;*119;;;;;*
comp;201099..201171;;aac;;964;*964;;;;;;*
;202136..202366;;cds;;;;;;77;;hp;*
;;;;;;;;;;;;*
;260990..261532;;cds;;173;173;;;181;;nitroreductase family protein";*
;261706..261777;;cgg;;673;*673;;;;;;*
;262451..262960;;cds;;;;;;170;;hp;*
;;;;;;;;;;;;*
comp;463836..464723;;cds;;2075;*2075;;;296;;polyprenyl synthetase family protein;*
;466799..466870;;gga;;94;;*94;;;;;*
;466965..467049;;cta;;221;221;;;;;;*
comp;467271..468818;;cds;;;;;;*516;;MBL fold metallo-hydrolase;*
;;;;;;;;;;;;*
;473154..473723;;cds;;298;298;;;190;;hp;*
comp;474022..474096;;gag;;246;246;;;;;;*
comp;474343..475584;;cds;;;;;;414;;proteasome-activating nucleotidase;*
;;;;;;;;;;;;*
comp;692109..692987;;cds;;349;349;;;293;;branched-chain-amino-acid transaminase;*
;693337..693411;;aga;;400;400;;;;;;*
comp;693812..694420;;cds;;;;;;203;;sulfite exporter TauE/SafE family protein;*
;;;;;;;;;;;;*
comp;703446..703958;;cds;;488;*488;;;171;;biotin transporter BioY;*
;704447..704521;;agg;;283;283;;;;;;*
;704805..705284;;cds;;;;;;160;;N-acetyltransferase;*
;;;;;;;;;;;;*
comp;800463..800642;;cds;;799;*799;;;60;;hp;*
comp;801442..801526;;agc;;137;137;;;;;;*
comp;801664..801978;;ncRNA;@1;327;327;;;315;;;*
;802306..803931;;cds;;;;;;*542;;methylamine methyltransferase corrinoid protein reductive activase;*
;;;;;;;;;;;;*
;1109819..1110013;;cds;;15;15;;;65;;hp;*
;1110029..1110103;;atgf;+;63;;63;;;;;*
;1110167..1110241;;atgf;3 atg;63;;63;;;;;*
;1110305..1110379;;atgf;;273;273;;;;;;*
;1110653..1111984;;cds;;;;;;444;;signal recognition particle protein;*
;;;;;;;;;;;;*
comp;1134460..1135074;;cds;;235;235;;;205;;endonuclease III;*
comp;1135310..1135381;;tgc;+;65;;65;;;;;*
comp;1135447..1135518;;tgc;2 tgc;126;126;;;;;;*
comp;1135645..1136277;;cds;;;;;;211;;hp;*
;;;;;;;;;;;;*
;1137210..1137680;;cds;;488;*488;;;157;;P-bacterioferritin;*
comp;1138169..1138290;;5s;;129;;;;122;;;*
comp;1138420..1141252;;23s;;222;;;;2833;;;*
comp;1141475..1142963;;16s;;830;*830;;;1489;;;*
;1143794..1145302;;cds;;;;;;*503;;2-isopropylmalate synthase;*
;;;;;;;;;;;;
comp;1249870..1250040;;cds;;423;*423;;;57;;CopG family transcriptional regulator;*
comp;1250464..1250537;;aag;;546;*546;;;;;;*
;1251084..1251290;;cds;;;;;;69;;TRAM domain-containing protein;*
;;;;;;;;;;;;*
;1315521..1315691;;cds;@2;-12;*-12;;;57;;hp;*
comp;1315680..1315751;;cgc;;174;174;;;;;;*
;1315926..1317110;;cds;;;;;;395;;redox-regulated ATPase YchF;*
;;;;;;;;;;;;*
<comp;1514831..1515373;;cds;;1133;*1133;;;181;;ArsR family transcriptional regulator;*
;1516507..1516579;;caa;;760;*760;;;;;;*
comp;1517340..1517663;;cds;;;;;;108;;hp;*
;;;;;;;;;;;;*
comp;1538879..1539286;;cds;;36;36;;;136;;sensor histidine kinase;*
comp;1539323..1539395;;other;@3;1249;*1249;;;73;;;*
>comp;1540645..1540794;;cds;;;;;;50;;PKD domain-containing protein;*
;;;;;;;;;;;;*
comp;1546247..1547791;;cds;;576;*576;;;*515;;aminotransferase class V-fold PLP-dependent enzyme;*
comp;1548368..1548441;;aca;;448;*448;;;;;;*
<;1548890..1549093;;cds;;;;;;68;;matrixin family metalloprotease;*
;;;;;;;;;;;;*
;1550566..1550760;;cds;;745;*745;;;65;;DeoR family transcriptional regulator;*
comp;1551506..1551579;;aca;;506;*506;;;;;;*
;1552086..1552640;;cds;;;;;;185;;YkgJ family cysteine cluster protein;*
;;;;;;;;;;;;*
;1621639..1622835;;cds;;433;*433;;;399;;methionine adenosyltransferase;*
;1623269..1623384;;tac;@4;112;;*112;;;;;*
;1623497..1623569;;gac;;300;300;;;;;;*
comp;1623870..1624067;;cds;;;;;;66;;hp;*
;;;;;;;;;;;;*
;1714788..1715069;;cds;;154;154;;;94;;hp;*
comp;1715224..1715295;;acg;;187;187;;;;;;*
comp;1715483..1716493;;cds;;;;;;337;;class I SAM-dependent methyltransferase family protein;*
;;;;;;;;;;;;*
comp;1755811..1755993;;cds;;113;113;;;61;;DNA-directed RNA polymerase subunit K;*
comp;1756107..1756181;;ccg;@5;0;*0;;;;;;*
comp;1756182..1756370;;cds;;;;;;63;;DNA-directed RNA polymerase subunit N;*
;;;;;;;;;;;;*
;1842058..1842195;;cds;;16;16;;;46;;hp;*
comp;1842212..1842285;;gtg;;717;*717;;;;;;*
;1843003..1843767;;cds;;;;;;255;;peptidase A24;*
;;;;;;;;;;;;*
comp;1852573..1852896;;cds;;1364;*1364;;;108;;PadR family transcriptional regulator;*
comp;1854261..1854338;;ccc;;198;198;;;;;;*
comp;1854537..1855097;;cds;;;;;;187;;CDP-alcohol phosphatidyltransferase family protein;*
;;;;;;;;;;;;*
comp;1908225..1908989;;cds;;349;349;;;255;;hp;*
comp;1909339..1909530;;tgg;;445;*445;;;;;;*
>;1909976..1910152;;cds;;;;;;59;;nitrogenase reductase;*
;;;;;;;;;;;;*
;1926717..1927178;;cds;;183;183;;;154;;DUF4145 domain-containing protein;*
comp;1927362..1927445;;tcg;;125;125;;;;;;*
comp;1927571..1928944;;cds;;;;;;458;;endonuclease Q family protein;*
;;;;;;;;;;;;*
comp;2005431..2007053;;cds;;2315;*2315;;;*541;;PKD domain-containing protein;*
comp;2009369..2009443;;cca;;199;199;;;;;;*
comp;2009643..2010194;;cds;;;;;;184;;UbiX family flavin prenyltransferase;*
;;;;;;;;;;;;*
comp;2026807..2028456;;cds;;314;314;;;*550;;ATP-dependent DNA ligase;*
;2028771..2028842;;ggg;;513;*513;;;;;;*
comp;2029356..2029766;;cds;;;;;;137;;PaaI family thioesterase;*
;;;;;;;;;;;;*
;2157926..2158684;;cds;;567;*567;;;253;;hp;*
;2159252..2159362;;atgj;;349;349;;;;;;*
;2159712..2160225;;cds;;;;;;171;;amidohydrolase family protein;*
;;;;;;;;;;;;
comp;2194967..2195302;;cds;;713;*713;;;112;;translation initiation factor eIF-1A;*
;2196016..2197504;;16s;;222;;;;1489;;;*
;2197727..2200559;;23s;;129;;;;2833;;;*
;2200689..2200810;;5s;;607;*607;;;122;;;*
comp;2201418..2201615;;cds;;;;;;66;;hp;*
;;;;;;;;;;;;*
>comp;2434335..2434609;;cds;;603;*603;;;92;;nucleoside deaminase;*
comp;2435213..2435284;;gcc;;223;;*223;;;;;*
;2435508..2435584;;atc;+;74;;74;;;;;*
;2435659..2435735;;atc;2 atc;241;241;;;;;;*
comp;2435977..2436390;;cds;;;;;;138;;transcriptional regulator;*
;;;;;;;;;;;;*
;2622097..2624025;;cds;;1489;*1489;;;*643;;replication factor C large subunit;*
;2625515..2625588;;gta;;1102;*1102;;;;;;*
;2626691..2626918;;cds;;;;;;76;;hp;*
;;;;;;;;;;;;*
;2650514..2651296;;cds;;164;164;;;261;;thiazole biosynthesis protein;*
;2651461..2651532;;cac;;218;218;;;;;;*
;2651751..2653460;;cds;;;;;;*570;;radical SAM protein;*
;;;;;;;;;;;;*
;2663547..2664668;;cds;;318;318;;;374;;PGF-pre-PGF domain-containing protein;*
comp;2664987..2665058;;ggc;;263;263;;;;;;*
;2665322..2666563;;cds;;;;;;414;;hp;*
;;;;;;;;;;;;*
;2856552..2857409;;cds;;134;134;;;286;;hp;*
comp;2857544..2857628;;tca;;153;153;;;;;;*
comp;2857782..2858546;;cds;;;;;;255;;peptidylprolyl isomerase;*
;;;;;;;;;;;;*
;3326036..3326557;;cds;;539;*539;;;174;;hp;*
;3327097..3327168;;tgc;;995;*995;;;;;;*
;3328164..3328898;;cds;;;;;;245;;hp;*
;;;;;;;;;;;;*
;3994472..3994921;;cds;;514;*514;;;150;;IS200/IS605 family transposase;*
comp;3995436..3995529;;cga;;477;*477;;;;;;*
;3996007..3996714;;cds;;;;;;236;;hp;*
;;;;;;;;;;;;*
;4005709..4006026;;cds;;269;269;;;106;;divalent-cation tolerance protein CutA;*
;4006296..4006378;;ttg;;860;*860;;;;;;*
;4007239..4009012;;rpr;@6;169;169;;;1774;;Family CRISPR;*
comp;4009182..4009478;;cds;;;;;;99;;CRISPR-associated endonuclease Cas2;*
;;;;;;;;;;;;*
comp;4031590..4031871;;cds;;1075;*1075;;;94;;hp;*
;4032947..4033019;;cag;;182;182;;;;;;*
comp;4033202..4033765;;cds;;;;;;188;;hp;*
;;;;;;;;;;;;*
comp;4041205..4041960;;cds;;96;96;;;252;;MBL fold metallo-hydrolase;*
;4042057..4042141;;tta;;375;375;;;;;;*
comp;4042517..4044976;;cds;;;;;;*820;;beta-propeller fold lactonase family protein;*
;;;;;;;;;;;;*
comp;4045359..4048274;;cds;;718;*718;;;*972;;PKD domain-containing protein;*
;4048993..4049077;;tta;;35;35;;;;;;*
comp;4049113..4052403;;cds;;241;241;;;*1097;;PGF-pre-PGF domain-containing protein;*
;4052645..4052729;;tta;;177;177;;;;;;*
comp;4052907..4053395;;cds;;;;;;163;;MarR family transcriptional regulator;*
;;;;;;;;;;;;*
;4407561..4407830;;cds;;64;64;;;90;;elongation factor 1-beta;*
;4407895..4407966;;gcg;;675;*675;;;;;;*
comp;4408642..4409715;;cds;;;;;;358;;radical SAM protein;*
;;;;;;;;;;;;*
comp;4504139..4504300;;cds;;536;*536;;;54;;hp;*
comp;4504837..4504921;;ctg;;220;220;;;;;;*
comp;4505142..4506050;;cds;;;;;;303;;ornithine carbamoyltransferase;*
;;;;;;;;;;;;*
comp;4551177..4551851;;cds;;566;*566;;;225;;MBL fold metallo-hydrolase;*
;4552418..4552491;;gtc;+;94;;*94;;;;;*
;4552586..4552660;;ttc;2 gtc;7;;7;;;;;*
;4552668..4552739;;ggc;2 ttc;61;;61;;;;;*
;4552801..4552874;;gtc;2 ggc;94;;*94;;;;;*
;4552969..4553043;;ttc;;7;;7;;;;;*
;4553051..4553122;;ggc;;717;*717;;;;;;*
;4553840..4554052;;cds;;;;;;71;;MoaD/ThiS family protein;*
;;;;;;;;;;;;*
;4617920..4618339;;cds;;200;200;;;140;;hp;*
;4618540..4618617;;gaa;;351;351;;;;;;*
;4618969..4619190;;cds;;377;377;;;74;;hp;*
;4619568..4619645;;gaa;;214;214;;;;;;*
comp;4619860..4620678;;cds;;;;;;273;;hp;*
;;;;;;;;;;;;*
;4673041..4673643;;cds;;289;289;;;201;;adenosylcobinamide amidohydrolase;*
comp;4673933..4674054;;5s;;129;;;;122;;;*
comp;4674184..4677016;;23s;;135;;;;2833;;;*
comp;4677152..4677224;;gca;;79;;;;;;;*
comp;4677304..4678792;;16s;;1242;*1242;;;1489;;;*
;4680035..4680817;;cds;;;;;;261;;methanol-5-hydroxybenzimidazolylcobamide methyltransferase;*
;;;;;;;;;;;;*
comp;4759174..4759410;;cds;;89;89;;;79;;DNA-directed RNA polymerase subunit H;*
comp;4759500..4759576;;aaa;;655;*655;;;;;;*
comp;4760232..4760801;;cds;;;;;;190;;DJ-1/PfpI family protein;*

mba cumuls[modifier | modifier le wikicode]

mba cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;3;1;0;-;1;2;1;;100;25;30;0
;16 23 5s 0;2;20;2;;50;4;20;;200;27;60;7
;16 gca 235;1;40;0;;100;4;40;;300;21;90;14
;16 23 5s a;0;60;0;;150;6;60;;400;8;120;8
;max a;1;80;6;;200;14;80;;500;4;150;5
;a doubles;0;100;3;;250;9;100;;600;7;180;10
;autres;0;120;2;;300;8;120;;700;1;210;11
;total aas;1;140;1;;350;6;140;;800;0;240;4
sans ;opérons;44;160;0;;400;4;160;;900;1;270;10
;1 aa;37;180;0;;450;4;180;;1000;1;300;4
;max a;6;200;0;;500;4;200;;1100;1;330;2
;a doubles;6;;1;;;35;;;;0;;21
;total aas;61;;15;0;;100;;0;;96;;96
total aas;;62;;;;;;;;;;;
remarques;;6;;;;;;;;;;;
avec jaune;;;moyenne;85;;;457;;;;240;;
;;;variance;52;;;407;;;;194;;
sans jaune;;;moyenne;51;;;210;;;;186;;158
;;;variance;28;;;98;;;;106;;78

mba blocs[modifier | modifier le wikicode]

mba blocs;;;;
cds;289;201;adenosylcobinamide amidohydrolase;*
5s;129;122;;*
23s;135;2833;;*
gca;79;;;*
16s;1242;1489;;*
cds;;261;methanol-5-hydroxybenzimidazolylcobamide methyltransferase;*
;;;;
cds;713;112;translation initiation factor eIF-1A;*
16s;222;1489;;*
23s;129;2833;;*
5s;607;122;;*
cds;;66;hp;*
;;;;
cds;488;157;P-bacterioferritin;*
5s;129;122;;*
23s;222;2833;;*
16s;830;1489;;*
cds;;503;2-isopropylmalate synthase;*

mba remarques[modifier | modifier le wikicode]

mba;;;;;;62;62
atgi;1;tct;;tat;;atgf;3
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgt;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;4
atc;2;acc;1;aac;2;agc;1
ctc;2;ccc;1;cac;1;cgc;1
gtc;2;gcc;1;gac;1;ggc;3
tta;3;tca;1;taa;;tga;
ata;;aca;2;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;1;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;1;ccg;1;cag;1;cgg;1
gtg;1;gcg;1;gag;1;ggg;1

mfe[modifier | modifier le wikicode]

mfe opérons[modifier | modifier le wikicode]

http://gtrnadb.ucsc.edu/genomes/archaea/Meth_WH1/methSp_WH1-tRNAs.fa;gtRNAdb;;%GC;41.80%;;;;;;;;
https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009504.1;mfe;;genome;;;;;;;;;
40.2%GC;3.2.20 Paris;16s  3;56;doubles;intercalaires;CDS;aa;avec aa;cdsa;cdsd;protéines;
Methanosarcina sp. WH1;;;;;;;;;;;;
comp;38726..40264;;cds;;698;*698;;;*513;;2-isopropylmalate synthase;*
;40963..42450;;16s;;208;;;;1488;;;*
;42659..45491;;23s;;130;;;;2833;;;*
;45622..45743;;5s;;857;*857;;;122;;;*
;46601..47164;;cds;;102;102;;;188;;hp;*
;47267..47338;;tgc;+;72;;72;;;;;*
;47411..47482;;tgc;2 tgc;411;*411;;;;;;*
;47894..48508;;cds;;;;;;205;;endonuclease III;*
;;;;;;;;;;;;*
comp;71092..72423;;cds;;384;384;;;444;;signal recognition particle protein;*
comp;72808..72882;;atgf;+;89;;*89;;;;;*
comp;72972..73046;;atgf;2 atgf;234;234;;;;;;*
;73281..73472;;cds;;;;;;64;;hp;*
;;;;;;;;;;;;*
comp;175573..176153;;cds;;163;163;;;194;;hp;*
comp;176317..176389;;gac;;111;;*111;;;;;*
comp;176501..176614;;tac;@1;295;295;;;;;;*
;176910..177248;;cds;;;;;;113;;hp;*
;;;;;;;;;;;;*
comp;214884..215966;;cds;;801;*801;;;361;;hp;*
comp;216768..216841;;aca;;150;150;;;;;;*
;216992..217582;;cds;;;;;;197;;aldolase;*
;;;;;;;;;;;;*
comp;372219..373091;;cds;;558;*558;;;291;;hp;*
comp;373650..373723;;gtg;;340;340;;;;;;*
;374064..374828;;cds;;;;;;255;;peptidase A24;*
;;;;;;;;;;;;*
comp;379248..381950;;cds;;1076;*1076;;;*901;;DNA mismatch repair protein MutS;*
comp;383027..383104;;ccc;;193;193;;;;;;*
comp;383298..383882;;cds;;;;;;195;;CDP-alcohol phosphatidyltransferase family protein;*
;;;;;;;;;;;;*
comp;532751..533176;;cds;;356;356;;;142;;hp;*
comp;533533..533607;;cca;;149;149;;;;;;*
comp;533757..534308;;cds;;;;;;184;;UbiX family flavin prenyltransferase;*
;;;;;;;;;;;;*
comp;598666..599850;;cds;;170;170;;;395;;redox-regulated ATPase YchF;*
;600021..600092;;cgc;;341;341;;;;;;*
;600434..600868;;cds;;;;;;145;;cell surface lipoprotein;*
;;;;;;;;;;;;*
;680493..681734;;cds;;185;185;;;414;;proteasome-activating nucleotidase;*
;681920..681994;;gag;;242;242;;;;;;*
>;682237..682560;;cds;;;;;;108;;p-IS200/IS605 family transposase;*
;;;;;;;;;;;;*
;689062..689631;;cds;;36;36;;;190;;phosphatase PAP2 family protein;*
comp;689668..689752;;cta;;73;;73;;;;;*
comp;689826..689897;;gga;;1481;*1481;;;;;;*
;691379..691483;;cds;;;;;;35;;CcmD family protein;*
;;;;;;;;;;;;*
comp;793563..795017;;cds;;111;111;;;485;;p-IS66 family transposase;*
comp;795129..795213;;ctc;+;117;;*117;;;;;*
comp;795331..795418;;ctc;2 ctc;235;235;;;;;;*
comp;795654..796454;;cds;;;;;;267;;DNA-directed RNA polymerase subunit D;*
;;;;;;;;;;;;*
;810088..810471;;cds;;861;*861;;;128;;hp;*
comp;811333..811415;;tcc;;123;123;;;;;;*
comp;811539..812555;;cds;;;;;;339;;RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5;*
;;;;;;;;;;;;*
comp;893309..894232;;cds;;391;391;;;308;;aldolase;*
comp;894624..894696;;aac;+;87;;*87;;;;;*
comp;894784..894858;;atgi;2 aac;110;;*110;;;;;*
comp;894969..895041;;aac;;1415;*1415;;;;;;*
comp;896457..897506;;cds;;;;;;350;;TIGR00303 family protein;*
;;;;;;;;;;;;*
;949570..950112;;cds;;208;208;;;181;;nitroreductase family protein;*
;950321..950392;;cgg;;498;*498;;;;;;*
comp;950891..952300;;cds;;;;;;470;;NADPH-dependent glutamate synthase;*
;;;;;;;;;;;;*
;1088496..1090946;;cds;;360;360;;;*817;;PGF-pre-PGF domain-containing protein;*
comp;1091307..1091378;;gcc;;227;;*227;;;;;*
;1091606..1091682;;atc;+;62;;62;;;;;*
;1091745..1091818;;atc;2 atc;353;353;;;;;;*
comp;1092172..1092585;;cds;;;;;;138;;transcriptional regulator;*
;;;;;;;;;;;;*
;1155736..1156137;;cds;;210;210;;;134;;AsnC family transcriptional regulator;*
;1156348..1156425;;gaa;+;718;;*718;;;;;*
;1157144..1157221;;gaa;2 gaa;233;233;;;;;;*
comp;1157455..1158645;;cds;@4;;;;;397;;ISH3 family transposase;*
;;;;;;;;;;;;*
comp;1199367..1200149;;cds;;967;*967;;;261;;methanol-5-hydroxybenzimidazolylcobamide methyltransferase;*
;1201117..1202604;;16s;;80;;;;1488;;;*
;1202685..1202757;;gca;;135;;;;;;;*
;1202893..1205725;;23s;;130;;;;2833;;;*
;1205856..1205977;;5s;;5;5;;;122;;;*
comp;1205983..1206231;;cds;;;;;;83;;hp;*
;;;;;;;;;;;;*
;1207508..1211485;;cds;;12;12;;;*1326;;PAS domain S-box protein;*
comp;1211498..1211582;;ctg;;190;190;;;;;;*
comp;1211773..1212681;;cds;;;;;;303;;ornithine carbamoyltransferase;*
;;;;;;;;;;;;*
comp;1220571..1220783;;cds;;596;*596;;;71;;MoaD/ThiS family protein;*
comp;1221380..1221451;;ggc;+;25;;25;;;;;*
comp;1221477..1221551;;ttc;2 ggc;57;;57;;;;;*
comp;1221609..1221682;;gtc;2 ttc;71;;71;;;;;*
comp;1221754..1221825;;ggc;2 gtc;25;;25;;;;;*
comp;1221851..1221925;;ttc;;118;;*118;;;;;*
comp;1222044..1222117;;gtc;;358;358;;;;;;*
;1222476..1223792;;cds;;;;;;439;;methanogenesis marker 16 metalloprotein;*
;;;;;;;;;;;;*
;1400830..1401773;;cds;;914;*914;;;315;;helix-turn-helix domain-containing protein;*
;1402688..1402761;;gta;;287;287;;;;;;*
;1403049..1403276;;cds;;;;;;76;;hp;*
;;;;;;;;;;;;*
comp;1504221..1505630;;cds;;686;*686;;;470;;F0F1 ATP synthase subunit beta;*
comp;1506317..1506410;;cga;;750;*750;;;;;;*
;1507161..1508039;;cds;;;;;;293;;response regulator;*
;;;;;;;;;;;;*
;1513245..1513562;;cds;;213;213;;;106;;divalent-cation tolerance protein CutA;*
;1513776..1513858;;ttg;;268;268;;;;;;*
>;1514127..1514647;;cds;;;;;;174;;p-IS1634 family transposase;*
;;;;;;;;;;;;*
;1887880..1888338;;cds;;392;392;;;153;;pyridoxamine 5'-phosphate oxidase family protein;*
comp;1888731..1888802;;ggc;;378;378;;;;;;*
;1889181..1890518;;cds;;;;;;446;;DHH family phosphoesterase;*
;;;;;;;;;;;;*
;1962666..1963553;;cds;;130;130;;;296;;hp;*
comp;1963684..1963768;;tta;;235;235;;;;;;*
;1964004..1964759;;cds;;;;;;252;;MBL fold metallo-hydrolase;*
;;;;;;;;;;;;*
;1971331..1971852;;cds;;319;319;;;174;;hp;*
comp;1972172..1972244;;cag;;204;204;;;;;;*
comp;1972449..1972850;;cds;;;;;;134;;hp;*
;;;;;;;;;;;;*
comp;2170713..2172446;;cds;;156;156;;;*578;;radical SAM protein;*
comp;2172603..2172674;;cac;;174;174;;;;;;*
comp;2172849..2173631;;cds;;;;;;261;;thiazole biosynthesis protein;*
;;;;;;;;;;;;*
<comp;2320809..2321131;;cds;;141;141;;;108;;p-IS200/IS605 family transposase;*
comp;2321273..2321344;;gcg;;65;65;;;;;;*
comp;2321410..2321679;;cds;;;;;;90;;elongation factor 1-beta;*
;;;;;;;;;;;;*
;2387890..2388675;;cds;;150;150;;;262;;peptidylprolyl isomerase;*
;2388826..2388911;;tca;;326;326;;;;;;*
comp;2389238..2389453;;cds;;;;;;72;;hp;*
;;;;;;;;;;;;*
comp;2678132..2678368;;cds;;85;85;;;79;;DNA-directed RNA polymerase subunit H;*
comp;2678454..2678530;;aaa;;824;*824;;;;;;*
comp;2679355..2679537;;cds;;;;;;61;;hp;*
;;;;;;;;;;;;*
;3091524..3091754;;cds;;271;271;;;77;;hp;*
comp;3092026..3092147;;5s;;130;;;;122;;;*
comp;3092278..3095110;;23s;;208;;;;2833;;;*
comp;3095319..3096806;;16s;;839;*839;;;1488;;;*
;3097646..3097975;;cds;;;;;;110;;translation initiation factor eIF-1A;*
;;;;;;;;;;;;
comp;3153517..3155214;;cds;;599;*599;;;*566;;diguanylate phosphodiesterase;*
comp;3155814..3155923;;atgj;;799;*799;;;;;;*
;3156723..3157106;;cds;;;;;;128;;tRNA CCA-pyrophosphorylase;*
;;;;;;;;;;;;*
comp;3241682..3242944;;cds;;473;*473;;;421;;diaminopimelate decarboxylase;*
;3243418..3243489;;ggg;;377;377;;;;;;*
;3243867..3244073;;cds;;;;;;69;;hp;*
;;;;;;;;;;;;*
;3341829..3342017;;cds;@2;0;*0;;;63;;DNA-directed RNA polymerase subunit N;*
;3342018..3342092;;ccg;;112;112;;;;;;*
;3342205..3342387;;cds;;;;;;61;;DNA-directed RNA polymerase subunit K;*
;;;;;;;;;;;;*
;3358176..3359186;;cds;;533;*533;;;337;;class I SAM-dependent methyltransferase family protein;*
;3359720..3359791;;acg;;52;52;;;;;;*
comp;3359844..3360305;;cds;;;;;;154;;peroxiredoxin;*
;;;;;;;;;;;;*
comp;3397316..3398947;;cds;;422;*422;;;*544;;methylamine methyltransferase corrinoid protein reductive activase;*
;3399370..3399684;;ncRNA;@3;149;149;;;315;;;*
;3399834..3399918;;agc;;230;230;;;;;;*
;3400149..3400847;;cds;;;;;;233;;ATPase;*
;;;;;;;;;;;;*
;3435506..3436918;;cds;;181;181;;;471;;phosphotransferase;*
;3437100..3437183;;tcg;;273;273;;;;;;*
;3437457..3437948;;cds;;870;*870;;;164;;rubrerythrin family protein;*
;3438819..3438989;;cds;;107;107;;;57;;hp;*
;3439097..3439289;;tgg;;42;42;;;;;;*
comp;3439332..3439484;;cds;;;;;;51;;hp MLELDILDLDILDLDILDLKILELEILELEVLELEILELEILELEVLVQS;*
;;;;;;;;;;;;*
;3456114..3456473;;cds;;260;260;;;120;;hp;*
comp;3456734..3456805;;acc;;200;200;;;;;;*
comp;3457006..3457518;;cds;;;;;;171;;DUF98 domain-containing protein;*
;;;;;;;;;;;;*
comp;3583589..3584044;;cds;;295;295;;;152;;N-acetyltransferase;*
comp;3584340..3584414;;agg;;339;339;;;;;;*
;3584754..3585317;;cds;;;;;;188;;biotin transporter BioY;*
;;;;;;;;;;;;*
;3593430..3593861;;cds;;343;343;;;144;;PspC domain-containing protein;*
comp;3594205..3594279;;aga;;348;348;;;;;;*
;3594628..3595506;;cds;;;;;;293;;branched-chain-amino-acid transaminase;*
;;;;;;;;;;;;*
;3603458..3603697;;cds;;389;389;;;80;;type II toxin-antitoxin system HicB family antitoxin;*
;3604087..3604159;;caa;;633;*633;;;;;;*
comp;3604793..3606301;;cds;;;;;;*503;;lipopolysaccharide biosynthesis protein;*
;;;;;;;;;;;;*
comp;3856073..3856279;;cds;;402;*402;;;69;;TRAM domain-containing protein;*
;3856682..3856755;;aag;;498;*498;;;;;;*
;3857254..3857424;;cds;;;;;;57;;CopG family transcriptional regulator;*

mfe cumuls[modifier | modifier le wikicode]

mfe cumuls;;;;;;;;;;;;;
;opérons;;Fréquences intercalaires tRNAs;;;Fréquences intercalaires cds;;;;Fréquences aas cds;;;
;;effectif;gammes;sans rRNAs;avec rRNAs;gammes;cds;gammes;cdsd;gammes;cdsa;gammes;cdsa 330
avec rRNA;opérons;3;1;0;-;1;1;1;;100;18;30;0
;16 23 5s 0;2;20;0;;50;4;20;;200;29;60;4
;16 gca 235;1;40;2;;100;3;40;;300;12;90;14
;16 23 5s a;0;60;1;;150;11;60;;400;9;120;6
;max a;1;80;4;;200;9;80;;500;9;150;8
;a doubles;0;100;2;;250;10;100;;600;5;180;7
;autres;0;120;4;;300;7;120;;700;0;210;9
;total aas;1;140;0;;350;7;140;;800;0;240;1
sans ;opérons;40;160;0;;400;10;160;;900;1;270;6
;1 aa;31;180;0;;450;3;180;;1000;1;300;4
;max a;6;200;0;;500;3;200;;1100;0;330;3
;a doubles;7;;2;;;20;;;;1;;23
;total aas;55;;15;0;;88;;0;;85;;85
total aas;;56;;;;;;;;;;;
remarques;;;;;;;;;;;;;
avec jaune;;;moyenne;131;;;376;;;;255;;
;;;variance;169;;;299;;;;210;;
sans jaune;;;moyenne;55;;;223;;;;207;;157
;;;variance;21;;;108;;;;127;;80

mfe blocs[modifier | modifier le wikicode]

mfe blocs;;;;
cds;698;513;2-isopropylmalate synthase;*
16s;208;1488;;*
23s;130;2833;;*
5s;857;122;;*
cds;102;188;hp;*
;;;;
cds;967;261;methanol-5-hydroxybenzimidazolylcobamide methyltransferase;*
16s;80;1488;;*
gca;135;;;*
23s;130;2833;;*
5s;5;122;;*
cds;;83;hp;*
;;;;
cds;271;77;hp;*
5s;130;122;;*
23s;208;2833;;*
16s;839;1488;;*
cds;;110;translation initiation factor eIF-1A;*

mfe remarques[modifier | modifier le wikicode]

mfe;;;;;;56;56
atgi;1;tct;;tat;;atgf;2
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgt;
gtt;;gct;;gat;;ggt;
ttc;2;tcc;1;tac;1;tgc;2
atc;2;acc;1;aac;2;agc;1
ctc;2;ccc;1;cac;1;cgc;1
gtc;2;gcc;1;gac;1;ggc;3
tta;1;tca;1;taa;;tga;
ata;;aca;1;aaa;1;aga;1
cta;1;cca;1;caa;1;cga;1
gta;1;gca;1;gaa;2;gga;1
ttg;1;tcg;1;tag;;tgg;1
atgj;1;acg;1;aag;1;agg;1
ctg;1;ccg;1;cag;1;cgg;1
gtg;1;gcg;1;gag;1;ggg;1