Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Les autres bactéries

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Fiche mémoire sur Les autres bactéries
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Fiche : Les autres bactéries
Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Les autres bactéries
 », n'a pu être restituée correctement ci-dessus.


  • Fiche en préparation

Paris le 7.2.20

tenericutes[modifier | modifier le wikicode]

tener blocs[modifier | modifier le wikicode]

  • Lien tableur: tener blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
tener blocs
lien blocs 16s total aas avec sans total page tn001-108 Notes
tn001 tac-16s-atc-235-aac-5s-aac 4 46 19 27 16s23s5s 16-atc-35 16s23s, 5s avant
16s-atc-235-11aas sans 12 5 2 1-3
16s23s5s-aac 1-3 4 4 2*16s23s5s-aac
16s23s5s-aac-5s-aac 11aas 4 1 16s23s5s-aac-5s-aac
16s23s5s-aac-gaa
tn003 tac-16atcgca235-11aas 2 35 15 20 32 total 16 4 5 7
16s23s5s-aac avant
tac-16atcgca235-11aas
tn004 tac-16s-atc-235-gta-aac 2 32 16 16 tac-16s-atc-235-aac-5s-aac
16s-atc-235-11aas 2*tac-16s-atc-235-gta-aac
tac-16s-atc-235-aac
tn005 16s23s5s 1 28 0 28 6aas-16s23s5s
aaa-cta-16s23s5s
tn008 tac-16s-atc-235-aac 2 35 15 20
16s-atc-235-11aas 5s de trop
16s23s5s-aac-5s-aac
tn012 6aas-16s23s5s 2 29 6 23 tac-16s-atc-235-aac-5s-aac
16s23s5s 16s°aac-gaa-5s
5s
tn014 16s23s5s-aac-gaa 1 40 4 36
16s°aac-gaa-5s
tn018 16s23s, 5s 1 34 0 34
5s
tn026 16s23s5s 2 31 2 29
aaa-cta-16s23s5s
tn030 16s23s, 5s 1 29 0 29
tn038 16s23s5s 2 33 0 33
16s23s, 5s
tn050 16s23s5s 1 36 0 36
tn066 16s23s, 5s 1 31 0 31
tn075 16s23s, 5s 1 28 0 28
tn078 2*16s23s5s 2 31 0 31
tn086 16s23s5s 1 37 0 37
tn097 tac-16s-atc-235-gta-aac 2 32 16 16
16s-atc-235-11aas
tn098 16s23s5s 1 31 0 31
tn102 16s23s5s 1 34 0 34
tn108 2*16s23s5s 2 30 0 30
32
lien blocs 16s total aas avec sans total clade Total Notes
20 16s23s5s 16-atc-35 16s23s, 5s avant
sans 12 5 2 1-3
Moyenne 33 5 28 1-3 4 4 2*16s23s5s-aac
ecartype 4 7 6 11aas 4 1 16s23s5s-aac-5s-aac
max 46 19 37 16s23s5s-aac-gaa
min 28 0 16 32 total 16 4 5 7
avant
tac-16atcgca235-11aas
tac-16s-atc-235-aac-5s-aac
2*tac-16s-atc-235-gta-aac
blocs 32 tac-16s-atc-235-aac
génomes 20 6aas-16s23s5s
aas longs 6 / 6 aaa-cta-16s23s5s
1-3 aac 10
16s23s5s 23 5s de trop
16-atc-35 8 16s23s5s-aac-5s-aac
16-atcgca-35 1 tac-16s-atc-235-aac-5s-aac
16s°aac-gaa-5s
5s

tener notes[modifier | modifier le wikicode]

  • Lien tableur: tener notes
  • Légende: tn001 génome (voir noms), comp pour complement, intercal pour intercalaire en pbs, et long longueur en pbs.
DUF951		DUF951 domain-containing protein
cobalamin	ATP:cob(I)alamin adenosyltransferase
DegV		DegV family protein
cobyrinic	cob(I)yrinic acid a,c-diamide adenosyltransferase
N-acetyl	N-acetyltransferase
ABCu		ABC transporter permease subunit
P-ligase	proline--tRNA ligase
DUF2963		DUF2963 domain-containing protein
NADP		NAD(P)-dependent oxidoreductase
THF		methylenetetrahydrofolate dehydrogenase
ABCs		substrate ABC transporter permease
tener Notes
tn001 16s-atc-235-11aas tn003
tac-16s-atc-235-aac-5s-aac intercal long pbs protéine tac-16atcgca235-11aas intercal long pbs protéine
cds 86 174 DUF951 comp cds 154 852 NADP
tac 214 85 comp ttc 7 76
16s 137 1536 comp gac 4 76
atc 88 77 comp atgf 55 77
23s 34 2854 comp tca 22 91
5s 11 111 comp atgi 4 77
aac 149 77 comp atgj 45 77
5s 11 111 comp gca 5 76
aac 860 77 comp tta 20 85
cds 432 105 cobalamin comp aaa 6 76
16s 137 1536 comp aca 15 76
atc 88 77 comp gta 21 76
23s 34 2854 comp 5s 34 108
5s 14 111 comp 23s 50 2838
gta 44 76 comp gca 6 76
aca 11 76 comp atc 110 77
aaa 7 76 comp 16s 206 1523
tta 8 87 comp tac 114 84
gca 72 76 comp cds 171 DUF951
atgj 7 77 tn004
atgi 44 77 16s-atc-235-11aas intercal long pbs protéine
tca 8 91 cds 729 582 hp
atgf 4 77 16s 98 1539
gac 11 76 atc 54 77
ttc 137 76 23s 19 2891
cds 855 DegV 5s 25 109
2*16s23s5s intercal long pbs protéine gta 53 76
comp cds 96 312 N-acetyl aca 7 76
comp aac 11 77 aaa 61 76
comp 5s 34 111 tta 8 86
comp 23s 158 2854 gca 38 76
comp 16s 432 1535 atgj 1 77
comp cds 860 105 cobalamin atgi 6 77
comp aac 11 77 tca 17 91
comp 5s 149 111 atgf 5 77
comp aac 11 77 gac 2 76
comp 5s 34 111 ttc 324 76
comp 23s 159 2854 comp cds 735 ABCu
comp 16s 431 1536 tn012
comp cds 531 cobyrinic 6aas-16s23s5s intercal long pbs protéine
tn008 cds 148 861 THF
16s-atc-235-11aas intercal long pbs protéine aac 8 76
comp cds 1035 2811 hp gaa 9 76
comp ttc 0 76 gta 9 76
comp gac 7 76 aca 116 76
comp atgf 20 77 aaa 4 76
comp tca 7 91 cta 264 84
comp atgi 1 77 16s 207 1528
comp atgj 22 77 23s 249 2736
comp gca 6 76 5s 97 103
comp tta 17 86 cds 1593 ABCs
comp aaa 2 76 tn014 16s°aac-gaa-5s
comp aca 50 76 16s23s5s-aac-gaa intercal long pbs protéine
comp gta 21 76 comp cds 178 597 hp
comp 5s 26 106 comp gaa 8 77
comp 23s 55 2866 comp aac 67 77
comp atc 61 77 comp 5s 0 91
comp 16s 2069 1537 comp 16s° 745 381
comp cds 246 DUF2963 comp gaa 8 77
tn086 comp aac 67 77
16s23s5s intercal long pbs protéine comp 5s 33 108
cds 570 423 hp comp 23s 143 2861
comp ncRNA 199 833 comp 16s 478 1544
16s -445 1513 comp cds 1287 P-ligase
comp ncRNA 221 456
23s -262 2905
comp ncRNA 70 229
5s 183 108
cds 765 hp
tn097 cds–11 aas tn001 tn003 tn004 tn008 tn097
16s-atc-235-11aas intercal long pbs protéine intercal intercal intercal intercal intercal
cds 217 186 hp cds 137 154 324 1035 217
comp ttc 2 76 ttc 11 7 2 0 2
comp gac 5 76 gac 4 4 5 7 5
comp atgf 17 77 atgf 8 55 17 20 17
comp tca 7 91 tca 44 22 6 7 7
comp atgi 1 77 atgi 7 4 1 1 1
comp atgj 38 77 atgj 72 45 38 22 38
comp gca 4 76 gca 8 5 8 6 4
comp tta 66 86 tta 7 20 61 17 66
comp aaa 7 76 aaa 11 6 7 2 7
comp aca 52 76 aca 44 15 53 50 52
comp gta 25 76 gta 14 21 25 21 25
comp 5s 19 109 5s 34 34 19 26 19
comp 23s 54 2890 23s 88 50 54 55 54
comp atc 102 77 atc 137 - 98 61 102
comp 16s 734 1535 16s 432 - 729 2069 734
comp cds 582 hp cds

tener typage[modifier | modifier le wikicode]

tener type 16-y-235 après 16s[modifier | modifier le wikicode]

  • Type
type		tableau	avant 16s	total	%
16s23s5s	16	2		18	56
atc		4	4		8	25
atcgca		1	1		3
16s23s, 5s	5			5	16
total		25	7		32	

tener type 16235-z après 5s[modifier | modifier le wikicode]

  • Type: Les 5 blocs 11aas sont tous identiques, voir tener notes
    gta-aca-aaa-tta-gca-atgj-atgi-tca-atgf-gac-ttc
type		tableau	avant 16s	total	%
aac		2	1		3	23
aac-5s-aac	1	1		2	15
aac-gaa		1			1	8
gta-aac			2		2	15
11aas		4	1		5	38
total		8	5		13	
sans		12	7		19
  • tRNA
tRNA		total	%
aac		10	67
gaa		1	7
gta		2	13
5s		2	13
total		15	

tener type x-16235 avant 16s[modifier | modifier le wikicode]

  • Type; Voir tener notes pour le blocs 6aas. Il a une séquence de 3 aas qui se trouve dans les 11aas de 16s23s5s-z, gta-aca-aaa.
    aac-gaa-gta-aca-aaa-cta
type		tableau
tac		5
aaa-cta		1
6aas		1

tener noms[modifier | modifier le wikicode]

  • Lien tableur: tener noms
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 4.9.19 Paris.
  • Légende:
    - notes
    • - 31*2, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes tener
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           3579
génomes		ruptures	faits	total
 		58		20	111
F. Noms des tener
ruptures notes rRNAs faits code tRNAs génomes
1 644 1 tn001 §46 Acholeplasma brassicae O502
1 tn002 §36 Acholeplasma laidlawii PG-8A
1 222 1 tn003 §35 Acholeplasma palmae J233
1 222 1 tn004 §32 Aster yellows witches-broom phytoplasma AYWB
1 111 1 tn005 §28 Candidatus Hepatoplasma crinochetorum Av
1 tn006 §31 Candidatus Mycoplasma girerdii VCU M1
1 tn007 §33 Candidatus Mycoplasma haemolamae str. Purdue
1 222 1 tn008 §35 Candidatus Phytoplasma australiense
1 tn009 §32 Candidatus Phytoplasma mali AT
1 tn010 §8 Candidatus Phytoplasma solani 231/09
1 tn011 §27 Candidatus Phytoplasma solani 284/09
1 222 1 tn012 §29 Mesoplasma florum L1 ATCC 33453
tn013 29 Mesoplasma florum W37
1 211 1 tn014 §40 Mollicutes bacterium HR1
1 tn015 §34 Mycoplasma agalactiae 5632
tn016 34 Mycoplasma agalactiae PG2
1 tn017 §33 Mycoplasma arthritidis 158L3-1
1 211 1 tn018 §34 Mycoplasma bovis CQ-W70
tn019 34 Mycoplasma bovis HB0801
tn020 34 Mycoplasma bovis Hubei-1
tn021 34 Mycoplasma bovis PG45
1 tn022 §30 Mycoplasma bovoculi M165/69
1 tn023 §32 Mycoplasma californicum HAZ160 1
tn024 32 Mycoplasma californicum ST-6
1 tn025 §32 Mycoplasma canadense HAZ360 1
1 222 1 tn026 §31 Mycoplasma capricolum subsp. capricolum ATCC 27343
tn027 31 Mycoplasma capricolum subsp. capripneumoniae 87001
tn028 31 Mycoplasma capricolum subsp. capripneumoniae F38
tn029 31 Mycoplasma capricolum subsp. capripneumoniae ILRI181
1 111 1 tn030 §29 Mycoplasma conjunctivae HRC/581T
1 tn031 §34 Mycoplasma crocodyli MP145
1 tn032 §30 Mycoplasma cynos C142
1 tn033 §32 Mycoplasma dispar ATCC 27140
1 tn034 §36 Mycoplasma fermentans JER
tn035 36 Mycoplasma fermentans M64
tn036 36 Mycoplasma fermentans PG18
1 tn037 §30 Mycoplasma flocculare ATCC 27399 Ms42
1 222 1 tn038 §33 Mycoplasma gallisepticum CA06 2006.052-5-2P
tn039 33 Mycoplasma gallisepticum NC06 2006.080-5-2P
tn040 33 Mycoplasma gallisepticum NC08 2008.031-4-3P
tn041 33 Mycoplasma gallisepticum NC95 13295-2-2P
tn042 33 Mycoplasma gallisepticum NC96 1596-4-2P
tn043 33 Mycoplasma gallisepticum NY01 2001.047-5-1P
tn044 33 Mycoplasma gallisepticum S6
tn045 32 Mycoplasma gallisepticum str. F
tn046 32 Mycoplasma gallisepticum str. Rhigh
tn047 32 Mycoplasma gallisepticum str. Rlow
tn048 33 Mycoplasma gallisepticum VA94 7994-1-7P
tn049 33 Mycoplasma gallisepticum WI01 2001.043-13-2P
1 111 1 tn050 §36 Mycoplasma genitalium G37 G-37
tn051 36 Mycoplasma genitalium M2288
tn052 36 Mycoplasma genitalium M2321
tn053 36 Mycoplasma genitalium M6282
tn054 36 Mycoplasma genitalium M6320
1 tn055 §32 Mycoplasma haemocanis str. Illinois
1 tn056 §32 Mycoplasma haemofelis Ohio2
tn057 32 Mycoplasma haemofelis str. Langford 1
1 tn058 §33 Mycoplasma hominis AF1
tn059 33 Mycoplasma hominis ATCC 23114
tn060 33 Mycoplasma hominis ATCC 27545 LBD-4
1 tn061 §31 Mycoplasma hyopneumoniae 168
tn062 31 Mycoplasma hyopneumoniae 168-L
tn063 31 Mycoplasma hyopneumoniae 232
tn064 31 Mycoplasma hyopneumoniae 7422
tn065 31 Mycoplasma hyopneumoniae 7448
111 1 tn066 31 Mycoplasma hyopneumoniae J
1 tn067 §30 Mycoplasma hyorhinis DBS 1050
tn068 30 Mycoplasma hyorhinis GDL-1
tn069 30 Mycoplasma hyorhinis HUB-1
tn070 30 Mycoplasma hyorhinis MCLD
tn071 30 Mycoplasma hyorhinis SK76
1 tn072 §31 Mycoplasma leachii 99/014/6
tn073 31 Mycoplasma leachii PG50
1 tn074 §17 Mycoplasma meleagridis B2096 8B
1 111 1 tn075 §28 Mycoplasma mobile 163K
1 tn076 §31 Mycoplasma mycoides subsp. capri LC str. 95010
31*2 tn077 62 Mycoplasma mycoides subsp. capri str. GM12
222 1 tn078 31 Mycoplasma mycoides subsp. mycoides izsam mm5713
tn079 31 Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
tn080 31 Mycoplasma mycoides subsp. mycoides SC str. PG1
1 tn081 §31 Mycoplasma ovis str. Michigan
1 tn082 §32 Mycoplasma parvum str. Indiana
1 tn083 §30 Mycoplasma penetrans HF-2
1 tn084 §36 Mycoplasma pneumoniae 309
tn085 36 Mycoplasma pneumoniae FH
111 1 tn086 37 Mycoplasma pneumoniae M129 ATCC 29342
tn087 37 Mycoplasma pneumoniae M129-B7
tn088 37 Mycoplasma pneumoniae M29
1 tn089 §31 Mycoplasma putrefaciens KS1
tn090 31 Mycoplasma putrefaciens Mput9231
1 tn091 §32 Mycoplasma suis KI3806
tn092 32 Mycoplasma suis str. Illinois
1 tn093 §34 Mycoplasma synoviae 53
tn094 34 Mycoplasma synoviae ATCC 25204 WVU1853
1 tn095 §32 Mycoplasma wenyonii str. Massachusetts
1 tn096 §31 Mycoplasma yeatsii GM274B
1 222 1 tn097 §32 Onion yellows phytoplasma OY-M onion yellows
1 111 1 tn098 §31 Spiroplasma apis B31
1 tn099 §33 Spiroplasma chrysopicola DF-1
1 tn100 §30 Spiroplasma culicicola AES-1
1 tn101 §30 Spiroplasma diminutum CUAS-1
1 111 1 tn102 §34 Spiroplasma mirum ATCC 29335
tn103 34 Spiroplasma mirum ATCC 29335 SMCA
1 tn104 §30 Spiroplasma sabaudiense Ar-1343
1 tn105 §32 Spiroplasma syrphidicola EA-1
1 tn106 §30 Spiroplasma taiwanense CT-1
1 tn107 §22 Ureaplasma diversum ATCC 49782
1 222 1 tn108 §30 Ureaplasma parvum serovar 3 str. ATCC 27815
tn109 30 Ureaplasma parvum serovar 3 str. ATCC 700970
tn110 30 Ureaplasma parvum serovar 3 SV3F4
1 tn111 §30 Ureaplasma urealyticum serovar 10 str. ATCC 33699
58 20

Chlamydiae[modifier | modifier le wikicode]

chlam blocs[modifier | modifier le wikicode]

  • Lien tableur: chlam blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
chlam blocs
lien blocs 16s total aas avec sans total page chl001-124 Notes
chl001 2*16s23s5s 2 35 0 35 16s23s5s 6-gcaatc-35 avant
16s°-23s°-5s sans 10 2 5 avant
1-3 5*cac-16s235
chl002 cac-16s235 1 39 1 38 cac en direct et le reste en comp
chl003 2*16s23s5s 2 37 0 37 17 total 10 2 5 les intercalaires sont très variables
entre 422-822
chl009 cac-16s235 1 38 1 37
chl012 cac-16s235 1 38 1 37 autres incomplets
chl029 cac-16s235 1 37 1 36 16s°-23s°-5s
chl118 16s23s5s 1 38 0 38 5s de trop
chl120 cac-16s235 1 38 1 37 16s-gcaatc-235-5s
chl121 16s23s5s 1 38 0 38
chl122 2*16s23s5s 3 41 2 39
16s-gcaatc-235-5s
chl123 16s23s5s 1 35 0 35
chl124 16s23s5s 2 37 2 35
16s-gcaatc-235
17
lien blocs 16s total aas avec sans total page chl001-124 Notes
12 16s23s5s 6-gcaatc-35 avant
sans 10 2 5 avant
Moyenne 38 1 37 1-3 5*cac-16s235
ecartype 2 1 1 cac en direct et le reste en comp
max 41 2 39 17 total 10 2 5 les intercalaires sont très variables
min 35 0 35 entre 422-822
blocs 17 autres incomplets
génomes 12 16s°-23s°-5s
cds 0
devant 0 5s de trop
avant 5 16s-gcaatc-235-5s
16s23s5s 15

chlam notes[modifier | modifier le wikicode]

  • Lien tableur: chlam notes
  • avant 16s: Sur 17 blocs 16s seulement 5 ont cac en avant avec changement de sens comp/direct. Les intercalaires cac-16s sont très variables
chl012	comp	16s		1023009..1024561	813
		cac		1025375..1025448		

chl029	comp	16s		133365..133438		532
		cac		133971..135520		

chl002	comp	16s		721467..723020		679
		cac		723700..723775		

chl009	comp	16s		962658..964211		422
		cac		964634..964707		

chl120	comp	16s		1023977..1025529	822
		cac		1026352..1026425		
  • autres incomplets: taille des rRNAs modifiés, ribosomal RNA rRNA prediction is too short.
autre incomplet		 intercalaire		long pbs	protéines
chl001	
	comp	cds		77		294		hp
	comp	5s		130		115	
	comp	23s°		0		809	
	comp	16s°		619		927	
		cds				837		fasciclin domain-containing protein

chlam typage[modifier | modifier le wikicode]

type		tableau	avant 16s	total	%
16s23s5s	10	5		15	88
gcaatc		2			2	12
total		12	5		17	
  • Type 16235-z après 5s, un seul 5s.
  • Type x-16235 avant 16s, 5 cac, tous sur le brin opposé, 5 génomes, voir chlam notes

chlam noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - notes
    • - 37*3, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes chlam
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           4762
génomes		ruptures	faits	total
 		12		12	124
F. Noms des chlam
ruptures notes rRNAs faits code tRNAs génomes
1 322 1 chl001 35 Candidatus Protochlamydia amoebophila UWE25
1 111 1 chl002 39 Chlamydia avium 10DC88
1 222 1 chl003 37 Chlamydia muridarum MopnTet14
37*3 chl004 111 Chlamydia muridarum Nigg3
chl005 37 Chlamydia muridarum str. Nigg
chl006 37 Chlamydia muridarum str. Nigg 2 MCR
chl007 37 Chlamydia muridarum str. Nigg CM972
chl008 37 Chlamydia muridarum str. Nigg3 CMUT3-5
1 111 1 chl009 38 Chlamydia pecorum P787
chl010 38 Chlamydia pecorum PV3056/3
chl011 38 Chlamydia pecorum W73
1 111 1 chl012 38 Chlamydia psittaci 01DC11
chl013 38 Chlamydia psittaci 01DC12
chl014 38 Chlamydia psittaci 02DC15
chl015 38 Chlamydia psittaci 08DC60
2*38 chl016 76 Chlamydia psittaci 6BC
chl017 38 Chlamydia psittaci 84/55
chl018 38 Chlamydia psittaci C19/98
chl019 38 Chlamydia psittaci CP3
chl020 38 Chlamydia psittaci GR9
chl021 38 Chlamydia psittaci M56
chl022 38 Chlamydia psittaci Mat116
chl023 38 Chlamydia psittaci MN
chl024 38 Chlamydia psittaci NJ1
chl025 37 Chlamydia psittaci RD1
chl026 38 Chlamydia psittaci VS225
chl027 38 Chlamydia psittaci WC
chl028 38 Chlamydia psittaci WS/RT/E30
1 111 1 chl029 37 Chlamydia trachomatis 434/Bu
chl030 37 Chlamydia trachomatis 6276
chl031 37 Chlamydia trachomatis 6276s
chl032 37 Chlamydia trachomatis 70
chl033 37 Chlamydia trachomatis 70s
chl034 37 Chlamydia trachomatis A/363
chl035 37 Chlamydia trachomatis A/5291
chl036 37 Chlamydia trachomatis A/7249
chl037 37 Chlamydia trachomatis A/HAR-13
2*37 chl038 74 Chlamydia trachomatis A2497
chl039 37 Chlamydia trachomatis B/Jali20/OT
chl040 37 Chlamydia trachomatis B/TZ1A828/OT
chl041 37 Chlamydia trachomatis C/TW-3
chl042 37 Chlamydia trachomatis D-EC
chl043 37 Chlamydia trachomatis D-LC
chl044 37 Chlamydia trachomatis D/13-96
chl045 37 Chlamydia trachomatis D/14-96
chl046 37 Chlamydia trachomatis D/SotonD1
chl047 37 Chlamydia trachomatis D/SotonD5
chl048 37 Chlamydia trachomatis D/SotonD6
chl049 37 Chlamydia trachomatis D/UW-3/CX
chl050 37 Chlamydia trachomatis Ds2923
chl051 37 Chlamydia trachomatis E/11023
chl052 36 Chlamydia trachomatis E/12-94
chl053 37 Chlamydia trachomatis E/150
chl054 37 Chlamydia trachomatis E/Bour
chl055 37 Chlamydia trachomatis E/C599
chl056 37 Chlamydia trachomatis E/SotonE4
chl057 37 Chlamydia trachomatis E/SotonE8
chl058 37 Chlamydia trachomatis E/SW3
chl059 37 Chlamydia trachomatis F/1-93
chl060 37 Chlamydia trachomatis F/11-96
chl061 37 Chlamydia trachomatis F/2-93
chl062 37 Chlamydia trachomatis F/6-94
chl063 37 Chlamydia trachomatis F/SotonF3
chl064 37 Chlamydia trachomatis F/SW4
chl065 37 Chlamydia trachomatis F/SW5
chl066 37 Chlamydia trachomatis F/SWFPminus
chl067 37 Chlamydia trachomatis G/11074
chl068 37 Chlamydia trachomatis G/11222
chl069 37 Chlamydia trachomatis G/9301
chl070 37 Chlamydia trachomatis G/9768
chl071 37 Chlamydia trachomatis G/SotonG1
chl072 37 Chlamydia trachomatis Ia/SotonIa1
chl073 37 Chlamydia trachomatis Ia/SotonIa3
chl074 37 Chlamydia trachomatis Ia20-97
chl075 37 Chlamydia trachomatis IU824
chl076 37 Chlamydia trachomatis IU888
chl077 38 Chlamydia trachomatis J/27-97
chl078 37 Chlamydia trachomatis J/31-98
chl079 37 Chlamydia trachomatis J/6276tet1
chl080 37 Chlamydia trachomatis K/SotonK1
chl081 37 Chlamydia trachomatis L1/115
chl082 37 Chlamydia trachomatis L1/1322/p2
chl083 37 Chlamydia trachomatis L1/224
chl084 37 Chlamydia trachomatis L1/440/LN
chl085 37 Chlamydia trachomatis L2/25667R
chl086 37 Chlamydia trachomatis L2/434/Buf
chl087 37 Chlamydia trachomatis L2/434/Bui
chl088 37 Chlamydia trachomatis L2b/795
chl089 37 Chlamydia trachomatis L2b/8200/07
chl090 37 Chlamydia trachomatis L2b/Ams1
chl091 37 Chlamydia trachomatis L2b/Ams2
chl092 37 Chlamydia trachomatis L2b/Ams3
chl093 37 Chlamydia trachomatis L2b/Ams4
chl094 37 Chlamydia trachomatis L2b/Ams5
chl095 37 Chlamydia trachomatis L2b/Canada1
chl096 37 Chlamydia trachomatis L2b/Canada2
chl097 37 Chlamydia trachomatis L2b/CS19/08
chl098 37 Chlamydia trachomatis L2b/CS784/08
chl099 37 Chlamydia trachomatis L2b/CV204
chl100 37 Chlamydia trachomatis L2b/LST
chl101 37 Chlamydia trachomatis L2b/UCH-1/proctitis
chl102 37 Chlamydia trachomatis L2b/UCH-2
chl103 37 Chlamydia trachomatis L2c
chl104 37 Chlamydia trachomatis L2tet1
chl105 37 Chlamydia trachomatis L3/404/LN
chl106 37 Chlamydia trachomatis RC-F/69
chl107 37 Chlamydia trachomatis RC-Fs/342
chl108 37 Chlamydia trachomatis RC-Fs/852
chl109 37 Chlamydia trachomatis RC-J/943
chl110 37 Chlamydia trachomatis RC-J/953
chl111 37 Chlamydia trachomatis RC-J/966
chl112 37 Chlamydia trachomatis RC-J/971
chl113 37 Chlamydia trachomatis RC-Js/122
chl114 37 Chlamydia trachomatis RC-L2/55
chl115 37 Chlamydia trachomatis RC-L2s/3
chl116 37 Chlamydia trachomatis RC-L2s/46
chl117 37 Chlamydia trachomatis Sweden2
1 111 1 chl118 38 Chlamydophila abortus AB7
chl119 38 Chlamydophila abortus S26/3
1 111 1 chl120 38 Chlamydophila caviae GPIC
1 111 1 chl121 38 Chlamydophila felis Fe/C-56
1 433 1 chl122 41 Parachlamydia acanthamoebae UV-7
1 111 1 chl123 35 Simkania negevensis Z
1 222 1 chl124 37 Waddlia chondrophila WSU 86-1044
12 12

cyanobacteria[modifier | modifier le wikicode]

cyano blocs[modifier | modifier le wikicode]

  • Lien tableur: cyano blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
cyano blocs
lien blocs 16s total aas avec sans total page cya01-83 Notes
cya01 2*16atcgca235 2 77 4 73 16s23s5s 16-atcgca-35 16-atc-35
cya02 2*16atcgca235 4 68 4 64 sans 17 44 13 cds
2*16s23s5s cds 1 16atcgca-23s°-cds-23s°-5s
16atcgca-cds-235
cya05 16atcgca235 2 40 4 36 75 total 17 45 13
16atcgca23 incomplets
5s 3*16atcgca23
16atcgca-23s°-cds-23s°-5s
cya08 2*16atcgca235 3 80 4 76 16s-atcgca –
16s23s5s 23s°-16s°-atcgca
16atcgca-23s’
cya09 2*16-atc-235 2 39 2 37 16s
cya10 3*16atcgca235 3 57 6 51
cya11 3*16-atc-235 3 46 3 43 autres incomplets
cya12 4*16s23s5s 4 43 0 43 2*23s5s
cya13 3*16atcgca235 3 44 6 38 16s°-atcgca-23s° –
cya16 2*16atcgca235 2 46 4 42 16s23s5s-16s°-23s° –
cya17 2*16-atc-235 2 44 2 42 23s°-5s
cya23 2*16atcgca235 4 77 4 73 5s de trop
2*16s23s5s 2*5s
cya24 2*16atcgca235 3 42 4 38
16s23s5s
cya25 3*16atcgca235 3 50 6 44
cya26 16atcgca235 1 52 2 50
cya28 2*16-atc-235 2 41 2 39
cya29 3*16atcgca235 3 46 6 40
cya30 2*16atcgca235 2 48 4 44
cya31 2*16atcgca235 4 74 4 70
2*16s23s5s
cya32 2*16-atc-235 2 42 2 40
cya33 16s23s5s 5 48 8 40
2*23s5s
16atcgca-23s’
16s°-atcgca-23s° –
16s23s5s-16s°-23s° –
23s°-5s
16s-atcgca –
23s°-16s°-atcgca
16s
cya34 4*16atcgca235 4 90 8 82
cya38 2*16s23s5s 3 72 2 70
16atcgca235
cya40 2*16-atc-235 42 2 40
16s23s5s 3
cya41 16atcgca235 1 41 2 39
cya55 2*16atcgca235 2 47 4 43
cya56 3*16atcgca235 3 57 6 51
cya57 16atcgca235 2 45 4 41
16atcgca-23s°-cds-23s°-5s
cya58 2*16atcgca235 2 46 4 42
cya81 16atcgca-cds-235 1 42 2 40
cya83 2*16atcgca23s 2 38 4 34
5s 82
lien blocs 16s total aas avec sans total page cya01-83 Notes
31 16s23s5s 16-atcgca-35 16-atc-35
sans 17 44 13 cds
Moyenne 52 4 49 cds 1 16atcgca-23s°-cds-23s°-5s
Ecartype 14 2 14 16atcgca-cds-235
Max 90 8 82 75 total 17 45 13
Min 38 0 34 incomplets
3*16atcgca23
16atcgca-23s°-cds-23s°-5s
blocs 82 16s-atcgca –
génomes 31 23s°-16s°-atcgca
avant 0 16atcgca-23s’
après 0 16s
cds 2
atcgca 62% autres incomplets
atc 16% 2*23s5s
16s23s5s 21% 16s°-atcgca-23s° –
16s23s5s-16s°-23s° –
23s°-5s
5s de trop
2*5s

cyano notes[modifier | modifier le wikicode]

cyano Notes
intercalaire long pbs protéines
Notes du cya033
16s23s5s-16s°-23s°-23s°-5s
< cds 161 144 IS630 family transposase
comp 5s 121 118
comp 23s° 61 1836
comp 23s° 349 1103
comp 16s° 258 223
comp 5s 121 118
comp 23s 349 2834
comp 16s 60 1326
comp 23s° 123 1027
comp gca 83 73
comp atc 121 74
comp 16s° 66 975
comp cds 216 gas vesicle structural protein GvpA
16s
> cds 129 400 IS630 family transposase
comp gca 83 73
comp atc 121 74
comp 16s° 60 152
comp 23s° 314 1446
comp gca 83 73
comp atc 121 74
comp 16s 312 1491
dir cds 867 carboxylating nicotinate-nucleotide diphosphorylase
16s
> comp cds 205 1206 HNH endonuclease
comp 16s 270 1491
dir cds 204 hp
Notes du cya057
16atcgca-23s°-cds-23s°-5s
comp cds 93 1299 dihydroorotase
comp 5s 71 118
comp 23s° 24 1005
comp cds 92 1176 transposase
comp 23s° 174 1834
comp gca 83 76
comp atc 119 77
comp 16s 304 1498
comp cds :2 1518 4-alpha-glucanotransferase
Notes du cya057
16atcgca-cds-235
comp cds 228 243 hp
comp 5s 123 121
comp 23s 150 306
comp cds 67 528 site-specific DNA endonuclease
comp 23s suite 146 2565
comp gca 12 73
comp atc 115 74
comp 16s 294 1491
cds 297 hp

cyano typage[modifier | modifier le wikicode]

type		tableau	incomplets	total	%
16s23s5s	17			17	22
atcgca		44	3		47	60
atc		13			13	17
atcgca-cds	1			1	1
total		75	3		78	
  • Type 16235-z après 5s, néant
  • Type x-16235 avant 16s, néant

cyano noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes cyano
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           4062
génomes		ruptures	faits	total
 		72		31	83
F. Noms des cyano
ruptures notes rRNAs faits code tRNAs génome
1 222 1 cya01 77 Acaryochloris marina MBIC11017
1 444 1 cya02 68 Anabaena cylindrica PCC 7122
1 cya03 44 Anabaena sp. 90
1 cya04 49 Anabaena variabilis ATCC 29413
1 222 1 cya05 40 Arthrospira platensis NIES-39
1 cya06 42 Arthrospira sp. PCC 8005
1 cya07 44 Calothrix sp. PCC 6303
1 333 1 cya08 80 Calothrix sp. PCC 7507
1 222 1 cya09 39 Candidatus Atelocyanobacterium thalassa isolate ALOHA
1 333 1 cya10 57 Chamaesiphon minutus PCC 6605
1 333 1 cya11 46 Chroococcidiopsis thermalis PCC 7203
1 444 1 cya12 43 Crinalium epipsammum PCC 9333
1 333 1 cya13 44 Cyanobacterium aponinum PCC 10605
1 cya14 40 cyanobacterium endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko
1 cya15 43 Cyanobacterium stanieri PCC 7202
1 222 1 cya16 46 Cyanobium gracile PCC 6307
1 222 1 cya17 44 Cyanothece sp. ATCC 51142
1 cya18 47 Cyanothece sp. PCC 7424
1 cya19 49 Cyanothece sp. PCC 7425
1 cya20 52 Cyanothece sp. PCC 7822
1 cya21 47 Cyanothece sp. PCC 8801
1 cya22 46 Cyanothece sp. PCC 8802
1 444 1 cya23 77 Cylindrospermum stagnale PCC 7417
1 333 1 cya24 42 Dactylococcopsis salina PCC 8305
1 333 1 cya25 50 Geitlerinema sp. PCC 7407
1 111 1 cya26 52 Gloeobacter kilaueensis JS1
1 cya27 44 Gloeobacter violaceus PCC 7421
1 222 1 cya28 41 Gloeocapsa sp. PCC 7428
1 333 1 cya29 46 Halothece sp. PCC 7418
1 222 1 cya30 48 Leptolyngbya sp. PCC 7376
1 444 1 cya31 74 Microcoleus sp. PCC 7113
1 222 1 cya32 42 Microcystis aeruginosa NIES-843
1 454 1 cya33 48 Nodularia spumigena CCY9414
1 444 1 cya34 90 Nostoc punctiforme PCC 73102 ATCC 29133
1 cya35 82 Nostoc sp. PCC 7107
1 cya36 74 Nostoc sp. PCC 7120
1 cya37 70 Nostoc sp. PCC 7524
1 333 1 cya38 72 Oscillatoria acuminata PCC 6304
1 cya39 78 Oscillatoria nigro-viridis PCC 7112
1 333 1 cya40 42 Pleurocapsa sp. PCC 7327
1 111 1 cya41 41 Prochlorococcus marinus str. AS9601
cya42 40 Prochlorococcus marinus str. MIT 9211 MIT9211
cya43 41 Prochlorococcus marinus str. MIT 9215
cya44 38 Prochlorococcus marinus str. MIT 9301
cya45 46 Prochlorococcus marinus str. MIT 9303
cya46 45 Prochlorococcus marinus str. MIT 9312
cya47 48 Prochlorococcus marinus str. MIT 9313 MIT9313
cya48 38 Prochlorococcus marinus str. MIT 9515
cya49 39 Prochlorococcus marinus str. NATL1A
cya50 39 Prochlorococcus marinus str. NATL2A
cya51 40 Prochlorococcus marinus subsp. marinus str. CCMP1375 SS120
cya52 38 Prochlorococcus marinus subsp. pastoris str. CCMP1986 MED4
1 cya53 43 Prochlorococcus sp. MIT 0604
1 cya54 41 Prochlorococcus sp. MIT 0801
1 222 1 cya55 47 Pseudanabaena sp. PCC 7367
1 333 1 cya56 57 Rivularia sp. PCC 7116
1 221 1 cya57 45 Stanieria cyanosphaera PCC 7437
1 222 1 cya58 46 Synechococcus elongatus PCC 6301
1 cya59 46 Synechococcus elongatus PCC 7942
1 cya60 44 Synechococcus sp. CC9311
1 cya61 52 Synechococcus sp. CC9605
1 cya62 45 Synechococcus sp. CC9902
1 cya63 45 Synechococcus sp. JA-2-3Ba2-13
1 cya64 47 Synechococcus sp. JA-3-3Ab
1 cya65 43 Synechococcus sp. KORDI-100
1 cya66 45 Synechococcus sp. KORDI-49
1 cya67 48 Synechococcus sp. KORDI-52
1 cya68 42 Synechococcus sp. PCC 6312
1 cya69 45 Synechococcus sp. PCC 7002 ATCC 27264
1 cya70 43 Synechococcus sp. PCC 7502
1 cya71 42 Synechococcus sp. RCC307
1 cya72 45 Synechococcus sp. UTEX 2973
1 cya73 45 Synechococcus sp. WH 7803
1 cya74 44 Synechococcus sp. WH 8109
1 cya75 42 Synechocystis sp. PCC 6714
1 cya76 82 Synechocystis sp. PCC 6803
1 cya77 41 Synechocystis sp. PCC 6803 GT-S
1 cya78 41 Synechocystis sp. PCC 6803 substr. GT-I
1 cya79 41 Synechocystis sp. PCC 6803 substr. PCC-N
1 cya80 41 Synechocystis sp. PCC 6803 substr. PCC-P
1 111 1 cya81 42 Thermosynechococcus elongatus BP-1
1 cya82 42 Thermosynechococcus sp. NK55a
1 122 1 cya83 38 Trichodesmium erythraeum IMS101
72 31

Spirochaetes[modifier | modifier le wikicode]

spiro blocs[modifier | modifier le wikicode]

  • Lien tableur: spiro blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
spiro blocs
lien blocs 16s total aas avec sans total page spi01-70 Notes
spi01 16s-gca, cds,235 2 32 2 30 16-atcgca-35 16-gca-35 16-atc-35 16s, 235s
16s-atc, cds,235 sans 2 7 5 2 incomplets
cds 3 2 4*16s
spi07 16s-gca, cds,235 1 32 2 30
16s°-cds-atc, 235 21 total 2 10 7 2 autres incomplets
4*23s
spi14 16s-gca, cds,235 2 32 2 30 16s°-cds-atc, 235
16s-atc, cds,235
cds création
spi26 16s, 235s 1 34 0 34 3*(16s-gca, cds,235)
spi30 16s, 235s 1 34 0 34 2*(16s-atc, cds,235)
spi33 2*16s 2 35 0 35 16s°-cds-atc, 235
2*23s
2*5s 5s de trop
3*5s
spi37 2*16s 2 37 0 37
2*23s
5s
spi41 16-gca-235 2 44 2 42
16s-atc-235
spi42 2*16-gca-235 3 47 3 44
16s-atc-235
spi45 2*16-atc-235 3 47 3 44
16-gca-235
spi49 2*16-gca-235 2 47 2 45
spi53 16-gca-235 2 45 2 43
16s-atc-235
spi70 2*16atcgca235 2 41 4 37
25
lien blocs 16s total aas avec sans total page spi01-70 Notes
13 16-atcgca-35 16-gca-35 16-atc-35 16s, 235s
sans 2 7 5 2 incomplets
Moyenne 39 2 37 cds 3 2 4*16s
Ecartype 6 1 6
Max 47 4 45 21 total 2 10 7 2 autres incomplets
Min 32 0 30 4*23s
16s°-cds-atc, 235
blocs 25 cds création
génomes 13 3*(16s-gca, cds,235)
avant 0 2*(16s-atc, cds,235)
après 0 16s°-cds-atc, 235
cds 6 / 3
5s de trop
3*5s

spiro notes[modifier | modifier le wikicode]

spiro Notes
génome sens gène intercal long pbs protéines
spi01 16s-gca, 16s-atc, 235-235
comp cds 97 4482 transporter substrate-binding domain-containing protein
comp 5s 20 111
comp 23s 170 2935
comp 5s 20 111
comp 23s 198 2935
comp cds 135 843 Cof-type HAD-IIB family hydrolase
comp cds 640 558 DNA-3-methyladenine glycosylase
atc 377 74
comp 16s 193 1464
comp gca 173 74
comp 16s 209 1543
comp cds 549 nucleoside deoxyribosyltransferase
spi07 16s-gca, 16s°-atc, 235-235
comp cds 97 4485 response regulator
comp 5s 21 111
comp 23s 178 2935
comp 5s 21 111
comp 23s 200 2935
comp cds 135 840 Cof-type HAD-IIB family hydrolase
comp cds 374 561 DNA-3-methyladenine glycosylase
atc 66 74
comp cds 168 204 hp
comp 16s° 79 122
comp gca 168 74
comp 16s 204 1545
comp cds 549 nucleoside deoxyribosyltransferase
spi14 16s-gca, 16s-atc, 235-235
comp cds 98 4485 transporter substrate-binding domain-containing protein
comp 5s 21 111
comp 23s 177 2935
comp 5s 21 111
comp 23s 197 2935
comp cds 124 843 Cof-type HAD-IIB family hydrolase
comp cds 1030 561 DNA-3-methyladenine glycosylase
atc 383 74
comp 16s 147 1087
comp gca 166 74
comp 16s 208 1543
comp cds 549 nucleoside deoxyribosyltransferase

spiro typage[modifier | modifier le wikicode]

  • Lien tableur: spiro typage
  • Type 16-y-235 après 16s: Les 5 blocs à cds sont particuliers et appartiennent à 3 génomes. Voir spiro notes
type		tableau	%
16s23s5s	0	0
atcgca		2	10
atc		5	24
gca		7	33
atc, gca, cds	5	24
16s, 235s	2	10
total		21	
  • Type 16235-z après 5s, néant
  • Type x-16235 avant 16s, néant

spiro noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes spiro
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           2841
génomes		ruptures	faits	total
 		39		13	70
F. Noms des spiro
ruptures notes rRNAs faits code tRNAs génomes
1 222 1 spi01 32 Borrelia afzelii HLJ01
spi02 32 Borrelia afzelii K78
spi03 33 Borrelia afzelii PKo
spi04 32 Borrelia afzelii Tom3107
1 spi05 32 Borrelia bissettii DN127
1 32*2 spi06 64 Borrelia burgdorferi B31
212 1 spi07 32 Borrelia burgdorferi CA382
spi08 32 Borrelia burgdorferi JD1
spi09 32 Borrelia burgdorferi N40
spi10 32 Borrelia burgdorferi ZS7
1 spi11 31 Borrelia chilensis VA1
1 spi12 32 Borrelia crocidurae str. Achema
1 spi13 32 Borrelia duttonii Ly
1 222 1 spi14 32 Borrelia garinii BgVir
spi15 33 Borrelia garinii NMJW1
spi16 32 Borrelia garinii PBi
spi17 33 Borrelia garinii SZ
1 spi18 32 Borrelia hermsii CC1
1 spi19 32 Borrelia miyamotoi CT14D4
spi20 32 Borrelia miyamotoi LB-2001
1 spi21 32 Borrelia parkeri HR1
1 spi22 32 Borrelia recurrentis A1
1 spi23 32 Borrelia turicatae 91E135
1 spi24 32 Borrelia valaisiana Tom4006
spi25 33 Borrelia valaisiana VS116
1 111 1 spi26 34 Brachyspira hyodysenteriae WA1 ATCC 49526
1 spi27 34 Brachyspira intermedia PWS/A
1 spi28 35 Brachyspira murdochii DSM 12563
1 spi29 34 Brachyspira pilosicoli 95/1000
111 1 spi30 34 Brachyspira pilosicoli B2904
spi31 34 Brachyspira pilosicoli P43/6/78
spi32 34 Brachyspira pilosicoli WesB
1 222 1 spi33 35 Leptospira biflexa serovar Patoc strain Patoc 1 Ames
spi34 35 Leptospira biflexa serovar Patoc strain Patoc 1 Paris
1 spi35 37 Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
spi36 37 Leptospira borgpetersenii serovar Hardjo-bovis str. L550
1 122 1 spi37 37 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
spi38 37 Leptospira interrogans serovar Lai str. 56601
spi39 37 Leptospira interrogans serovar Lai str. IPAV
spi40 37 Leptospira interrogans serovar Linhai str. 56609
1 222 1 spi41 44 Salinispira pacifica L21-RPul-D2
1 333 1 spi42 47 Sphaerochaeta coccoides DSM 17374
1 spi43 48 Sphaerochaeta globosa str. Buddy
1 spi44 49 Sphaerochaeta pleomorpha str. Grapes
1 333 1 spi45 47 Spirochaeta africana DSM 8902
1 spi46 50 Spirochaeta smaragdinae DSM 11293
1 spi47 46 Spirochaeta thermophila DSM 6192
spi48 46 Spirochaeta thermophila DSM 6578
1 222 1 spi49 47 Treponema azotonutricium ZAS-9
1 spi50 47 Treponema brennaborense DSM 12168
1 spi51 48 Treponema caldaria DSM 7334
1 spi52 44 Treponema denticola ATCC 35405
1 222 1 spi53 45 Treponema pallidum str. Fribourg-Blanc
spi54 45 Treponema pallidum subsp. endemicum str. Bosnia A
spi55 45 Treponema pallidum subsp. pallidum DAL-1
spi56 90 Treponema pallidum subsp. pallidum SS14
spi57 45 Treponema pallidum subsp. pallidum str. Chicago
spi58 45 Treponema pallidum subsp. pallidum str. Mexico A
spi59 90 Treponema pallidum subsp. pallidum str. Nichols
spi60 45 Treponema pallidum subsp. pallidum str. Sea 81-4
spi61 45 Treponema pallidum subsp. pertenue str. CDC2
spi62 45 Treponema pallidum subsp. pertenue str. Gauthier
spi63 45 Treponema pallidum subsp. pertenue str. SamoaD
1 spi64 45 Treponema paraluiscuniculi Cuniculi A
1 spi65 45 Treponema pedis str. T A4
1 spi66 53 Treponema primitia ZAS-2
1 spi67 45 Treponema putidum OMZ 758
1 spi68 49 Treponema sp. OMZ 838
1 spi69 49 Treponema succinifaciens DSM 2489
1 222 1 spi70 41 Turneriella parva DSM 21527
39 13

Chloroflexi[modifier | modifier le wikicode]

chlor blocs[modifier | modifier le wikicode]

  • Lien tableur: chlor blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
chlor blocs
lien blocs 16s total aas avec sans total page clo01-22 Notes
clo01 16s23s5s 2 54 2 52 16s23s5s 16-atcgca-35 16-atc-35 16s, 235s 16-atc,35
16atcgca235 sans 2 1 2 2 2
atgf 4 2
clo02 2*16-atc-235 2 48 2 46
clo03 16s23s5s 3 49 15 total 6 3 2 2 2
2*(16s,235s)
clo06 16s-atc, 235 1 49 1 48
clo17 16s-atc, 235 1 48 1 47
clo19 2*16235-atgf 2 48 2 46
clo21 16235-atgf 2 50 2 48
16atcgca235-atgf
clo22 16235-atgf 2 49 2 47
16atcgca235-atgf
15
lien blocs 16s total aas avec sans total page total Notes
8 16s23s5s 16-atcgca-35 16-atc-35 16s, 235s 16-atc,35
sans 2 1 2 2 2
Moyenne 49 2 48 atgf 4 2
Ecartype 2 0 2
Max 54 2 52 15 total 6 3 2 2 2
Min 48 1 46
blocs 15
génomes 8
avant 0
après atgf 6 / 3
cds 0
16s23s5s 8
16-aas-235 7

chlor notes[modifier | modifier le wikicode]

chlor typage[modifier | modifier le wikicode]

type		tableau	incomplets	total	%
16s23s5s	6	2		8	53
atcgca		3			3	20
atc		2	2		4	27
total		13	2		15	
  • Type 16235-z après 5s, 6 blocs avec atgf en 3 génomes.
  • Type x-16235 avant 16s, néant

chlor noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes chlor
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           1076
génomes		ruptures	faits	total
 		12		8	22
F. Noms des chlor
ruptures notes rRNAs faits code tRNAs génomes
1 222 1 clo01 54 Anaerolinea thermophila UNI-1
1 222 1 clo02 48 Caldilinea aerophila DSM 14535 NBRC 104270
1 333 1 clo03 49 Chloroflexus aggregans DSM 9485
1 clo04 50 Chloroflexus aurantiacus J-10-fl
1 clo05 50 Chloroflexus sp. Y-400-fl
1 111 1 clo06 49 Dehalococcoides mccartyi 195
clo07 48 Dehalococcoides mccartyi BAV1
clo08 49 Dehalococcoides mccartyi BTF08
clo09 47 Dehalococcoides mccartyi CBDB1
clo10 51 Dehalococcoides mccartyi CG1
clo11 47 Dehalococcoides mccartyi CG4
clo12 47 Dehalococcoides mccartyi CG5
clo13 47 Dehalococcoides mccartyi DCMB5
clo14 48 Dehalococcoides mccartyi GT
clo15 47 Dehalococcoides mccartyi GY50
clo16 47 Dehalococcoides mccartyi VS
1 111 1 clo17 47 Dehalogenimonas lykanthroporepellens BL-DC-9
1 clo18 55 Herpetosiphon aurantiacus DSM 785
1 222 1 clo19 48 Roseiflexus castenholzii DSM 13941
1 clo20 49 Roseiflexus sp. RS-1
1 222 1 clo21 50 Sphaerobacter thermophilus DSM 20745
1 222 1 clo22 49 Thermomicrobium roseum DSM 5159
12 8

Deinococcus-Thermus[modifier | modifier le wikicode]

deino blocs[modifier | modifier le wikicode]

  • Lien tableur: deino blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
deino blocs
lien blocs 16s total aas avec sans total page det01-20 Notes
det01 16s23s5s 4 50 3 47 16s23s5s 16s, 235s
3*16s, 23s5s-ggc sans 2 2 incomplets
ggc 11 2*16s
det09 16s, 23s5s-ggc 3 51 1 50
2*16s 15 total 2 13 autres incomplets
235s 235s
det10 2*16s, 23s5s-ggc 2 50 2 48
det12 2*16s, 23s5s 2 48 0 48
det13 2*16s, 23s5s-ggc 2 56 2 54
det16 2*16s, 23s5s-ggc 2 49 2 47
det20 16s23s5s 2 46 1 45
16s,23s5s-ggc
17
lien blocs 16s total aas avec sans total page det01-20 Notes
7 16s23s5s 16s, 235s
sans 2 2 incomplets
Moyenne 50 2 48 ggc 11 2*16s
Ecartype 3 1 3
Max 56 3 54 15 total 2 13 autres incomplets
Min 46 0 45 235s
blocs 17
génomes 7
avant 0
après ggc 11 / 6
cds 0
16s23s5s 15
16-aas-235 0

deino notes[modifier | modifier le wikicode]

deino typage[modifier | modifier le wikicode]

type		tableau	%
16s23s5s	2	13
16s,23s5s	13	87
total		15	
  • Type 16235-z après 5s, 11 blocs avec ggc en 6 génomes.
  • Type x-16235 avant 16s, néant

deino noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes deino
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           1001
génomes		ruptures	faits	total
 		17		7	20
F. Noms des deino
ruptures notes rRNAs faits code tRNAs génomes
1 444 1 det01 50 Deinococcus deserti VCD115
1 det02 49 Deinococcus geothermalis DSM 11300
1 det03 49 Deinococcus gobiensis I-0
1 det04 58 Deinococcus maricopensis DSM 21211
1 det05 52 Deinococcus peraridilitoris DSM 19664
1 det06 47 Deinococcus proteolyticus MRP
1 det07 51 Deinococcus radiodurans R1
1 det08 47 Deinococcus swuensis DY59
1 232 1 det09 51 Marinithermus hydrothermalis DSM 14884
1 222 1 det10 50 Meiothermus ruber DSM 1279
1 det11 52 Meiothermus silvanus DSM 9946
1 222 1 det12 48 Oceanithermus profundus DSM 14977
1 222 1 det13 56 Thermus oshimai JL-2
1 det14 50 Thermus scotoductus SA-01
1 det15 48 Thermus sp. CCB US3 UF1
1 222 1 det16 49 Thermus thermophilus HB27
det17 49 Thermus thermophilus HB8
det18 50 Thermus thermophilus JL-18
det19 49 Thermus thermophilus SG0.5JP17-16
1 222 1 det20 46 Truepera radiovictrix DSM 17093
17 7

Thermotogae[modifier | modifier le wikicode]

toga blocs[modifier | modifier le wikicode]

  • Lien tableur: toga blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
toga blocs
lien blocs 16s total aas avec sans total page ter01-16 Notes
ter01 3*16s23s5s 3 48 0 48 16s23s5s 16atcgca235 16-gca-235 16-atc-235
ter02 2*16atcgca235 2 51 4 47 sans 7 8 3 2
20
ter04 16s23s5s 2 47 2 45
16atcgca235
ter05 2*16-gca-235 3 52 3 49
16-atc-235
ter06 16s23s5s 2 46 2 44
16atcgca235
ter07 16-gca-235 2 49 2 47
16-atc-235
ter08 16atcgca235 1 47 2 45
ter12 2*16s23s5s 3 49 2 47
16atcgca235
ter14 16atcgca235 1 47 2 45
ter16 16atcgca235 1 47 2 45
20
lien blocs 16s total aas avec sans total page ter01-16 Notes
10 16s23s5s 16atcgca235 16-gca-235 16-atc-235
sans 7 8 3 2
Moyenne 48 2 46 20
Ecartype 2 1 2
Max 52 4 49
Min 46 0 44
blocs 20
génomes 10
avant 0
après 0
cds 0
16s23s5s 7
16-aas-235 13

toga notes[modifier | modifier le wikicode]

toga typage[modifier | modifier le wikicode]

type		tableau	%
16s23s5s	7	35
atcgca		8	40
atc		2	10
gca		3	15
total		20	
  • Type 16235-z après 5s, néant
  • Type x-16235 avant 16s, néant

toga noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes toga
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           1337
génomes		ruptures	faits	total
 		23		10	25
F. Noms des toga
ruptures notes rRNAs faits code tRNAs génomes
1 333 1 ter01 §48 Defluviitoga tunisiensis
1 222 1 ter02 §51 Fervidobacterium nodosum Rt17-B1
1 ter03 §49 Fervidobacterium pennivorans DSM 9078
1 222 1 ter04 §47 Kosmotoga olearia TBF 19.5.1
1 333 1 ter05 §52 Marinitoga piezophila KA3
1 222 1 ter06 §46 Mesotoga prima MesG1.Ag.4.2
1 222 1 ter07 §49 Petrotoga mobilis SJ95
1 111 1 ter08 §47 Pseudothermotoga elfii DSM 9442 NBRC 107921
1 ter09 §47 Pseudothermotoga hypogea DSM 11164 NBRC 106472
1 ter10 §47 Pseudothermotoga lettingae TMO
1 ter11 §47 Pseudothermotoga thermarum DSM 5069
1 333 1 ter12 §49 Thermosipho africanus TCF52B
1 ter13 §51 Thermosipho melanesiensis BI429
1 111 1 ter14 §47 Thermotoga caldifontis AZM44c09
1 4*47 ter15 §188 Thermotoga maritima MSB8
111 1 ter16 47 Thermotoga maritima Tma100
ter17 47 Thermotoga maritima Tma200
1 ter18 §47 Thermotoga naphthophila RKU-10
1 ter19 §49 Thermotoga neapolitana DSM 4359
1 ter20 §47 Thermotoga petrophila RKU-1
1 ter21 §47 Thermotoga profunda AZM34c06
1 ter22 §47 Thermotoga sp. 2812B
1 ter23 §47 Thermotoga sp. Cell2
1 ter24 §47 Thermotoga sp. RQ2
1 ter25 §47 Thermotoga sp. RQ7
23 10

Autres[modifier | modifier le wikicode]

autre blocs[modifier | modifier le wikicode]

  • Lien tableur: autre blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
autre blocs
lien blocs 16s total aas avec sans total page ab001-35 Notes
Acidobacteria 16s23s5s 16atcgca235 avant
ab001 16atcgca235 1 48 2 46 sans 3 17 4 1-3
ab002 16atcgca235 1 50 2 48 1-3 1 1 16atcgca235-aga
ab004 16atcgca235 1 48 2 46 16s23s5s-atgi
ab005 16atcgca235 1 55 2 53 26 total 4 18 4
ab007 16atcgca235 2 55 5 50 avant
aag-16atcgca235 aag-16atcgca235
Aquificae ggc-16s23s5s
ab011 16atcgca235 2 45 5 40 cca-aga-atgf-16atcgca235
16atcgca235-aga ggc-16atcgca235
ab012 16atcgca235 2 44 3 41 incomplet
ggc-16s23s5s 16s
ab013 16atcgca235 1 90 2 88
ab014 2*16atcgca235 2 46 4 42
ab018 16atcgca235 2 42 7 35
cca-aga-atgf-16atcgca235
ab019 2*16atcgca235 2 39 4 35
ab021 16atcgca235 1 45 2 43
ab023 16atcgca235 3 47 5 42
ggc-16atcgca235
16s23s5s
Armatimonadetes
ab027 16atcgca235 2 47 2 45
16s
Caldiserica
ab032 16s23s5s 1 47 0 47
Chrysiogenetes
ab035 16s23s5s 3 37 3 34
16s23s5s-atgi
16atcgca235 27
lien blocs 16s total aas avec sans total page ab041-82 Notes
Deferribacteres 16s23s5s 16atcgca235 avant
ab041 2*16atcgca235 2 41 4 37 sans 9 17 1 1-3
ab042 16atcgca235 2 44 5 39 1-3 3 5 2*16s23s5s-aac
16atcgca235-tgc 3*16atcgca235-aac
35 total 12 22 1 16atcgca235-tgc
ab043 2*16atcgca235 2 43 4 39 16s23s5s-aac-5s
Dictyoglomi 16atcgca235-aac-5s
ab047 16atcgca235 2 47 2 45
16s23s5s avant
Elusimicrobia cca-aga-aag-16s23s5s
ab051 16atcgca235 1 45 2 43
Fibrobacteres incomplet
ab055 3*16atcgca235 3 58 6 52 16s23s, 5s
Fusobacteria
ab058 3*16s23s5s 5 46 4 42 5s en trop
16s23s5s-aac 16s23s5s-aac-5s
16atcgca235-aac 16atcgca235-aac-5s
16s23s5s-5s
ab063 3*16s23s5s 8 79 10 69
16atcgca235
16s23s5s-aac
16s23s5s-aac-5s
16atcgca235-aac
16atcgca235-aac-5s
ab066 16s23s5s 3 36 3 33
16s23s5s-5s
16atcgca235-aac
Gemmatimonadetes
ab071 cca-aga-aag-16s23s5s 1 50 3 47
Ignavibacteriae
ab074 16atcgca235 1 45 2 43
Nitrospirae
ab079 2*16atcgca235 2 53 4 49
ab081 3*16atcgca235 3 55 6 49
ab082 16s23s, 5s 1 50 0 50
36
lien blocs 16s total aas avec sans total page ab085-129 Notes
Planctomycetes 16s23s5s 16atcgca235 16gcaatc235
ab085 3*16s23s5s 3 49 0 49 sans 17 5 8 cds
ab088 16s, 235s 2 48 2 46 cds 2 3 2*16-cds-gca-atc-gta-cds-235
16s, atcgca235 16-cds-gca-atc-235
35 total 17 7 11 2*16atcgca23-cds-5s
ab089 2*16s, atcgca235 2 70 4 66
ab090 8*16s23s5s 8 73 0 73 incomplet
Synergistetes 16s, 235s
ab093 2*16s23s5s 3 48 2 46 16s, atcgca235
16atcgca235 2*16s
ab094 2*16s23s5s 2 50 autres incomplets
ab096 2*16s23s5s 3 51 2 49 atcgca235
16atcgca235
Thermobaculum
ab100 2*16atcgca235 2 52 4 48
Thermodesulfobacteria
ab103 2*16atcgca23-cds-5s 2 51 4 47
ab104 16atcgca235 1 47 2 45 Notes total
Verrucomicrobia 1-3
ab108 3*16-gca-atc-235 3 53 6 47 2*16s23s5s-aac
ab110 16-cds-gca-atc-235 1 48 2 46 3*16atcgca235-aac
ab113 16-gca-atc-235 1 76 2 74 16atcgca235-tgc
ab115 4*16-gca-atc-235 4 71 8 63 16s23s5s-aac-5s
Candidatus Saccharibacteria 16atcgca235-aac-5s
ab128 16-cds-gca-atc-gta-cds-235 1 44 3 41 16atcgca235-aga
ab129 16-cds-gca-atc-gta-cds-235 1 48 3 45 16s23s5s-atgi
39
lien blocs 16s total aas avec sans total page total Notes
16s23s5s 16atcgca235 16gcaatc235 avant
sans 29 39 8 5 avant
Moyenne 51 3 48 1-3 4 6 0 0 cca-aga-aag-16s23s5s
Ecartype 11 2 11 cds 2 3 0 ggc-16s23s5s
Max 90 10 88 aag-16atcgca235
Min 36 0 33 96 total 33 47 11 5 ggc-16atcgca235
cca-aga-atgf-16atcgca235
incomplet
16s, 235s
16s, atcgca235
3*16s
16s23s, 5s
blocs 102
génomes 46 autres incomplets
avant 5 atcgca235
après 1-3 10
cds 5 / 4 cds
16s23s5s 33 2*16-cds-gca-atc-gta-cds-235
atcgca 47 16-cds-gca-atc-235
gcaatc 11 2*16atcgca23-cds-5s
5s en trop
16s23s5s-aac-5s
16atcgca235-aac-5s
16s23s5s-5s

autre notes[modifier | modifier le wikicode]

  • Lien tableur: autre notes
  • Légende:
  • Les aas en dehors des blocs 16s23s5s
    - 11 génomes sur 46 et 15 blocs sur 102 ont des aas.
    - 13 blocs n’ont qu’un seul aa en dehors du bloc.
avant	16s			après	5s
aag-16atcgca235			16atcgca235-aga	
ggc-16atcgca235			16s23s5s-atgi	
ggc-16s23s5s			16atcgca235-tgc	
cca-aga-atgf-16atcgca235	3*16atcgca235-aac	
cca-aga-aag-16s23s5s		2*16s23s5s-aac	
				16s23s5s-aac-5s	
				16atcgca235-aac-5s	

cca	2			aac-5s	2
aga	2			aac	5
ggc	2			aga	1
aag	2			atgi	1
atgf	1			tgc	1
  • Les cds dans ab103 110 128 129
    - ab103, comme écrit dans "autre blocs" j'avais 2 blocs avec chacun un cds le 20.8.19 (voir autre noms). A cette date je n'avais pas relevé les adresses par contre j'avais relevé les séquences en aas des cds et elles étaient identiques. Le 10.2.20 j'ai relevé les adresses et le 2ème bloc n'avait plus de cds. La séquence en aas du cds restant est la même que celle du 20.8.19.
    - séquence: MLDIPKKYQVKILDALRKLEKGKGDIKKLAPKRYRLRVGCYRILFKEEDDLLVVYKIVHRQGADRYYDNV
    - ab110, le relevé des adresses n' a été fait que le 10.2.20. Le 20.8.19 j'avais relevé la séquence en aas, elles sont identiques.
    - séquence: MPPIIYLYDYRFFTPFPKHAIVIHSSLPDKVFCCCFLYLPEIPIPGVRDIQQQNHLVKVKMDPLTFYWMLFSAVGFFFKRLWSPVQQN
    - ab128 129, j'avais relevé les adresses et les séquences le 20.8.19.
    - ab128 cds comp en 2019: MLYQFSFGALFFGILIMTAGGLVVIFHQKLADNLGGGISSYERFKFWGLITCGVGFAIMLSLHTIPLNWLLNSLFGGGL
    - ab129 cds comp en 2019: MTYEFSWTWFGIGFLILLAGAALTVWYRQIADNLGSGVSSYERYKLWGLIGCGIGLLTMLNLHTLILNMLIGGLFHR
autres Notes
intercalaire long pbs protéines
ab103
2*16atcgca23-cds-5s
cds 215 765 ABC transporter ATP-binding protein
comp 5s 172 117
comp cds 160 213 type II toxin-antitoxin system RelE/ParE family toxin
comp 23s 171 3030
comp gca 11 76
comp atc 193 79
comp 16s 410 1570
comp cds 1014 hp
cds 149 684 4Fe-4S dicluster domain-containing protein
comp 5s 127 117
comp 23s 171 3030
comp gca 11 76
comp atc 193 79
comp 16s 480 1570
cds 228 hp
ab110
16-cds-gca-atc-235
cds 258 228 hp
comp 5s 99 116
comp 23s 141 2850
comp atc 34 74
comp gca -8 76
comp cds 130 267 hp
16s 333 1534
comp cds 1749 glycosyltransferase family 39 protein
ab128
16-cds-gca-atc-gta-cds-235
cds 211 432 divergent PAP2 family protein
16s 285 1482
comp cds 63 240 hp
gca 51 77
atc 22 77
gta 61 77
cds 237 1176 dihydroorotate dehydrogenase (quinone)
23s 191 3110
5s 103 109
cds 714 DUF3152 domain-containing protein
ab129
16-cds-gca-atc-gta-cds-235
cds 191 435 divergent PAP2 family protein
16s 211 1506
comp cds 67 234 hp
gca 130 77
atc 31 77
gta 282 77
cds 398 582 hp
23s 174 3214
5s 420 110
cds 672 hp

autre typage[modifier | modifier le wikicode]

Les 3 types[modifier | modifier le wikicode]

  • Lien tableur: autre typage
  • Légende:
    - 8 **, type 16s23s5s-z du clade Fusobacteria:  5 x aac,  2 x aac-5s,  1 x 5s
    - cds *,
clade				type		blocs
CandidatusSaccharibacteria	16s-y-23s5s	2 x 16-cds-gca-atc-gta-cds-235
Verrucomicrobia			16s-y-23s5s	1 x 16-cds-gca-atc-235
Thermodesulfobacteria		16s23s5s-z	2 x 16atcgca23-cds-5s
AB1 Typage autres bactéries, 19 clades.
type 16s-y-23s5s 16s23s5s-z x-16s23s5s
clade 16s23s5s atcgca gcaatc cds *
Acidobacteria 6 aag
Aquificae 2 13 aga cca-aga-atgf, 2 x gcc
Armatimonadetes 1
Caldiserica 1
Chrysiogenetes 2 1 atgi
Deferribacteres 6 tgc
Dictyoglomi 1 1
Elusimicrobia 1
Fibrobacteres 3
Fusobacteria 11 5 8 **
Gemmatimonadetes 1 cca-aga-aag
Ignavibacteriae 1
Nitrospirae 1 5
Planctomycetes 12 3
Synergistetes 6 2
Thermobaculum 2
Thermodesulfobacteria 3 2 cds *
Verrucomicrobia 8 1
CandidatusSaccharibacteria 2
total 37 53 8 3
  • total11, type y.
génomes	clade			16s23s5s	atcgca	cds-gca-atc-gta-cds
1	Armatimonadetes				1	
1	Caldiserica			1		
1	Chrysiogenetes			2	1	
1	Dictyoglomi			1	1	
1	Elusimicrobia				1	
1	Fibrobacteres				3	
1	Gemmatimonadetes		1		
1	Ignavibacteriae				1	
1	Thermobaculum				2	
2	Thermodesulfobacteria			3	
2	CandidatusSaccharibacteria			2
13	total11				5	13	2

Pourcentages du type 16s-y-23s5s[modifier | modifier le wikicode]

16s-y-23s5s	16s23s5s	atcgca	gcaatc	cds	total
total		37		53	8	3	101
%		37		52	8	3	

autre noms[modifier | modifier le wikicode]

Prélèvement: fait vers le 20.8.19 et mise en forme le

  • Légende:
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes autre
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
  • Construction de la liste des noms
  • Statistiques
tRNAs           total           4081
génomes		ruptures	faits	total
 		78		46	83
F. Noms des autre
ruptures ordre rRNAs faits code tRNAs génomes
1 Acidobacteria
1 2 111 1 ab001 48 Acidobacterium capsulatum ATCC 51196
1 3 111 1 ab002 50 Candidatus Koribacter versatilis Ellin345
1 4 ab003 56 Candidatus Solibacter usitatus Ellin6076
1 5 111 1 ab004 48 Chloracidobacterium thermophilum B
1 6 111 1 ab005 55 Granulicella mallensis MP5ACTX8
1 7 ab006 48 Granulicella tundricola MP5ACTX9
1 8 222 1 ab007 55 Terriglobus roseus DSM 18391
1 9 ab008 49 Terriglobus saanensis SP1PR4
10
11 Aquificae
1 12 222 1 ab011 45 Aquifex aeolicus VF5
1 13 222 1 ab012 44 Desulfurobacterium thermolithotrophum DSM 11699
1 14 111 1 ab013 90 Hydrogenobacter thermophilus TK-6
1 15 222 1 ab014 46 Hydrogenobaculum sp. 3684
1 16 ab015 46 Hydrogenobaculum sp. HO
1 17 ab016 46 Hydrogenobaculum sp. SN
1 18 ab017 46 Hydrogenobaculum sp. Y04AAS1
1 19 222 1 ab018 42 Persephonella marina EX-H1
1 20 222 1 ab019 39 Sulfurihydrogenibium azorense Az-Fu1
1 21 ab020 41 Sulfurihydrogenibium sp. YO3AOP1
1 22 111 1 ab021 45 Thermocrinis albus DSM 14484
1 23 ab022 45 Thermocrinis ruber DSM 23557
1 24 333 1 ab023 47 Thermovibrio ammonificans HB-1
25
26 Armatimonadetes
1 27 121 1 ab027 47 Chthonomonas calidirosea T49
1 28 ab028 50 Fimbriimonas ginsengisoli Gsoil 348
29
30 Caldiserica
1 31 111 1 ab032 47 Caldisericum exile AZM16c01
32
33 Chrysiogenetes
1 34 333 1 ab035 37 Desulfurispirillum indicum S5
35
36 Cloacimonetes
1 37 ab038 47 Candidatus Cloacimonas acidaminovorans str. Evry
38
39 Deferribacteres
1 40 222 1 ab041 41 Calditerrivibrio nitroreducens DSM 19672
1 41 222 1 ab042 44 Deferribacter desulfuricans SSM1
1 42 222 1 ab043 43 Denitrovibrio acetiphilus DSM 12809
1 43 ab044 45 Flexistipes sinusarabici DSM 4947
44
45 Dictyoglomi
1 46 222 1 ab047 47 Dictyoglomus thermophilum H-6-12 ATCC 35947
1 47 ab048 48 Dictyoglomus turgidum DSM 6724
48
49 Elusimicrobia
1 50 111 1 ab051 45 Elusimicrobium minutum Pei191
1 51 ab052 45 uncultured Termite group 1 bacterium phylotype Rs-D17
52
53 Fibrobacteres
1 54 333 1 ab055 58 Fibrobacter succinogenes subsp. succinogenes S85
55
56 Fusobacteria
1 57 555 1 ab058 46 Fusobacterium nucleatum subsp. animalis 4 8
58 ab059 46 Fusobacterium nucleatum subsp. animalis 7 1
59 ab060 48 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
60 ab061 47 Fusobacterium nucleatum subsp. vincentii 3 1 27
61 ab062 48 Fusobacterium nucleatum subsp. vincentii 3 1 36A2
1 62 10,8,8 1 ab063 79 Ilyobacter polytropus DSM 2926
1 63 ab064 47 Leptotrichia buccalis C-1013-b DSM 1135
1 64 ab065 41 Sebaldella termitidis ATCC 33386
1 65 433 1 ab066 36 Sneathia sp. Sn35 SN35
1 66 ab067 39 Streptobacillus moniliformis DSM 12112
67
68 Gemmatimonadetes
1 69 ab070 50 Gemmatimonadetes bacterium KBS708
1 70 111 1 ab071 50 Gemmatimonas aurantiaca T-27
71
72 Ignavibacteriae
1 73 111 1 ab074 45 Ignavibacterium album JCM 16511
1 74 ab075 46 Melioribacter roseus P3M-2
75
76 Nitrospirae
1 77 ab078 49 Candidatus Nitrospira defluvii
1 78 222 1 ab079 53 Leptospirillum ferriphilum ML-04
79 ab080 52 Leptospirillum ferriphilum YSK
1 80 333 1 ab081 55 Leptospirillum ferrooxidans C2-3
1 81 111 1 ab082 50 Thermodesulfovibrio yellowstonii DSM 11347
82
83 Planctomycetes
1 84 333 1 ab085 49 Isosphaera pallida ATCC 43644
1 85 ab086 46 Phycisphaera mikurensis NBRC 102666
1 86 ab087 50 Pirellula staleyi DSM 6068
1 87 222 1 ab088 48 Planctomyces brasiliensis DSM 5305
1 88 121 1 ab089 70 Planctomyces limnophilus DSM 3776
1 89 888 1 ab090 73 Singulisphaera acidiphila DSM 18658
90
91 Synergistetes
1 92 333 1 ab093 48 Aminobacterium colombiense DSM 12261
1 93 222 1 ab094 50 Anaerobaculum mobile DSM 13181
1 94 ab095 42 Fretibacterium fastidiosum SGP1
1 95 333 1 ab096 51 Thermanaerovibrio acidaminovorans DSM 6589
1 96 ab097 49 Thermovirga lienii DSM 17291
97
98 Thermobaculum
1 99 222 1 ab100 52 Thermobaculum terrenum ATCC BAA-798
100
101 Thermodesulfobacteria
1 102 222 1 ab103 51 Thermodesulfatator indicus DSM 15286
1 103 111 1 ab104 47 Thermodesulfobacterium commune DSM 2178
1 104 ab105 47 Thermodesulfobacterium geofontis OPF15
105
106 Verrucomicrobia
1 107 333 1 ab108 53 Akkermansia muciniphila ATCC BAA-835
1 108 ab109 47 Coraliomargarita akajimensis DSM 45221
1 109 111 1 ab110 48 Methylacidiphilum fumariolicum SolV
1 110 ab111 46 Methylacidiphilum infernorum V4
1 111 ab112 49 Opitutaceae bacterium TAV5
1 112 111 1 ab113 76 Opitutus terrae PB90-1
1 113 ab114 49 Verrucomicrobia bacterium IMCC26134
1 114 444 1 ab115 71 Verrucomicrobium spinosum DSM 4136 JCM 18804
115
116 candidate divisionNC10
1 117 ab118 48 Candidatus Methylomirabilis oxyfera
118
119 candidate divisionSR1
1 120 ab121 37 candidate division SR1 bacterium RAAC1_SR1_1
121
122 candidate divisionWWE3
1 123 ab124 46 candidate division WWE3 bacterium RAAC2_WWE3_1
124
125 Candidatus Saccharibacteria
1 126 ab127 44 Candidatus Saccharibacteria bacterium RAAC3_TM7_1
1 127 111 1 ab128 44 Candidatus Saccharibacteria oral taxon TM7x
1 128 111 1 ab129 48 Candidatus Saccharimonas aalborgensis
78 46