Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Firmicutes

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Fiche mémoire sur Firmicutes
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Fiche : Firmicutes
Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Firmicutes
 », n'a pu être restituée correctement ci-dessus.


  • Fiche en préparation

Tanger le 02.11.19

Bacilli[modifier | modifier le wikicode]

Bacilli blocs[modifier | modifier le wikicode]

  • Lien tableur: bacilli blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
Bacilli blocs
lien blocs 16s total aas avec sans total page Bc001-25 Notes
16s23s5s atcgca autres avant
bc001 16s23s5s 4 60 40 20 sans 19 4 avant
16atcgca235-aac-acc 1-3 3 2 3 3*cgt gga 16s23s5s atgf gac
16atcgca235-22aas 4-8 3
16s23s5s-12aas 9-23 13 2 1-3
24-43 2*16atcgca235-aac-acc
bc002 16s23s5s-tca 6 65 1 64 49 total 38 8 0 3 2*16s23s5s-atgf-gac
5*16s23s5s 16s23s5s-tca
bc004 2*16s23s5s 6 56 28 28 autres incomplets
16atcgca235-aac-acc 16s°atcgca235
16s23s5s-atgf-gac 16s°23s5s-16 aas
2*16s23s5s-13,9 aas 16s°atcgca235
bc008 2*16atcgca235 10 95 68 27
2*16s23s5s
5*16s23s5s-21,16,9,9,5 aas
cgt gga 16s23s5s atgf gac
bc014 4*16s23s5s 8 89 59 30
cgt-gga-16s23s5s-atgf-gac
2*16s23s5s-9,7 aas
16atcgca235-21 aas
16s°atcgca235
16s°23s5s-16 aas
bc015 3*16s23s5s 9 89 52 37
16atcgca235
4*16s23s5s-21,16,9,7 aas
16s23s5s-atgf-gac
16s°atcgca235
bc025 2*16s23s5s 6 70 41 29
16atcgca235
cgt-gga-16s23s5s-atgf-gac
2*16s23s5s-21,16 aas 49
lien blocs 16s total aas avec sans total page Bc029-74 Notes
bc029 4*16s23s5s 11 112 98 14 16s23s5s atcgca autres avant
2*16atcgca235 sans 33 6 1 avant
4*16s23s5s-20,19,11,9 aas 1-3 5 3 3*33,12,11aas-16s23s5s-atgf-gac
33aas-16s23s5s-atgf-gac 4-8 1 13aas-16s23s5s
9-23 22 2
bc034 5*16s23s5s 10 94 81 13 24-43 1-3
16atcgca235-15aas 73 total 61 8 0 4 3*16s23s5s-atgf-gac
3*16s23s5s-22,20,9aas 2*16s23s5s-aac-acc
11aas-16s23s5s-atgf-gac
bc063 16s23s5s 7 75 45 30
2*16atcgca235
16s23s5s-aac-acc
16s23s5s-atgf-gac
2*16s23s5s-21,16 aas
bc065 3*16s23s5s 8 80 50 30
16s23s5s-atgf-gac
16s23s5s-aac-acc
3*16s23s5s-21,16,9 aas
bc066 8*16s23s5s 13 95 68 27
4*16s23s5s-22,19,15,8 aas
12aas-16s23s5s-atgf-gac
bc067 7*16s23s5s 10 83 43 40
16atcgca235-9aas
2*16s23s5s-16,16aas
bc074 5*16s23s5s 14 118 94 24
16s23s5s-atgf-gac
2*16atcgca235
5*16s23s5s-22,20,15,9,9 aas
13aas-16s23s5s 73
lien blocs 16s total aas avec sans total page Bc090-244 Notes
bc090 7*16s23s5s 13 95 83 12 16s23s5s atcgca autres avant
16atcgca235 sans 35 13 avant
4*16s23s5s-22,20,15,9 aas 1-3 1 6 5*(3*12),11,10aas-16s23s5s-atgf-gac
11aas-16s23s5s-atgf-gac 4-8 3 1 cgt-gga-16s23s5s-atgf-gac
9-23 26
bc097 5*16s23s5s 13 107 93 14 24-43 1-3
2*16atcgca235 85 total 65 14 0 6 16s23s5s-gaa
12aas-16s23s5s-atgf-gac
5*16s23s5s-22,20,15,9,9aas
bc125 16s23s5s 12 123 107 16
2*16atcgca235
suite3-16s23s5s
10aas-16s23s5s-atgf-gac
7*16s23s5s-21,16,14,12,10,9,9
bc147 3*16s23s5s encadrés 9 86 60 26
2*16atcgca235
cgt-gga-16s23s5s-atgf-gac
3*16s23s5s-21, 16, 9, 6aas
bc158 5*16s23s5s 14 142 93 49
2*16atcgca235
suite2-16s23s5s
5*16s23s5s-22,20,15,9,9aas
12aas-16s23s5s-atgf-gac
bc165 10*16s23s5s 15 78 59 19
16s23s5s-gaa
3*16s23s5s-20,15,9
12aas-16s23s5s-atgf-gac
bc244 4*16atcgca235 9 98 26 72
16atcgca235-5aas
2*16s23s5s dont un encadré ici
2*16s23s5s-6, 5aas 85
lien blocs 16s total aas avec sans total page Bc328-656 Notes
bc328 2*16s23s5s dont un encadré ici 67 50 17 16s23s5s atcgca autres avant
2*16s23s5s-21,9 6 sans 18 2 1 2 avant
16atcgca235-14aas 1-3 1 1 4 1 5s-8aas-16s-atc-235
16atcgca235-aac-acc 4-8 1 1 2 ctc-gga-16s23s5s
9-23 15 2 6 11aas-16s23s5s-atgf-gac
bc384 5*16s23s5s 14 175 138 37 24-43 1
9*16s23s5s-23 22 19 17 58 total 35 7 13 3 1-3
16 12 11 9 9 aas 16atcgca235-aac-acc
16s23s5s-aac-acc
bc393 7*16s23s5s 13 165 73 92 2*16-gca-235-aac
16s-gca-235 2*16-gca-235-aac-cgt
16s-5s-atcgca-23s-8aas
16s-5s-atcgca-23s-5s-11aas autres
3*16s23s5s-11, 17, 21 aas 16s-gca-235
16s-5s-atcgca-23s-8aas
bc413 16atcgca235 5 63 47 16 16s-5s-atcgca-23s-5s-11aas
16atcgca-235-26aas
16s23s5s-6aas 2*16-gca-235-aac
5s-8aas-16s-atc-235 5*16-gca-235-17,15,12,9,4 aas
ctc-gga-16s23s5s 2*16-gca-235-aac-cgt
23s°5s 3*16s-gca-235-17, 12, 7 aas
bc499 2*16-gca-235-aac 7 80 66 14 5s en trop
5*16-gca-235-17,15,12,9,4 aas 16s-5s-atcgca-23s-5s-11aas
23s°5s
bc655 2*16-gca-235-aac-cgt 5 59 45 14 5s-8aas-16s-atc-235
3*16s-gca-235-17, 12, 7 aas
bc656 4*16s23s5s 8 56 30 26
16s23s5s-aac-acc
16atcgca235
11aas-16s23s5s-atgf-gac
16s23s5s-13aas 58
lien blocs 16s total aas avec sans total page Bc657-660 Notes
bc657 16s23s5s 5 62 36 26 16s23s5s atcgca autres avant
16s23s5s-aac sans 7 1 avant
2*16s-gca-235-25, 8aas 1-3 2 1 2 12aas-16s23s5s-atgf-gac
16s23s5s-12aas 4-8 1 2 1 gga-16atcgca235-gta
9-23 3 2
bc658 16s-5s-23s 5 61 58 3 24-43 1 1-3
16s-5s-23s-atgf-ctc-ctg 23 total 13 6 2 2 16s23s5s-aac
2*16s-5s-atcgca-23s-9,5aas 16s-5s-23s-atgf-ctc-ctg
16s-5s-23s-14aas 16atcgca235-aac-acc
bc659 4*16s23s5s 7 54 32 22 autres
16atcgca235-aac-acc 16s-5s-23s-14aas
12aas-16s23s5s-atgf-gac 2*16s-5s-atcgca-23s-9,5aas
16s23s5s-14aas 2*16s-gca-235-25, 8aas
bc660 16atcgca235 6 75 38 37 5s en trop
16s23s5s 16atcgca235-4aas-5s-aac
16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca
2*16atcgca235-17aas, 4aas-5s-aac
gga-16atcgca235-gta
23
lien blocs 16s total aas avec sans total pages Total
16s23s5s atcgca autres avant
sans 112 26 1 3
1-3 12 4 4 15
Moyenne 88 59 29 4-8 9 4 3 0
ecartype 30 28 19 9-23 79 8 6 0
max 175 138 92 24-43 0 1 1 0
min 54 1 3 288 total 212 43 15 18

Bacilli notes[modifier | modifier le wikicode]

Bacilli blocs, Notes
avant 1-3
33,5*12,3*11,10aas-16s23s5s-atgf-gac 4*16atcgca235-aac-acc
4*cgt-gga-16s23s5s-atgf-gac 2*16-gca-235-aac
13aas-16s23s5s 2*16-gca-235-aac-cgt
5s-8aas-16s-atc-235
ctc-gga-16s23s5s 5*16s23s5s-atgf-gac
3*16s23s5s-aac-acc
gga-16atcgca235-gta 16s23s5s-gaa
16s23s5s-tca
autres 16s23s5s-aac
16s-gca-235 16s-5s-23s-atgf-ctc-ctg
2*16-gca-235-aac
2*16-gca-235-aac-cgt autres incomplets
9*16-gca-235-2*17,15,2*12,9,8,7,4 aas 16s°atcgca235
16s-gca-235-25aas 16s°23s5s-16 aas
3*16s-5s-atcgca-23s-9,8,5aas 16s°atcgca235
16s-5s-atcgca-23s-5s-11aas
16s-5s-23s-14aas 5s en trop
16atcgca235-4aas-5s-aac
zéro cds 16s-5s-atcgca-23s-5s-11aas
5s-8aas-16s-atc-235
incomplets 23s°5s

Bacilli typage[modifier | modifier le wikicode]

bacilli blocs intégrés[modifier | modifier le wikicode]

Bacilli blocs intégrés
avant inversé Total intégré
16s23s5s 16s23s5s atcgca gca autres atc total
0 sans 112 26 1 *0 139
1 1-3 13 5 4 *0 22
4 4-8 13 4 3 *2 1 21
10 9-23 89 8 6 *3 103
1 24-43 1 1 1 *0 3
16 total 228 44 15 *5 1 288
0 Dont 16s5s-*-23s 1 4 0 *5 5

bacilli blocs 1-3[modifier | modifier le wikicode]

Bacillus blocs 1-3
1-3 après/ap Total
aac 12
acc 7
atgf 6
gac 5
cgt 2
ctc 1
ctg 1
gaa 1
tca 1
36
aac-acc 7
atgf-gac 5

bacilli blocs 4-8[modifier | modifier le wikicode]

  • Lien tableur: bacilli blocs 4-8
  • Le bloc bc014 a une séquence de 6 qui se répète dans plusieurs autres blocs 4-8
  • Le bloc bc657 est analogue à un bloc 9 des blocs 9-23
bc014	bc657
7	8
aac	gta
acc	aaa
ggc	cta
cgt	aca
cca	ggc
gca	tta
	cgt
	cca

bacilli blocs 9-23[modifier | modifier le wikicode]

  • Lien tableur: bacilli blocs 9-23
  • Notes:
    - Sont inclus 1 bloc 25 et 1 bloc 26.
    - 25 blocs à 9aas dont 14 sont identiques entre eux
    - 31 blocs de 12-16aas dont 23 ont la séquence de bc001 en commun
    - blocs 17aas, 2 sont analogues aux 12-16aas et 3 contiennent la séquence de 9aas dont 2 sont identiques
    - blocs 19aas 2/3 identiques et incluent la séquence 9aas
    - blocs 20aas 6/7 identiques et incluent la séquence 9aas
    - blocs 21aas 9/10 identiques et incluent la séquence 9aas
    - blocs 22aas 6/8 identiques et incluent la séquence 9aas
    - les blocs 25 et 26aas contiennent la séquence de 9aas

bacilli blocs avant[modifier | modifier le wikicode]

  • Lien tableur: bacilli blocs avant
  • Notes
    - 10 blocs de 12-14, 2 blocs de 4, un de 9 et un de 35
    - Ils ont tous après le 5s, le couple atgf-gac sauf bc074 et bc413
    - Les 10 blocs 12-14 ont 3 séquences de 3 gènes en commun
    - Le génome bc413 a atc dans les rRNAs et est analogue aux blocs à 9 des blocs après 9-23
    - Le génome bc029 à 35 aas a la séquence de 6 aas du début égale à celle des 12-14 aas, et a une séquence de 7 analogue à celle des blocs à 9 des blocs après 9-23.

bacilli total blocs longs[modifier | modifier le wikicode]

  • Lien tableur: bacilli total blocs longs
  • Légende:
    -  63 : gca aga ttg s'inversent dans les blocs longs des clostridia, ttg et gca s'annulent et aga devient majoritaire.
    -  0 : cga gtg gcg ggg agg cag n'existent quasiment pas, ni chez les clostridia ni chez les bacilli. Si les 5 qui se terminent par g suivent l’exemple des autres du même type de la dernière rangée, cga ne suit pas les tRNAs de sa rangée et du coup il est particulièrement atypique.
  • Notes
B. Bacilli total blocs longs
B1. Effectifs
tot 1749 atgf 83
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 48 acc 20 aac 87 agc 38
ctc 14 ccc 0 cac 53 cgt 82
gtc 3 gcc 1 gac 99 ggc 101
ttc 63 tcc 30 tac 56 tgc 30
atgi 20 aca 87 aaa 84 aga 1
cta 54 cca 77 caa 69 cga 0
gta 112 gca 63 gaa 93 gga 51
tta 59 tca 48 taa 0 tga 0
atgj 32 acg 3 aag 0 agg 0
ctg 11 ccg 0 cag 0 cgg 0
gtg 0 gcg 0 gag 0 ggg 1
ttg 32 tcg 2 tag 0 tgg 42
B2. Pour 1000
tot 1000 atgf 47
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 27 acc 11 aac 50 agc 22
ctc 8 ccc 0 cac 30 cgt 47
gtc 2 gcc 1 gac 57 ggc 58
ttc 36 tcc 17 tac 32 tgc 17
atgi 11 aca 50 aaa 48 aga 1
cta 31 cca 44 caa 39 cga 0
gta 64 gca 36 gaa 53 gga 29
tta 34 tca 27 taa 0 tga 0
atgj 18 acg 2 aag 0 agg 0
ctg 6 ccg 0 cag 0 cgg 0
gtg 0 gcg 0 gag 0 ggg 1
ttg 18 tcg 1 tag 0 tgg 24

clostridia[modifier | modifier le wikicode]

clostridia blocs[modifier | modifier le wikicode]

  • Lien tableur: clostridia blocs
  • Légende: NCBI # gtRNAdb, différence entre
    - 16s, nombre de 16s   taas, total tRNAs   avec, avec rRNA   sans, sans rRNA   tpage, total de la page correspondant à une en-tête   av16s, avec des tRNAs avant 16s.   Pour contrôle, tpage plus le nombre d' incomplets de Notes doit être égal au 16s de fin d'en-tête
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
clostridia blocs
lien blocs 16s taas avec sans tpage Cd001-32 Notes 1
cd001 3*16s23s5s 5 62 21 41 16s23s5s atcgca gcaatc gca atc autres av16s
16s-gcaatc-235-6aas sans 15 1 2 2 2 avant
5aas-16s-gcaatc-235-6aas 1-3 7 1 1 1 5aas-16s-gcaatc-235-6aas
5s 4-8 1 1 1 3 agc-16s5s23s-6aas
9-23 5 2 tca-tcc-16s5s23s-5aas
cd002 16atcgca235 5 67 34 33 24-43
16atcgca235-6aas 45 total 28 2 4 5 3 0 3 autres
3*16s23s5s-12,9,4 aas 16s5s-atc-23s
16s5s-gca-23-aac-gaa-tgc
cd003 3*16s23s5s 10 110 83 27 16s5s23s-gac-aca
16-gca-2355 16s5s23s
16-atc-235
3*16s23s5s-22,13,9aas 1-3
2*16-gca-235-22,13aas 16s-atc-23s-aac
16s-gcaatc-23s5s-ttc-tgc
cd011 16s5s23s 6 51 21 30 16s5s-gca-23-aac-gaa-tgc
16s5s23s-gac-aca 16235-aaa-cds-5s-aaa
16s5s-atc-23s 16s5s23s-gac-aca
agc-16s5s23s-6aas 2*16s23s5s-atgi-gca
tca-tcc-16s5s23s-5aas 16s23s5s-ttc-gac-gaa
16s5s-gca-23-aac-gaa-tgc 2*16s23s-aac-5s
cd013 16s23s5s 3 52 4 48 différents
2*16-gca-atc-235 2*16s23s-aac-5s
16235-aaa-cds-5s-aaa
cd032 NCBI # gtRNAdb 93 18 75
7*16s23s5s 16 cds
2*16s23s5s-atgi-gca 16235-aaa-cds-5s-aaa
16s23s5s-ttc-gac-gaa
2*16s23s-aac-5s 5s en trop
16s-atc-23s-aac 16235-aaa-cds-5s-aaa
16s-gca-23s5s 16-gca-2355
16235-aaa-cds-5s-aaa 5s-ttc
16s-gcaatc-23s5s-ttc-tgc 5s
5s-ttc 45
lien blocs 16s taas avec sans tpage Cd045-59 Notes 2
cd045 3*16s23s5s 10 87 22 65 16s23s5s atcgca gcaatc gca atc autres av16s
16s23s5s-atgi-gca sans 8 4 2 1 avant
16s23s5s-aaa 1-3 15 1 2 1 1 gca-atc-gga-16s23s5s
16s23s-aac-5s-aac 4-8 1 5s-atgi-gca-16-gca-atc-235-aac-aac
16s23s5s-ttc-5s-ttc-aaa 9-23
16s-gca-atc-235-6aas 24-43 1-3
gca-atc-gga-16s23s5s 36 total 23 0 2 6 3 0 2 3*16s23s5s-aaa
16s-gca-atc-23s-aac 3*16s23s5s-aac
2*16s23s5s-ttc
cd047 16s23s5s 5 53 6 47 16s23s5s-ggc
16s23s5s-aac 16s23s5s-ttc-tgc
16s23s5s-ttc 16s23s5s-aac-aac
16s23s5s-aac-aac 2*16s23s5s-atgi-gca
16s5s-atgi-gca 16s23s-aac-5s-aac
16s23s5s-ttc-5s-ttc-aaa
cd055 3*16-gca-235 8 65 9 56 2*16-gca-235-aac
16-gca-235-aac 16-atc-235-tgg
16-atc-235-tgg 16-gca-atc-235-aac
16-atc-235
16s23s5s-aac incomplets
16s23s5s 16s5s-atgi-gca
16s-gca-atc-23s-aac
cd057 16s23s5s 9 80 17 63
16s23s5s-atgi-gca différents
16s23s5s-ggc 16s23s-aac-5s-aac
2*16s23s5s-aaa 16s23s5s-ttc-5s-ttc-aaa
16s23s5s-ttc
16s23s5s-ttc-tgc 5s en trop
16-gca-atc-235-aac 16s23s5s-ttc-5s-ttc-aaa
5s-atgi-gca-16 – 5s-atgi-gca-16-gca-atc-235-aac-aac
gca-atc-235-aac-aac
cd059 2*16s23s5s 6 59 5 54
16-atc-235
16-gca-235
16s23s5s-aac
16-gca-235-aac 38
lien blocs 16s taas avec sans tpage Cd060-64 Notes 3
cd060 16s23s5s 7 63 10 53 16s23s5s atcgca gcaatc gca atc autres av16s
16s23s5s-atgi-gca sans 8 1 avant
16-gca-atc-235-atgi-gca 1-3 16 2 2 1 atgf-16s23s5s
16-atc-235-ttc 4-8 1 1 atgi-gca-16s23s5s-aac
16s23s5s-aac 9-23
16s23s5s-aaa 24-43 1-3
16s23s 32 total 25 0 3 0 2 0 2 16s23s5s-atgi
2*16s23s5s-aac
cd062 2*16s23s5s 9 74 13 61 2*16s23s5s-ttc
16s23s5s-atgi 5*16s23s5s-aaa
16s23s5s-aaa 3*16s23s5s-atgi-gca
16s23s5s-ttc 16s23s-aac-5s-aac
16-gca-atc-235-aac 16s23s5s-atgi-gca-aac
atgf-16s23s5s 16s23s5s-ttc-5s-ttc-aaa
16s23s5s-atgi-gca-aac 16-atc-235-ttc
16-gca-atc-23s 16-atc-235-ttc-tgc
5s-ttc 16-gca-atc-235-aac
16-gca-atc-235-atgi-gca
cd063 4*16s23s5s 10 81 18 63
16s23s-aac-5s-aac incomplets
16-gca-atc-23-aac 16s23s
16s23s5s-ttc-5s-ttc-aaa 16-gca-atc-23s
16s23s5s-aaa 16-gca-atc-23-aac
16s23s5s-atgi-gca
16-gca-atc-235-6 aas différents
16s23s5s-ttc-5s-ttc-aaa
cd064 16s23s5s 9 77 17 60 16s23s-aac-5s-aac
16s23s5s-atgi-gca
2*16s23s5s-aaa 5s en trop
16s23s5s-ttc 5s-ttc
16-atc-235-ttc-tgc 16s23s5s-ttc-5s-ttc-aaa
16s23s5s-aac
atgi-gca-16s23s5s-aac
16s23s5s-5aas 35
lien blocs 16s taas avec sans tpage Cd067-92 Notes 4
cd067 2*16s23s5s-atc-gca 10 96 16 80 16s23s5s atcgca gcaatc gca atc autres av16s
16s23s5s-gaa, aaa, aac, ttc sans 9 5 0 5 1 1-3
16-gca-atc-235-ttc, aaa 1-3 16 4 3*16s23s5s-aaa
16-gca-atc-23-aac 4-8 3*16s23s5s-ttc
16-gca-atc-235 – 9-23 4*16s23s5s-aac
aac-5s-ttc-tgc 24-43 16s23s5s-gaa
40 total 25 5 4 5 0 1 0 2*16s23s5s-atgi-gca
cd071 3*16s23s5s-aac 9 66 12 64 3*16s23s5s-atc-gca
16-gca-atc-235-ttc 16-gca-atc-235-aaa
16s23s5s-ttc, aaa 16-gca-atc-23-aac
16s23s5s 2*16-gca-atc-235-ttc
16s23s5s-atc-gca 16-gca-atc-235-aac-5s-ttc-tgc
16s23s5s-atgi-gca
incomplets
cd079 16s23s5s-atgi-gca 4 53 9 44 8aas-16s
16s23s5s-aaa 16s-atc-23s
16s23s5s-ttc 16-gca-atc-23-aac
16s-atc-23s
16s°-atc-235-atgi-gca autres incomplets
23s5s-aaa 23s5s-aaa
16s°-atc-235-atgi-gca
cd083 16s23s5s 2 48 2 46
16atcgca235 différents
16-gca-atc-235-aac-5s-ttc-tgc
cd084 2*16-gca-235 4 54 4 50
16s23s5s cds
16atcgca-cds-235 16atcgca-cds-235
cd089 2*16atcgca235 5 76 6 70 5s en trop
2*16-gca-235 16-gca-atc-235-aac-5s-ttc-tgc
16s23s5s
autres
cd092 5*16s23s5s 9 68 13 55 16atcgca-cds-235
2*16atcgca235
16-gca-235
8aas-16s 43
lien blocs 16s taas avec sans tpage Cd095-118 Notes 5
cd095 3*16-5s-23s 10 70 16 54 16s23s5s atcgca gcaatc gca atc autres av16s
16s-5s-atcgca-23s-gta-tta sans 6 1 2 1 5 2 avant
16-5s-atcgca-23-aac 1-3 2 6 1 1 1 gac-ttc-ggc-16s-5s-23s
2*16-5s-atgf-23s 4-8 4 1 1 15aas-16s5s-atcgca-23s
16-gcc-235-gta 9-23 2 4 1 2 cgg-tgg-16s5s-gcc-23s-5aas
gac-ttc-ggc-16s-5s-23s 24-43 ttc-cds-16s5s-atc-23s-aac-atgf
16s-23s 43 total 14 7 0 6 2 8 6 tcc-16s-cds-235-19aas
tcg-16s23s-gca-5s-12aas
cd102 2*16-gca-235 7 69 55 14
2*16s23s5s autres
2*16-gca-235-22,21aas 16-gcc-235-gta
16s23s5s-8aas 2*16s5s-gcc-23s
2*16s5s-gcc-23s-19, 5aas
cd112 16s23s-gca-5s-gta-tac-gga-cga 2*16-5s-atgf-23s
tcc-16s-cds-235-19aas 16s-cds-235
16s-cds-235 4 48 39 9 3*16-5s-23s
tcg-16s23s-gca-5s-12aas 16s-5s-atcgca-23s-gta-tta
16-5s-atcgca-23-aac
cd113 16s-atc-235 4 48 32 16 16s5s-atcgca-23s-aac-atgf
16s23s5s 16s5s-atc-23s-aac
16s-gca-235-11 aas
16s-gca-235-18 aas 1-3
16-gcc-235-gta
cd114 16atcgca235 4 59 21 38 16s5s-atc-23s-aac
2*16atcgca235-acc 16-5s-atcgca-23-aac
16s23s5s-13 aas 3*16atcgca235-acc
16s-5s-atcgca-23s-gta-tta
cd116 16s23s5s-aac 5 78 35 43 16s5s-atcgca-23s-aac-atgf
16s23s5s-caa-gaa-tac-ggc 16s23s5s-aac
16atcgca235-acc 16s5s23s-aaa-acc-ctc
16s23s5s-8 aas
16s23s5s-21 aas incomplets
16s-23s
cd118 2*16s5s-gcc-23s 10 109 67 42
16s5s-gcc-23s-19aas cds
16s5s-gcc-23s-5aas 16s-cds-235
16s5s23s-aaa-acc-ctc tcc-16s-cds-235-19aas
16s5s-atc-23s-aac ttc-cds-16s5s-atc-23s-aac-atgf
16s5s-atcgca-23s-aac-atgf
15aas-16s5s-atcgca-23s 44 différents
cgg-tgg-16s5s-gcc-23s-5aas 16s23s-gca-5s-gta-tac-gga-cga
ttc-cds-16s5s-atc-23s-aac-atgf
lien blocs 16s taas avec sans tpage Cd133-153 Notes 6
cd133 3*16s23s5s 10 85 75 10 16s23s5s atcgca gcaatc gca atc autres av16s
2*16s-gca-235 sans 9 2 1-3
16s23s-gga-5s 1-3 4 1 16’-gca-235-tta-atgi
16s23s5s-43aas 4-8 2*16s23s-gga-5s
16s23s5s-18aas 9-23 5 1 16s23s5s-tta-atgi
16s-gca-235-9aas 24-43 1 16s23s5s-gtg-gaa-cgg
16s23s-aca 23 total 19 0 0 4 0 0 0
incomplets
cd136 3*16s23s5s 16 110 99 11 2*16s23s-aca
16s’-gca-23s°-16s°-23s 16s’-gca-23s°-16s°-23s
16s°-gca-23s’ 16s-cds-23s°-5s-43aas
16s23s-gga-5s 16s23s°-cds
16s23s-aca 3*16s-23s°
16s-cds-23s°-5s-43aas 16s
cds-cds-23s°-5s-18aas
16s°-23s°-5s-9aas autres incomplets
16s°-gca-23s’
16s23s5s-19aas 23s5s
16s23s5s-tta-atgi 16s°-23s°-23s’-5s
16s23s5s 16s°gca-23s°
16’-gca-235-tta-atgi
cds
23s5s 16s-cds-23s°-5s-43aas
16s cds-cds-23s°-5s-18aas
16s23s°-cds
16s23s°-cds
3*16s-23s° différents
2*16s23s-gga-5s
16s°-23s°-23s’-5s
23s°-5s 5s en trop
16s°gca-23s° cds-cds-23s°-5s-18aas
16s°-23s°-5s-9aas
cd153 2*16s23s5s 6 98 40 58 23s°-5s
16s23s5s-gtg-gaa-cgg
2*16s23s5s-12aas
16s23s5s-13aas 32
lien blocs 16s taas avec sans tpage Cd154-174 Notes 6
cd154 2*16s-gcc-235 4 55 6 49 16s23s5s atcgca gcaatc gca atc autres av16s
2*16atcgca235 sans 13 7 5 avant
1-3 3 1 2 1 1 cag-gag-16atcgca235-aac
cd155 16atcgca235 4 48 2 46 4-8 1 1
16s23s5s 9-23 autres
16s23s°23s5s 24-43 2*16s-gcc-235
16s23s°23s5s-5s-5s 35 total 16 8 3 0 0 7 1 2*16-cds-atcgca-23s16s°5s
16s-cds-16s°-23s-cds-5s
cd156 16s23s5s 2 47 2 45 16s-23s°-gca-atc-23s-16s°-5s-6aas
16atcgca235 23s°-16s-16s°-23s-5s-aac-ggg
cd157 16s23s5s-aac 2 106 4 102 1-3
16-gcaatc-235-aac 16s23s5s-aac
16s23s5s-aac-ggg
cd158 2*16s23s5s 3 53 3 50 23s°-16s-16s°-23s-5s-aac-ggg
16atcgca235-aac 16atcgca235-aac
2*16-gcaatc-235-aac
cd159 16atcgca235 2 51 7 44
cag-gag-16atcgca235-aac cds
2*16-cds-atcgca-23s16s°5s
cd160 2*16-cds-atcgca-23s16s°5s 53 4 49 16s-cds-16s°-23s-cds-5s
16s-cds-16s°-23s-cds-5s 3
différents
cd161 2*16s23s5s 4 57 10 47 16s23s°23s5s
16s-23s°-gca-atc-23s-16s°-5s-6aas 16s23s°23s5s-5s-5s
23s°-16s-16s°-23s-5s-aac-ggg 16s-23s°-gca-atc-23s-16s°-5s-6aas
23s°-16s-16s°-23s-5s-aac-ggg
cd170 3*16s23s5s 5 58 10 48
16s23s5s-aac-ggg 5s en trop
16-gcaatc-235-6aas 16s23s°23s5s-5s-5s
cd173 2*16atcgca235 2 48 4 44
cd174 2*16s23s5s 3 53 3 50
16-gcaatc-235-aac 34
lien blocs 16s taas avec sans tpages Total
16s23s5s atcgca gcaatc gca atc autres av16s
sans 68 14 2 15 5 11 4
1-3 63 7 10 4 5 2 4
Moyenne 68 21 48 4-8 6 1 4 0 0 2 4
ecartype 19 23 19 9-23 12 0 0 7 0 1 2
max 110 99 102 24-43 1 0 0 0 0 0 0
min 47 2 9 254 total 150 22 16 26 10 16 14

clostridia Notes[modifier | modifier le wikicode]

Liens aux notes[modifier | modifier le wikicode]

Clostridia. Liens aux notes
1-3 1-3 1-3 1-3 1-3 1-3 1-3
16s-atc-23s-aac 3*16s23s5s-aaa 16s23s5s-atgi 3*16s23s5s-aaa 16-gcc-235-gta 16’-gca-235-tta-atgi 16s23s5s-aac
16s-gcaatc-23s5s-ttc-tgc 3*16s23s5s-aac 2*16s23s5s-aac 3*16s23s5s-ttc 16s5s-atc-23s-aac 2*16s23s-gga-5s 16s23s5s-aac-ggg
16s5s-gca-23-aac-gaa-tgc 2*16s23s5s-ttc 2*16s23s5s-ttc 4*16s23s5s-aac 16-5s-atcgca-23-aac 16s23s5s-tta-atgi 23s°-16s-16s°-23s-5s-aac-ggg
16235-aaa-cds-5s-aaa 16s23s5s-ggc 5*16s23s5s-aaa 16s23s5s-gaa 3*16atcgca235-acc 16s23s5s-gtg-gaa-cgg 16atcgca235-aac
16s5s23s-gac-aca 16s23s5s-ttc-tgc 3*16s23s5s-atgi-gca 2*16s23s5s-atgi-gca 16s-5s-atcgca-23s-gta-tta 2*16-gcaatc-235-aac
2*16s23s5s-atgi-gca 16s23s5s-aac-aac 16s23s-aac-5s-aac 3*16s23s5s-atc-gca 16s5s-atcgca-23s-aac-atgf
16s23s5s-ttc-gac-gaa 2*16s23s5s-atgi-gca 16s23s5s-atgi-gca-aac 16-gcaatc-235-aaa 16s23s5s-aac
2*16s23s-aac-5s 16s23s-aac-5s-aac 16s23s5s-ttc-5s-ttc-aaa 16-gcaatc-23-aac 16s5s23s-aaa-acc-ctc
16s23s5s-ttc-5s-ttc-aaa 16-atc-235-ttc 2*16-gcaatc-235-ttc
2*16-gca-235-aac 16-atc-235-ttc-tgc 16-gcaatc-235-aac-5s-ttc-tgc
16-atc-235-tgg 16-gcaatc-235-aac
16-gcaatc-235-aac 16-gcaatc-235-atgi-gca
avant avant avant avant avant avant avant
5aas-16s-gcaatc-235-6aas gca-atc-gga-16s23s5s atgf-16s23s5s gac-ttc-ggc-16s-5s-23s cag-gag-16atcgca235-aac
agc-16s5s23s-6aas 5s-atgi-gca-16-gcaatc-235-aac-aac atgi-gca-16s23s5s-aac 15aas-16s5s-atcgca-23s
tca-tcc-16s5s23s-5aas cgg-tgg-16s5s-gcc-23s-5aas
ttc-cds-16s5s-atc-23s-aac-atgf
tcc-16s-cds-235-19aas
tcg-16s23s-gca-5s-12aas
autres autres autres autres autres autres autres
16s5s-atc-23s 16atcgca-cds-235 16-gcc-235-gta 2*16s-gcc-235
16s5s-gca-23-aac-gaa-tgc 2*16s5s-gcc-23s 2*16-cds-atcgca-23s16s°5s
16s5s23s-gac-aca 2*16s5s-gcc-23s-19, 5aas 16s-cds-16s°-23s-cds-5s
16s5s23s 2*16-5s-atgf-23s 16s-23s°-gcaatc-23s-16s°-5s-6aas
16s-cds-235 23s°-16s-16s°-23s-5s-aac-ggg
3*16-5s-23s
16s-5s-atcgca-23s-gta-tta
16-5s-atcgca-23-aac
16s5s-atcgca-23s-aac-atgf
16s5s-atc-23s-aac
différents différents différents différents différents différents différents
2*16s23s-aac-5s 16s23s-aac-5s-aac 16s23s5s-ttc-5s-ttc-aaa 16-gcaatc-235-aac-5s-ttc-tgc 16s23s-gca-5s-gta-tac-gga-cga 2*16s23s-gga-5s 16s23s°23s5s
16235-aaa-cds-5s-aaa 16s23s5s-ttc-5s-ttc-aaa 16s23s-aac-5s-aac 16s23s°23s5s-5s-5s
16s-23s°-gcaatc-23s-16s°-5s-6aas
23s°-16s-16s°-23s-5s-aac-ggg
incomplets incomplets incomplets incomplets incomplets incomplets incomplets
16s5s-atgi-gca 16s23s 8aas-16s 16s-23s 2*16s23s-aca
16s-gcaatc-23s-aac 16-gcaatc-23s 16s-atc-23s 16s’-gca-23s°-16s°-23s
16-gcaatc-23-aac 16-gcaatc-23-aac 16s-cds-23s°-5s-43aas
16s23s°-cds
3*16s-23s°
16s
autres incomplets autres incomplets autres incomplets autres incomplets autres incomplets autres incomplets autres incomplets
23s5s-aaa 16s°-gca-23s’
16s°-atc-235-atgi-gca 23s5s
16s°-23s°-23s’-5s
16s°gca-23s°
cds cds cds cds cds cds cds
16235-aaa-cds-5s-aaa 16atcgca-cds-235 16s-cds-235 16s-cds-23s°-5s-43aas 2*16-cds-atcgca-23s16s°5s
tcc-16s-cds-235-19aas cds-cds-23s°-5s-18aas 16s-cds-16s°-23s-cds-5s
ttc-cds-16s5s-atc-23s-aac-atgf 16s23s°-cds
5s en trop 5s en trop 5s en trop 5s en trop 5s en trop 5s en trop 5s en trop
16235-aaa-cds-5s-aaa 16s23s5s-ttc-5s-ttc-aaa 5s-ttc 16-gcaatc-235-aac-5s-ttc-tgc cds-cds-23s°-5s-18aas 16s23s°23s5s-5s-5s
16-gca-2355 5s-atgi-gca-16-gcaatc-235-aac-aac 16s23s5s-ttc-5s-ttc-aaa 16s°-23s°-5s-9aas
5s-ttc 23s°-5s
5s
avant inversé avant inversé avant inversé avant inversé avant inversé avant inversé avant inversé
16s-gcaatc-235-11aas 16s23s5s-gca-atc-gga 16s23s5s-atgf 16s5s23s-gac-ttc-ggc 16atcgca235-aac-cag-gag
16s5s23s-7aas 16-gcaatc-235-aac-aac-5s-atgi-gca 16s23s5s-aac-atgi-gca 16s5s-atcgca-23s-15aas
16s5s23s-7aas 16s5s-gcc-23s-7aas
16s5s-atc-23s-aac-atgf-ttc-cds
16s-cds-235-20aas
16s23s-gca-5s-13aas

Cumuls notes[modifier | modifier le wikicode]

clostridia blocs, cumuls Notes
clostridia blocs, cumuls Notes
avant incomplets
atgf-16s23s5s 16s23s*2
gca-atc-gga-16s23s5s 16s23s-aca*2
atgi-gca-16s23s5s-aac 16-gcaatc-23s
16s-gcaatc-23s-aac*3
cag-gag-16-atcgca-235-aac 16s-atc-23s
5aas-16s-gcaatc-235-6aas 16s’-gca-23s°-16s°-23s
5s-atgi-gca-16-gcaatc-235-aac-aac
tcg-16s23s-gca-5s-12aas 16s5s-atgi-gca
16s-cds-23s°-5s-43aas
tcc-16s-cds-235-19aas
16s
gac-ttc-ggc-16s5s23s 8aas-16s
tca-tcc-16s5s23s-5aas 16s-23s° *3
agc-16s5s23s-6aas 16s23s°-cds
15aas-16s5s-atcgca-23s
ttc-cds-16s5s-atc-23s-aac-atgf autres incomplets
cgg-tgg-16s5s-gcc-23s-5aas 23s5s-aaa
23s5s
autres 16s°-23s°-23s’-5s
16s5s23s*4 16s°-atc-235-atgi-gca
16s5s23s-gac-aca 16s°-gca-23s’
16-5s-atcgca-23-aac 16s°gca-23s°
16s-5s-atcgca-23s-gta-tta
16s5s-atcgca-23s-aac-atgf cds
16s5s-gca-23-aac-gaa-tgc 16s-cds-235
16s5s-atc-23s tcc-16s-cds-235-19aas
16s5s-atc-23s-aac 16-atcgca-cds-235
16s-gcc-235*2 16s-cds-23s°-5s-43aas
16-gcc-235-gta 16s-cds-16s°-23s-cds-5s
16s5s-gcc-23s*2 16-cds-atcgca-23s16s°5s*2
16s5s-gcc-23s-19, 5aas*2
16-5s-atgf-23s*2 16235-aaa-cds-5s-aaa
ttc-cds-16s5s-atc-23s-aac-atgf
16s-cds-235
16-atcgca-cds-235 16s23s°-cds
16-cds-atcgca-23s16s°5s*2 cds-cds-23s°-5s-18aas
16s-cds-16s°-23s-cds-5s
23s°-16s-16s°-23s-5s-aac-ggg 5s en trop
16s-23s°-gca-atc-23s-16s°-5s-6aas 16s23s5s-ttc-5s-ttc-aaa*2
16-gca-2355
différents 16-gca-atc-235-aac-5s-ttc-tgc
16s23s-gga-5s*2 5s-atgi-gca-16-gca-atc-235-aac-aac
16s23s-aac-5s*2
16s23s-aac-5s-aac*2 16s°-23s°-5s-9aas
16s23s5s-ttc-5s-ttc-aaa*2 16s23s°23s5s-5s-5s
16s23s-gca-5s-gta-tac-gga-cga
cds-cds-23s°-5s-18aas
16-gcaatc-235-aac-5s-ttc-tgc 16235-aaa-cds-5s-aaa
16s-23s°-gcaatc-23s-16s°-5s-6aas
23s°-5s
16s23s°23s5s 2*5s-ttc
16s23s°23s5s-5s-5s 5s
23s°-16s-16s°-23s5s-aac-ggg
16235-aaa-cds-5s-aaa
clostridia blocs, cumuls 1-3
type 1-3 tRNAs nbre
16s23s5s aaa 11
aac 11
ttc 7
ggc 1
atgi 1
gaa 1
atgi-gca 9
atc-gca 3
ttc-tgc 1
aac-aac 1
tta-atgi 1
aac-ggg 1
gac-aca 1
aaa-cds-5s-aaa 1
atgi-gca-aac 1
gtg-gaa-cgg 1
ttc-gac-gaa 1
ttc-5s-ttc-aaa 2
aaa-acc-ctc 1
16s23s-gga-5s gga 2
aac 2
16s23s-aac-5s-aac aac-aac 2
23s°-16s-16s°-23s5s aac-ggg 1
16-atcgca-235 aac 4
aac 1
gta-tta 1
aac-atgf 1
16-gcaatc-235 aac 4
ttc 2
aaa 1
atgi-gca 1
ttc-tgc 1
aac-5s-ttc-tgc 1
16-gcaatc-23-aac aac 1
16s-atc-235 aac 1
tgg 1
ttc 1
ttc-tgc 1
16s-atc-23-aac aac 1
16-gca-235 aac 2
aac-gaa-tgc 1
16s’-gca-235 tta-atgi 1
16-gcc-235 gta 1
total 91

clostridia typage[modifier | modifier le wikicode]

clostridia blocs intégrés[modifier | modifier le wikicode]

  • Lien tableur: clostridia blocs intégrés
  • Légende: voir pour 'avant inversé, gcc atgf autres-cds' clostridia notes, ligne avant inversé et ligne autres. Pour les 16s5s-*-23s voir les clusters en gras, toujours dans clostridia_notes.
  • Notes: Dans l'hypothèse que les clusters 'avant 16s', ceux qui ont des tRNAs avant rRNA 16, sont des clusters inversés, j'ai copié tel quel l'avant ducluster vers sa fin. Quand il y a plus de 3 tRNAs ils sont intégrés dans le nombre total à la fin, par exemple 20aas au lieu de 19aas.
clostridia blocs intégrés
avant inversé Total intégré
total 16s23s5s atcgca gcaatc gca atc gcc atgf autres-cds total
- sans 68 14 2 15 5 4 2 5 115
5 1-3 63 7 10 4 5 1 0 1 91
5 4-8 6 1 4 0 1 1 13
4 9-23 12 7 1 20
24-43 1 1
14 total 150 22 16 26 10 7 2 7 240
6 Dont 16s5s-*-23s 5 3 0 1 2 4 2 0 17

clostridia blocs 1-3[modifier | modifier le wikicode]

Clostridia blocs 1-3
total 1-3 nbre 16s23s5s nbre 16s-*-23s5s nbre
aac 39 aac 22 aac 17
ttc 19 aaa 16 ttc 6
aaa 17 gca 13 tgc 4
gca 14 ttc 13 atgi 2
atgi 13 atgi 11 gta 2
tgc 5 5s 3 tta 2
5s 4 atc 3 5s 1
gaa 4 gaa 3 aaa 1
atc 3 ggg 3 atgf 1
ggg 3 gac 2 gaa 1
tta 3 gga 2 gca 1
gac 2 aca 1 tgg 1
gga 2 acc 1 total 39
gta 2 cds 1
aca 1 cgg 1
acc 1 ctc 1
atgf 1 ggc 1
cds 1 gtg 1
cgg 1 tgc 1
ctc 1 tta 1
ggc 1 total 100
gtg 1
tgg 1
total 139

clostridia blocs 4-8[modifier | modifier le wikicode]

  • Lien tableur: clostridia blocs 4-8
  • Notes:
    - 12 blocs dont 6 de 6, 3 de 8, 2 de 5 et 1 de 4
    - 2 fois 2 blocs identiques, cd045-cd063 et cd0161-cd0170
    - Le bloc cd092 a un seul rRNA, le 16s. Il est ambigu car on peut le considérer comme ayant perdu 23s5s avant ou après 16s.

clostridia blocs 9-23[modifier | modifier le wikicode]

  • Lien tableur: clostridia blocs 9-23
  • Notes:
    - 24 blocs dont 2 identiques de 43, cd133 et cd136 (voir annexe). Les 22 autres se décomposent en 4 à 9aas, 8 à 11-13aas, 5 à 18-19aas et 5 à 21-22aas.
    - La proximité phylogénique de cd133 et cd136 se retrouve dans l'identité des blocs 9aas et 18aas.
    - La séquence des 7 1ers tRNAs du bloc 9-cd133 se retrouve en tête dans 7 blocs différents: 11-cd113   13-cd003   18-cd113   19-cd136   22-cd003   22-cd102   43-cd133, soit 7 sur un total de 20 blocs, en tenant compte que les 2 13-cd003 sont quasi identiques (9 en commun séquentiellement).
    - Le grand groupe de 8 blocs des 11-13aas a 6 blocs tous différents, les 3 blocs 11-cd113 et 2*13-cd003 étant quasiment identiques (9 en commun séquentiellement).

clostridia blocs avant[modifier | modifier le wikicode]

  • Lien tableur: clostridia blocs avant
  • Notes:
    - Il y a 6 blocs avec des tRNAs à l'avant de 16s. 3 n'ont qu'un seul tRNA à l'avant avec 6, 12 et 19 à l'arrière. Parmi ces derniers, on pourrait comparer les 2 blocs longs aux blocs 9-23.
    - J'ai comparé 20-cd112 avec un tRNA à l'avant à 19-cd136 des 9-23 blocs. Les 19aas à l'arrière sont quasiment identiques séquentiellement (15/19).
    - J'ai comparé 14-cd112 avec un tRNA à l'avant à 12-cd002 des 9-23 blocs. Les 12aas à l'arrière ont 5 tRNAs identiques séquentiellement.
    - Les 4 autres blocs avant sont très différents des blocs arrière et entre eux: 17-cd118 n'a rien à l'arrière et 13-cd001 a 5 en avant et 6 en arrière; cd011 a 2 blocs 4-8, avec 6 et 5 à l'arrière.

clostridia total blocs longs[modifier | modifier le wikicode]

  • Lien tableur: clostridia total blocs longs
  • Légende
    -  0 : gca aga ttg s'inversent dans les blocs longs des bacilli, ttg et gca sont majoritaires et aga est réduit à l'unité.
    -  0 : cga gtg gcg ggg agg cag n'existent quasiment pas, ni chez les clostridia ni chez les bacilli. Si les 5 qui se terminent par g suivent l’exemple des autres du même type de la dernière rangée, cga ne suit pas les tRNAs de sa rangée et du coup il est particulièrement atypique.
  • Notes
C. Clostridia total blocs longs
C1. Effectifs
tot 568 atgf 26
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 10 acc 5 aac 26 agc 12
ctc 1 ccc 3 cac 12 cgt 8
gtc 4 gcc 4 gac 38 ggc 21
ttc 25 tcc 3 tac 24 tgc 11
atgi 15 aca 28 aaa 31 aga 21
cta 18 cca 17 caa 24 cga 0
gta 35 gca 0 gaa 40 gga 28
tta 16 tca 14 taa 0 tga 0
atgj 18 acg 3 aag 2 agg 1
ctg 5 ccg 2 cag 1 cgg 2
gtg 0 gcg 0 gag 4 ggg 0
ttg 0 tcg 2 tag 0 tgg 8
C2. Pour 1000
tot 1000 atgf 46
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 18 acc 9 aac 46 agc 21
ctc 2 ccc 5 cac 21 cgt 14
gtc 7 gcc 7 gac 67 ggc 37
ttc 44 tcc 5 tac 42 tgc 19
atgi 26 aca 49 aaa 55 aga 37
cta 32 cca 30 caa 42 cga 0
gta 62 gca 0 gaa 70 gga 49
tta 28 tca 25 taa 0 tga 0
atgj 32 acg 5 aag 4 agg 2
ctg 9 ccg 4 cag 2 cgg 4
gtg 0 gcg 0 gag 7 ggg 0
ttg 0 tcg 4 tag 0 tgg 14

bacilli-clostridia[modifier | modifier le wikicode]

B-C les types de blocs[modifier | modifier le wikicode]

B-C blocs avant[modifier | modifier le wikicode]

B-C blocs avec cds internes[modifier | modifier le wikicode]

B-C blocs 1-3[modifier | modifier le wikicode]

B-C total blocs longs[modifier | modifier le wikicode]

  • Lien tableur: B-C total blocs longs
  • Légende
    1. Tableaux B2 C2
      -  0 : gca aga ttg s'inversent entre bacilli et clostridia. Dans les blocs longs des bacilli, ttg et gca sont majoritaires et aga est réduit à l'unité.
      -  0 : cga gtg gcg ggg agg cag n'existent quasiment pas, ni chez les clostridia ni chez les bacilli. Si les 5 qui se terminent par g suivent l’exemple des autres du même type de la dernière rangée, cga ne suit pas les tRNAs de sa rangée et du coup il est particulièrement atypique.
      -  4 : Valeurs faibles
      -  9 : Valeurs moyennes
    2. Tableau BC: plus grande variation en % des variations en pour 1000 de B2 moins C2, le dénominateur étant le plus faible entre B2 et C2 pour un tRNA donné.
      -  0 : grandes variations analogues à gca aga ttg (pour un dénominateur nul, il est remplacé par l'unité). Comme ces derniers cgt tcc passent d'une valeur forte à une valeur faible, ils triplent (200%). Le tRNA atgi double seulement sa valeur. Le tRNA ctc quadruple sa valeur mais il passe d'une valeur moyenne à faible et ses effectifs sont faibles.
      -  70 : Les variations sont proches de 50% et plus, les tRNAs remarquables (70%) sont parmi les obligatoires, atgj tgg gga. Les variations inférieures à 30% sont en clair et contiennent la plus part des tRNAs obligatoires, aac cac gac tac tgc ttc, et leurs semblables agc atc .
      - Les valeurs faibles de bacilli qui le restent chez les clostridia sont représentées par une différence et non par la plus grande variation. De même pour les valeurs nulles ou égales à l'unité des effectifs.
BC. Bacilli-Clostridia total blocs longs
B2. Bacilli pour 1000
tot 1000 atgf 47
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 27 acc 11 aac 50 agc 22
ctc 8 ccc 0 cac 30 cgt 47
gtc 2 gcc 1 gac 57 ggc 58
ttc 36 tcc 17 tac 32 tgc 17
atgi 11 aca 50 aaa 48 aga 1
cta 31 cca 44 caa 39 cga 0
gta 64 gca 36 gaa 53 gga 29
tta 34 tca 27 taa 0 tga 0
atgj 18 acg 2 aag 0 agg 0
ctg 6 ccg 0 cag 0 cgg 0
gtg 0 gcg 0 gag 0 ggg 1
ttg 18 tcg 1 tag 0 tgg 24
C2. Clostridia pour 1000
tot 1000 atgf 46
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 18 acc 9 aac 46 agc 21
ctc 2 ccc 5 cac 21 cgt 14
gtc 7 gcc 7 gac 67 ggc 37
ttc 44 tcc 5 tac 42 tgc 19
atgi 26 aca 49 aaa 55 aga 37
cta 32 cca 30 caa 42 cga 0
gta 62 gca 0 gaa 70 gga 49
tta 28 tca 25 taa 0 tga 0
atgj 32 acg 5 aag 4 agg 2
ctg 9 ccg 4 cag 2 cgg 4
gtg 0 gcg 0 gag 7 ggg 0
ttg 0 tcg 4 tag 0 tgg 14
BC. B2 - C2 : plus grande variation
tot -- atgf    4
att act aat agt
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 56 acc 30 aac 9 agc 3
ctc 355 ccc -5 cac 43 cgt 233
gtc -5 gcc -6 gac -18 ggc 56
ttc -22 tcc 225 tac -32 tgc -13
atgi -131 aca 1 aaa -14 aga -6366
cta -3 cca 47 caa -7 cga 0
gta 4 gca 3602 gaa -32 gga -69
tta 20 tca 11 taa 0 tga 0
atgj -73 acg -4 aag -4 agg -2
ctg -40 ccg -4 cag -2 cgg -4
gtg 0 gcg 0 gag -7 ggg 1
ttg 1830 tcg -2 tag 0 tgg 70

Autres firmicutes[modifier | modifier le wikicode]

Autres firmicutes blocs[modifier | modifier le wikicode]

  • Lien tableur: Autres firmicutes blocs
  • Légende:
    - 16s, nombre de 16s   taas, total tRNAs   avec, avec rRNA   sans, sans rRNA   tpage, total de la page correspondant à une en-tête   av16s, avec des tRNAs avant 16s.   Pour contrôle, tpage plus le nombre d' incomplets de Notes doit être égal au 16s de fin d'en-tête
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
clostridia blocs
lien blocs 16s total aas avec sans total page en004-9 Notes
en002 3*16s23s5s 3 53 0 53 16s23s5s atcgca gcaatc gca
5s sans 19 4 3 1-3
1-3 4 2 16s23s5s-cds-tgc-taa
en003 16s23s5s-CDS-tgc-taa 1 40 2 38 4-8 16s23s5s-cds-tac-caa
9-23 1 3 16235-aac-gaa-acg
en004 16s23s5s 7 77 63 14 24-43 16atcgca235-tgg-cgt
16atcgca235-9aas 36 total 24 9 0 3 16atcgca235-aac
2*16atcgca235-12aas
16235-19aas cds
16s23s5s-cds-tac-caa 16s23s5s-cds-tgc-taa
16235-aac-gaa-acg 16s23s5s-cds-tac-caa
en005 4*16s23s5s 6 60 4 56 5s en trop
2*16atcgca235 16s23s5s-5s
5s
en006 3*16s23s5s 3 53 0 53
en008 4*16s23s5s 7 65 6 59
2*16-gca-235
16atcgca235-tgg-cgt
en009 3*16s23s5s 9 77 9 68
16s23s5s-aac
16atcgca235-aac
2*16atcgca235
16-gca-235
16s23s5s-5s
36
lien blocs 16s total aas avec sans total page en010-13 Notes
en010 6*16s23s5s 15 99 28 71 16s23s5s atcgca gcaatc gca
3*16atcgca235 sans 15 4 1 1 1-3
16-gca-235 1-3 2 2 1 1 16-gca-235-aac
16s23s5s-5s 4-8 16-gcaatc-235-cac-tgg-agc
16-gca-235-aac 9-23 1 1 16atcgca235-aac
16atcgca235-aac 24-43 16atcgca235-tgg-cgt
16s23s5s-acc 29 total 18 6 3 2 16s23s5s-acc
16s-23s° 16s23s5s-cac-tgg
gga-5s-5aas-ncRNA-9aas
incomplets
en011 4*16s23s5s 7 73 20 53 16s23s
16-gcaatc-235-cac-tgg-agc 16s-23s°
16-gcaatc-2355-13 aas
16s23s 5s en trop
16s23s5s-5s
en012 16s23s5s 4 55 16 39 gga-5s-5aas-ncRNA-9aas
16-gca-atc-235 16-gcaatc-2355-13 aas
16s23s5s-cac-tgg
16s23s5s-12aas
en013 2*16s23s5s 4 49 6 43
16atcgca235
16atcgca235-tgg-cgt
30
lien blocs 16s total aas avec sans total pages total Notes
701 154 547 16s23s5s atcgca gcaatc gca
sans 34 8 1 4
1-3 6 4 1 1
Moyenne 64 14 50 4-8 0 0 0 0
ecartype 17 19 16 9-23 2 3 1 0
max 99 63 71 24-43
min 40 0 14 65 total 42 15 3 5

Noms firmicutes[modifier | modifier le wikicode]

Tableau des noms[modifier | modifier le wikicode]

  • Lien tableur: Noms firmicutes
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 2.9.19 Paris.
  • Légende
    - notes
    • - NCBI1: [1]
    • - NCBI2: [2]
    • - bmq et semblables, code KEGG à partir duquel on peut retrouver le NCBI
    • - 2*95, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes bacilli, clostridia et autres firmicutes
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs           total           61644
génomes		ruptures	faits	total
total		324		86	850
bacilli		189		32	663
clostridia	123		43	174
autres		12		11	13
F. Noms des firmicutes
ruptures notes rRNAs fait code tRNAs génomes
1 444 1 bc001 60 Aerococcus urinae ACS-120-V-Col10a
1 666 1 bc002 65 Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
bc003 64 Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
1 666 1 bc004 56 Amphibacillus xylanus NBRC 15112
1 bc005 77 Anoxybacillus flavithermus WK1
1 bc006 87 Bacillus amyloliquefaciens CC178
bc007 94 Bacillus amyloliquefaciens DSM 7
10,10,10 1 bc008 95 Bacillus amyloliquefaciens IT-45
bc009 85 Bacillus amyloliquefaciens L-H15
bc010 92 Bacillus amyloliquefaciens L-S60
bc011 94 Bacillus amyloliquefaciens LFB112
bc012 72 Bacillus amyloliquefaciens LL3
bc013 72 Bacillus amyloliquefaciens SQR9
1 10,8,10 1 bc014 89 Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19
1 10,9,10 1 bc015 89 Bacillus amyloliquefaciens subsp. plantarum AS43.3
bc016 95 Bacillus amyloliquefaciens subsp. plantarum CAU B946
bc017 90 Bacillus amyloliquefaciens subsp. plantarum FZB42
bc018 92 Bacillus amyloliquefaciens subsp. plantarum NAU-B3
bc019 81 Bacillus amyloliquefaciens subsp. plantarum NJN6
bc020 77 Bacillus amyloliquefaciens subsp. plantarum TrigoCor1448
bc021 86 Bacillus amyloliquefaciens subsp. plantarum UCMB5033 UCMB-5033
bc022 89 Bacillus amyloliquefaciens subsp. plantarum UCMB5036
bc023 89 Bacillus amyloliquefaciens subsp. plantarum UCMB5113
bc024 92 Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
666 1 bc025 70 Bacillus amyloliquefaciens TA208
bc026 75 Bacillus amyloliquefaciens XH7
bc027 88 Bacillus amyloliquefaciens Y2
1 bc028 96 Bacillus anthracis 2000031021
NCBI 1 11,11,11 1 bc029 112 Bacillus anthracis 2002013094
bc030 95 Bacillus anthracis A0157
bc031 96 Bacillus anthracis A1144
bc032 95 Bacillus anthracis Ames A0462
bc033 98 Bacillus anthracis Ames BA1004
1 10,10,10 1 bc034 94 Bacillus anthracis BA1015
bc035 96 Bacillus anthracis BA1035
bc036 95 Bacillus anthracis BFV
bc037 83 Bacillus anthracis Canadian bison
bc038 95 Bacillus anthracis Cvac02
bc039 107 Bacillus anthracis delta Sterne
bc040 95 Bacillus anthracis Han
bc041 96 Bacillus anthracis HYU01
bc042 96 Bacillus anthracis K3
bc043 101 Bacillus anthracis Ohio ACB
bc044 98 Bacillus anthracis PAK-1
bc045 96 Bacillus anthracis Pasteur
bc046 95 Bacillus anthracis Pollino
bc047 94 Bacillus anthracis RA3
bc048 97 Bacillus anthracis SK-102
bc049 95 Bacillus anthracis str. A0248
bc050 93 Bacillus anthracis str. A16
bc051 93 Bacillus anthracis str. A16R
bc052 33 Bacillus anthracis str. A2012
bc053 95 Bacillus anthracis str. Ames
bc054 95 Bacillus anthracis str. Ames Ancestor A2084
bc055 97 Bacillus anthracis str. CDC 684
bc056 96 Bacillus anthracis str. H9401
2*95 bc057 190 Bacillus anthracis str. Sterne
bc058 96 Bacillus anthracis str. SVA11
bc059 99 Bacillus anthracis str. Turkey32
bc060 96 Bacillus anthracis str. V770-NP-1R
bc061 95 Bacillus anthracis str. Vollum
bc062 95 Bacillus anthracis Vollum 1B
1 777 1 bc063 75 Bacillus atrophaeus 1942
bc064 81 Bacillus atrophaeus NRS 1221A
888 1 bc065 80 Bacillus atrophaeus subsp. globigii BSS
1 13,13,13 1 bc066 95 Bacillus bombysepticus str. Wang
1 10,10,10 1 bc067 83 Bacillus cellulosilyticus DSM 2522
1 2*106 bc068 212 Bacillus cereus 03BB102
bc069 105 Bacillus cereus 03BB108
bc070 107 Bacillus cereus 03BB87
bc071 108 Bacillus cereus 3a
bc072 106 Bacillus cereus AH187
bc073 97 Bacillus cereus AH820
14,14,14 1 bc074 118 Bacillus cereus Al Hakam
bc075 99 Bacillus cereus ATCC 10987
bc076 108 Bacillus cereus ATCC 14579
bc077 107 Bacillus cereus ATCC 4342
bc078 108 Bacillus cereus B4264
bc079 102 Bacillus cereus biovar anthracis str. CI
bc080 105 Bacillus cereus D17
96+103 bc081 199 Bacillus cereus E33L
bc082 105 Bacillus cereus F837/76
bc083 102 Bacillus cereus FM1
bc084 106 Bacillus cereus FORC 005
bc085 107 Bacillus cereus FRI-35
bc086 92 Bacillus cereus FT9
bc087 105 Bacillus cereus G9241
bc088 99 Bacillus cereus G9842
bc089 106 Bacillus cereus NC7401
13,13,13 1 bc090 95 Bacillus cereus Q1
bc091 106 Bacillus cereus S2-8
1 bc092 75 Bacillus clausii KSM-K16
1 bc093 73 Bacillus coagulans 2-6
bc094 85 Bacillus coagulans 36D1
bc095 86 Bacillus coagulans DSM 1 ATCC 7050
bc096 85 Bacillus coagulans HM-08
1 13,13,13 1 bc097 107 Bacillus cytotoxicus NVH 391-98
1 bc098 78 Bacillus halodurans C-125
1 bc099 88 Bacillus infantis NRRL B-14911
1 bc100 69 Bacillus lehensis G1
1 bc101 73 Bacillus licheniformis 9945A
bc102 73 Bacillus licheniformis BL-09
74*2 bc103 148 Bacillus licheniformis DSM 13 ATCC 14580
1 bc104 116 Bacillus megaterium DSM 319
bc105 128 Bacillus megaterium NBRC 15308 ATCC 14581
bmq bc106 142 Bacillus megaterium QM B1551
bc107 119 Bacillus megaterium WSH-002
1 bc108 92 Bacillus methanolicus MGA3
1 bc109 82 Bacillus methylotrophicus JS25R
1 bmyc bc110 118 Bacillus mycoides 219298
bc111 107 Bacillus mycoides ATCC 6462
1 bc112 78 Bacillus pseudofirmus OF4
1 bc113 81 Bacillus pumilus MTCC B6033
bc114 70 Bacillus pumilus SAFR-032
bc115 70 Bacillus pumilus W3
1 bc116 69 Bacillus selenitireducens MLS10
1 bc117 91 Bacillus sp. 1NLA3E
1 bc118 87 Bacillus sp. BH072
1 bc119 86 Bacillus sp. BS34A
1 bc120 86 Bacillus sp. JS
1 bc121 86 Bacillus sp. LM 4-2
1 bc122 83 Bacillus sp. OxB-1
1 bc123 84 Bacillus sp. Pc3
1 bc124 81 Bacillus sp. WP8
1 gst 12,12,12 1 bc125 123 Bacillus sp. X12014
1 bc126 87 Bacillus sp. YP1
1 bc127 72 Bacillus subtilis ATCC 13952
bc128 72 Bacillus subtilis ATCC 19217
bc129 59 Bacillus subtilis B-1
bc130 92 Bacillus subtilis BEST7003
NCBI 2 bc131 130 Bacillus subtilis BEST7613
bc132 86 Bacillus subtilis Bs-916
bc133 86 Bacillus subtilis BS49
bc134 83 Bacillus subtilis BSn5
bc135 71 Bacillus subtilis HJ5
bc136 86 Bacillus subtilis KCTC 1028
bc137 86 Bacillus subtilis PS832
bc138 86 Bacillus subtilis PY79
bc139 86 Bacillus subtilis QB928
bc140 84 Bacillus subtilis SG6
bc141 88 Bacillus subtilis subsp. natto BEST195
bc142 77 Bacillus subtilis subsp. spizizenii NRS 231
bc143 77 Bacillus subtilis subsp. spizizenii str. W23
bc144 92 Bacillus subtilis subsp. spizizenii TU-B-10
bc145 86 Bacillus subtilis subsp. subtilis 3NA
bc146 86 Bacillus subtilis subsp. subtilis 6051-HGW
2*86 10,10,10 1 bc147 172 Bacillus subtilis subsp. subtilis str. 168
bc148 86 Bacillus subtilis subsp. subtilis str. AG1839
bc149 89 Bacillus subtilis subsp. subtilis str. BAB-1
bc150 86 Bacillus subtilis subsp. subtilis str. BSP1
bc151 86 Bacillus subtilis subsp. subtilis str. JH642 substr. AG174
bc152 80 Bacillus subtilis subsp. subtilis str. OH 131.1
bc153 86 Bacillus subtilis subsp. subtilis str. RO-NN-1
bc154 77 Bacillus subtilis T30
bc155 77 Bacillus subtilis XF-1
1 bc156 105 Bacillus thuringiensis 97-27
bc157 104 Bacillus thuringiensis BMB171
btg 14,14,14 1 bc158 142 Bacillus thuringiensis Bt407
bc159 99 Bacillus thuringiensis HD-771
bc160 122 Bacillus thuringiensis HD-789
bc161 134 Bacillus thuringiensis HD1002
bc162 104 Bacillus thuringiensis HD1011
bc163 104 Bacillus thuringiensis HD571
bc164 105 Bacillus thuringiensis HD682
15,15,15 1 bc165 78 Bacillus thuringiensis MC28
bc166 86 Bacillus thuringiensis serovar chinensis CT-43
bc167 108 Bacillus thuringiensis serovar finitimus YBT-020
bc168 115 Bacillus thuringiensis serovar galleriae HD-29
bc169 105 Bacillus thuringiensis serovar konkukian str. 97-27
bc170 108 Bacillus thuringiensis serovar kurstaki HD 1
bc171 98 Bacillus thuringiensis serovar kurstaki str. HD-1
bc172 104 Bacillus thuringiensis serovar kurstaki str. HD73
99+108 bc173 207 Bacillus thuringiensis serovar kurstaki str. YBT-1520
bc174 98 Bacillus thuringiensis serovar morrisoni BGSC 4AA1
bc175 86 Bacillus thuringiensis serovar thuringiensis str. IS5056
bc176 104 Bacillus thuringiensis str. Al Hakam
bc177 95 Bacillus thuringiensis YBT-1518
1 bc178 98 Bacillus toyonensis BCT-7112
1 bc179 108 Bacillus weihenstephanensis KBAB4
bc180 79 Bacillus weihenstephanensis WSBC 10204
1 bbe bc181 127 Brevibacillus brevis NBRC 100599 NBRC 100599 47
1 blr bc182 113 Brevibacillus laterosporus LMG 15441
1 bc183 59 Carnobacterium maltaromaticum LMA28
1 bc184 67 Carnobacterium sp. 17-4
1 bc185 74 Carnobacterium sp. WN1359
1 bc186 60 Enterococcus casseliflavus EC20
1 bc187 57 Enterococcus faecalis 62
bc188 63 Enterococcus faecalis ATCC 29212
bc189 65 Enterococcus faecalis D32
bc190 64 Enterococcus faecalis DENG1
bc191 60 Enterococcus faecalis OG1RF
bc192 65 Enterococcus faecalis str. Symbioflor 1
bc193 71 Enterococcus faecalis V583
1 bc194 47 Enterococcus faecium Aus0004
bc195 76 Enterococcus faecium Aus0085 AUS0085
bc196 64 Enterococcus faecium DO
bc197 48 Enterococcus faecium NRRL B-2354
bc198 65 Enterococcus faecium T110
1 bc199 72 Enterococcus hirae ATCC 9790
1 bc200 66 Enterococcus mundtii QU 25 QU25
1 bc201 33 Enterococcus sp. 7L76
1 bc202 67 Exiguobacterium antarcticum B7 Eab7
1 bc203 69 Exiguobacterium sibiricum 255-15
1 bc204 68 Exiguobacterium sp. AT1b
1 bc205 61 Exiguobacterium sp. MH3
1 bc206 88 Geobacillus kaustophilus HTA426
1 bc207 89 Geobacillus sp. C56-T3
1 bc208 88 Geobacillus sp. GHH01
1 bc209 89 Geobacillus sp. JF8
1 bc210 93 Geobacillus sp. WCH70
1 bc211 92 Geobacillus sp. Y4.1MC1
1 bc212 89 Geobacillus sp. Y412MC52
1 bc213 89 Geobacillus sp. Y412MC61
1 bc214 88 Geobacillus thermodenitrificans NG80-2
1 bc215 91 Geobacillus thermoglucosidasius C56-YS93
1 bc216 89 Geobacillus thermoleovorans CCB US3 UF5
1 bc217 69 Halobacillus halophilus DSM 2266
1 jeo bc218 124 Jeotgalibacillus sp. D5
1 bc219 56 Jeotgalicoccus sp. 13MG44 air
1 bc220 60 Kyrpidia tusciae DSM 2912
1 bc221 63 Lactobacillus acidophilus 30SC
bc222 61 Lactobacillus acidophilus FSI4
bc223 61 Lactobacillus acidophilus La-14
bc224 61 Lactobacillus acidophilus NCFM
1 bc225 60 Lactobacillus amylovorus GRL 1112
bc226 62 Lactobacillus amylovorus GRL1118
1 bc227 65 Lactobacillus brevis ATCC 367
bc228 49 Lactobacillus brevis BSO 464
bc229 64 Lactobacillus brevis KB290
1 bc230 61 Lactobacillus buchneri CD034
bc231 63 Lactobacillus buchneri NRRL B-30929
1 bc232 57 Lactobacillus casei 12A
bc233 59 Lactobacillus casei ATCC 334
bc234 61 Lactobacillus casei BD-II
bc235 61 Lactobacillus casei BL23
bc236 59 Lactobacillus casei LC2W
bc237 61 Lactobacillus casei LOCK919
bc238 60 Lactobacillus casei str. Zhang
bc239 59 Lactobacillus casei subsp. casei ATCC 393
bc240 61 Lactobacillus casei W56
1 bc241 64 Lactobacillus crispatus ST1
1 bc242 89 Lactobacillus delbrueckii subsp. bulgaricus 2038
bc243 95 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 JCM 1002
999 1 bc244 98 Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
bc245 98 Lactobacillus delbrueckii subsp. bulgaricus ND02
1 bc246 58 Lactobacillus fermentum CECT 5716
bc247 58 Lactobacillus fermentum F-6
bc248 58 Lactobacillus fermentum IFO 3956
1 bc249 75 Lactobacillus gasseri ATCC 33323 JCM 1131
1 bc250 64 Lactobacillus helveticus CNRZ32
bc251 61 Lactobacillus helveticus DPC 4571
bc252 63 Lactobacillus helveticus H10
bc253 61 Lactobacillus helveticus H9
bc254 61 Lactobacillus helveticus KLDS1.8701
bc255 61 Lactobacillus helveticus R0052
1 bc256 56 Lactobacillus hokkaidonensis LOOC260
1 bc257 55 Lactobacillus johnsonii DPC 6026
bc258 54 Lactobacillus johnsonii FI9785
bc259 54 Lactobacillus johnsonii N6.2
bc260 78 Lactobacillus johnsonii NCC 533
1 bc261 60 Lactobacillus kefiranofaciens ZW3
1 bc262 92 Lactobacillus mucosae LM1
1 bc263 61 Lactobacillus paracasei N1115
bc264 59 Lactobacillus paracasei subsp. paracasei 8700 2
bc265 61 Lactobacillus paracasei subsp. paracasei JCM 8130
1 bc266 69 Lactobacillus plantarum 16
bc267 67 Lactobacillus plantarum B21
bc268 62 Lactobacillus plantarum JDM1
bc269 72 Lactobacillus plantarum subsp. plantarum P-8
bc270 71 Lactobacillus plantarum subsp. plantarum ST-III
bc271 74 Lactobacillus plantarum WCFS1
bc272 65 Lactobacillus plantarum ZJ316
1 bc273 68 Lactobacillus reuteri DSM 20016
bc274 70 Lactobacillus reuteri I5007
bc275 65 Lactobacillus reuteri JCM 1112
bc276 70 Lactobacillus reuteri SD2112
bc277 70 Lactobacillus reuteri TD1
1 bc278 60 Lactobacillus rhamnosus ATCC 8530
bc279 59 Lactobacillus rhamnosus GG ATCC 53103
bc280 57 Lactobacillus rhamnosus GG GG ATCC 53103
bc281 61 Lactobacillus rhamnosus Lc 705
bc282 59 Lactobacillus rhamnosus LOCK900
bc283 62 Lactobacillus rhamnosus LOCK908
1 bc284 67 Lactobacillus ruminis ATCC 27782
1 bc285 65 Lactobacillus sakei subsp. sakei 23K
1 bc286 77 Lactobacillus salivarius CECT 5713
bc287 77 Lactobacillus salivarius JCM1046
1 bc288 61 Lactobacillus sanfranciscensis TMW 1.1304
1 bc289 56 Lactobacillus sp. wkB8
1 bc290 63 Lactococcus garvieae ATCC 49156
bc291 63 Lactococcus garvieae Lg2
1 bc292 62 Lactococcus lactis AI06
1 bc293 64 Lactococcus lactis subsp. cremoris A76
bc294 62 Lactococcus lactis subsp. cremoris KW2
bc295 64 Lactococcus lactis subsp. cremoris MG1363
bc296 64 Lactococcus lactis subsp. cremoris NZ9000
bc297 62 Lactococcus lactis subsp. cremoris SK11
bc298 61 Lactococcus lactis subsp. cremoris UC509.9
1 bc299 66 Lactococcus lactis subsp. lactis CV56
bc300 63 Lactococcus lactis subsp. lactis Il1403 IL1403
bc301 65 Lactococcus lactis subsp. lactis IO-1
bc302 69 Lactococcus lactis subsp. lactis KF147
bc303 66 Lactococcus lactis subsp. lactis KLDS 4.0325
bc304 69 Lactococcus lactis subsp. lactis NCDO 2118
bc305 64 Lactococcus lactis subsp. lactis S0
1 bc306 65 Leuconostoc carnosum JB16
1 bc307 70 Leuconostoc citreum KM20
1 bc308 67 Leuconostoc gelidum JB7
bc309 67 Leuconostoc gelidum subsp. gasicomitatum LMG 18811
1 bc310 68 Leuconostoc kimchii IMSNU 11154
1 bc311 69 Leuconostoc mesenteroides KFRI-MG
bc312 71 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
bc313 71 Leuconostoc mesenteroides subsp. mesenteroides J18
1 bc314 67 Leuconostoc sp. C2
1 bc315 67 Listeria ivanovii subsp. ivanovii PAM 55
bc316 67 Listeria ivanovii subsp. ivanovii WSLC 3010
bc317 67 Listeria ivanovii subsp. londoniensis WSLC 30151
bc318 67 Listeria ivanovii subsp. londoniensis WSLC 30167
bc319 67 Listeria ivanovii WSLC3009
1 bc320 67 Listeria monocytogenes 07PF0776
bc321 58 Listeria monocytogenes 08-5578
bc322 58 Listeria monocytogenes 08-5923
bc323 67 Listeria monocytogenes 10403S
bc324 49 Listeria monocytogenes 6179
bc325 67 Listeria monocytogenes ATCC 19117
bc326 67 Listeria monocytogenes C1-387
bc327 67 Listeria monocytogenes CFSAN006122
666 1 bc328 67 Listeria monocytogenes EGD
bc329 67 Listeria monocytogenes Finland 1998 Finland 1988
bc330 67 Listeria monocytogenes FSL R2-561
bc331 67 Listeria monocytogenes HCC23
bc332 65 Listeria monocytogenes IZSAM Lm hs2008
bc333 59 Listeria monocytogenes J0161
bc334 67 Listeria monocytogenes J1-220
bc335 67 Listeria monocytogenes J1776
bc336 58 Listeria monocytogenes J1816
bc337 67 Listeria monocytogenes J1817
bc338 67 Listeria monocytogenes J1926
bc339 67 Listeria monocytogenes J2-031
bc340 58 Listeria monocytogenes J2-064
bc341 67 Listeria monocytogenes J2-1091
bc342 67 Listeria monocytogenes L312
bc343 67 Listeria monocytogenes L99
bc344 67 Listeria monocytogenes La111
bc345 67 Listeria monocytogenes Lm60
bc346 67 Listeria monocytogenes M7
bc347 67 Listeria monocytogenes N1-011A
bc348 67 Listeria monocytogenes N2306
bc349 67 Listeria monocytogenes N53-1
bc350 67 Listeria monocytogenes NE dc2014
bc351 67 Listeria monocytogenes NTSN
bc352 67 Listeria monocytogenes R2-502
bc353 58 Listeria monocytogenes R479a
bc354 67 Listeria monocytogenes serotype 4b str. CLIP 80459 Clip80459
bc355 67 Listeria monocytogenes serotype 4b str. F2365 4b F2365
bc356 67 Listeria monocytogenes serotype 4b str. LL195
bc357 67 Listeria monocytogenes serotype 7 str. SLCC2482
bc358 67 Listeria monocytogenes SLCC2372
bc359 67 Listeria monocytogenes SLCC2376
bc360 67 Listeria monocytogenes SLCC2378
bc361 65 Listeria monocytogenes SLCC2479
bc362 67 Listeria monocytogenes SLCC2540
bc363 67 Listeria monocytogenes SLCC2755
bc364 67 Listeria monocytogenes SLCC5850
bc365 68 Listeria monocytogenes SLCC7179
bc366 67 Listeria monocytogenes WSLC1001
bc367 67 Listeria monocytogenes WSLC1042
1 bc368 67 Listeria seeligeri serovar 1/2b str. SLCC3954
1 bc369 66 Listeria welshimeri serovar 6b str. SLCC5334
1 bc370 107 Lysinibacillus fusiformis RB-21
1 bc371 86 Lysinibacillus sphaericus C3-41
1 bc372 98 Lysinibacillus varians GY32
1 bc373 50 Macrococcus caseolyticus JCSC5402
1 bc374 61 Melissococcus plutonius ATCC 35311
bc375 55 Melissococcus plutonius DAT561
1 bc376 71 Oceanobacillus iheyensis HTE831
1 bc377 45 Oenococcus kitaharae DSM 17330
1 bc378 46 Oenococcus oeni PSU-1
1 bc379 90 Paenibacillus beijingensis DSM 24997
1 bc380 86 Paenibacillus borealis DSM 13188
1 bc381 87 Paenibacillus durus DSM 1735
1 bc382 89 Paenibacillus graminis DSM 15220
1 bc383 81 Paenibacillus larvae subsp. larvae DSM 25430
1 pmq 14,14,14 1 bc384 175 Paenibacillus mucilaginosus 3016
pmw bc385 152 Paenibacillus mucilaginosus K02
bc386 113 Paenibacillus mucilaginosus KNP414
1 bc387 88 Paenibacillus odorifer DSM 15391
1 bc388 107 Paenibacillus polymyxa CF05
bc389 90 Paenibacillus polymyxa CR1
bc390 91 Paenibacillus polymyxa E681
bc391 111 Paenibacillus polymyxa M1
bc392 109 Paenibacillus polymyxa Sb3-1
ppm 14,13,13 1 bc393 165 Paenibacillus polymyxa SC2
bc394 112 Paenibacillus polymyxa SQR-21 SQR21
1 bc395 82 Paenibacillus sabinae T27
1 bc396 86 Paenibacillus sp. FSL H7-0357
1 bc397 93 Paenibacillus sp. FSL H7-0737
1 bc398 87 Paenibacillus sp. FSL P4-0081
1 bc399 90 Paenibacillus sp. FSL R5-0345
1 bc400 90 Paenibacillus sp. FSL R5-0912
1 bc401 85 Paenibacillus sp. FSL R7-0273
1 bc402 85 Paenibacillus sp. FSL R7-0331
1 bc403 90 Paenibacillus sp. IHBB 10380
1 bc404 89 Paenibacillus sp. JDR-2
1 bc405 73 Paenibacillus sp. Y412MC10
1 bc406 88 Paenibacillus stellifer DSM 14472
1 bc407 90 Paenibacillus terrae HPL-003
1 bc408 57 Pediococcus claussenii ATCC BAA-344
1 bc409 55 Pediococcus pentosaceus ATCC 25745
1 bc410 51 Pediococcus pentosaceus SL4
bc411 60 Planococcus sp. PAMC 21323
1 bc412 97 Solibacillus silvestris StLB046
1 755 1 bc413 63 Staphylococcus aureus 04-02981
bc414 58 Staphylococcus aureus 08BA02176
bc415 56 Staphylococcus aureus 144 S7
bc416 62 Staphylococcus aureus 2395 USA500
bc417 54 Staphylococcus aureus 25b MRSA
bc418 54 Staphylococcus aureus 26b MRSA
bc419 54 Staphylococcus aureus 27b MRSA
bc420 54 Staphylococcus aureus 29b MRSA
bc421 54 Staphylococcus aureus 31b MRSA
bc422 54 Staphylococcus aureus 33b
bc423 61 Staphylococcus aureus 502A
bc424 31 Staphylococcus aureus 71A S11
bc425 58 Staphylococcus aureus 79 S10
bc426 31 Staphylococcus aureus 93b S9
bc427 62 Staphylococcus aureus Bmb9393
bc428 61 Staphylococcus aureus CA-347
bc429 58 Staphylococcus aureus FCFHV36
bc430 61 Staphylococcus aureus ILRI Eymole1/1
bc431 58 Staphylococcus aureus M1
bc432 53 Staphylococcus aureus NRS 100
bc433 61 Staphylococcus aureus RF122
bc434 52 Staphylococcus aureus SA17 S6
1 bc435 60 Staphylococcus aureus subsp. aureus 11819-97
bc436 53 Staphylococcus aureus subsp. aureus 55/2053
bc437 58 Staphylococcus aureus subsp. aureus 6850
bc438 58 Staphylococcus aureus subsp. aureus 71193
bc439 60 Staphylococcus aureus subsp. aureus ATCC 25923
bc440 58 Staphylococcus aureus subsp. aureus CN1
bc441 53 Staphylococcus aureus subsp. aureus COL
bc442 61 Staphylococcus aureus subsp. aureus ECT-R 2
bc443 60 Staphylococcus aureus subsp. aureus ED133
bc444 62 Staphylococcus aureus subsp. aureus ED98
bc445 60 Staphylococcus aureus subsp. aureus FORC 001
bc446 62 Staphylococcus aureus subsp. aureus Gv69
bc447 59 Staphylococcus aureus subsp. aureus H-EMRSA-15
bc448 61 Staphylococcus aureus subsp. aureus HO 5096 0412
bc449 61 Staphylococcus aureus subsp. aureus JH1
bc450 60 Staphylococcus aureus subsp. aureus JH9
bc451 58 Staphylococcus aureus subsp. aureus JKD6159
bc452 61 Staphylococcus aureus subsp. aureus LGA251
bc453 60 Staphylococcus aureus subsp. aureus M013
bc454 60 Staphylococcus aureus subsp. aureus MRSA252
bc455 59 Staphylococcus aureus subsp. aureus MSHR1132
bc456 60 Staphylococcus aureus subsp. aureus MSSA476
bc457 61 Staphylococcus aureus subsp. aureus Mu3
bc458 61 Staphylococcus aureus subsp. aureus Mu50
bc459 61 Staphylococcus aureus subsp. aureus MW2
bc460 63 Staphylococcus aureus subsp. aureus N315
bc461 61 Staphylococcus aureus subsp. aureus NCTC 8325
bc462 61 Staphylococcus aureus subsp. aureus SA268
bc463 61 Staphylococcus aureus subsp. aureus SA40
bc464 60 Staphylococcus aureus subsp. aureus SA957
bc465 506 Staphylococcus aureus subsp. aureus ST228
bc466 61 Staphylococcus aureus subsp. aureus ST398
bc467 61 Staphylococcus aureus subsp. aureus ST772-MRSA-V DAR4145
bc468 84 Staphylococcus aureus subsp. aureus str. JKD6008
bc469 61 Staphylococcus aureus subsp. aureus str. Newman
bc470 55 Staphylococcus aureus subsp. aureus T0131
bc471 61 Staphylococcus aureus subsp. aureus TCH60
bc472 62 Staphylococcus aureus subsp. aureus TW20
bc473 54 Staphylococcus aureus subsp. aureus USA300 FPR3757
bc474 61 Staphylococcus aureus subsp. aureus USA300 TCH1516
bc475 61 Staphylococcus aureus subsp. aureus VC40
bc476 62 Staphylococcus aureus subsp. aureus Z172
bc477 61 Staphylococcus aureus UA-S391 USA300
bc478 61 Staphylococcus aureus USA300-ISMMS1
bc479 59 Staphylococcus aureus XN108
1 bc480 61 Staphylococcus carnosus subsp. carnosus TM300
1 bc481 58 Staphylococcus epidermidis 949 S8
bc482 61 Staphylococcus epidermidis ATCC 12228
bc483 61 Staphylococcus epidermidis PM221
bc484 61 Staphylococcus epidermidis RP62A
bc485 60 Staphylococcus epidermidis SEI
1 bc486 62 Staphylococcus haemolyticus JCSC1435
bc487 62 Staphylococcus haemolyticus Sh29/312/L2
1 bc488 59 Staphylococcus hyicus ATCC 11249
1 bc489 61 Staphylococcus lugdunensis HKU09-01
bc490 56 Staphylococcus lugdunensis N920143
1 bc491 49 Staphylococcus pasteuri SP1
1 bc492 68 Staphylococcus pseudintermedius E140
bc493 58 Staphylococcus pseudintermedius ED99
bc494 59 Staphylococcus pseudintermedius HKU10-03
1 bc495 60 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
1 bc496 59 Staphylococcus warneri SG1
1 bc497 55 Staphylococcus xylosus HKUOPL8
bc498 59 Staphylococcus xylosus SMQ-121
1 777 1 bc499 80 Streptococcus agalactiae 09mas018883
bc500 72 Streptococcus agalactiae 138P
bc501 71 Streptococcus agalactiae 138spar
bc502 72 Streptococcus agalactiae 2-22
bc503 80 Streptococcus agalactiae 2603V/R
bc504 80 Streptococcus agalactiae A909
bc505 80 Streptococcus agalactiae CNCTC 10/84
bc506 80 Streptococcus agalactiae COH1
bc507 82 Streptococcus agalactiae GBS1-NY
bc508 80 Streptococcus agalactiae GBS2-NM
bc509 80 Streptococcus agalactiae GBS6
bc510 77 Streptococcus agalactiae GD201008-001
bc511 81 Streptococcus agalactiae ILRI005
bc512 79 Streptococcus agalactiae ILRI112
bc513 81 Streptococcus agalactiae NGBS061
bc514 81 Streptococcus agalactiae NGBS572
bc515 80 Streptococcus agalactiae SA20-06
1 bc516 58 Streptococcus anginosus C1051
bc517 58 Streptococcus anginosus C238
bc518 59 Streptococcus anginosus SA1
bc519 67 Streptococcus anginosus subsp. whileyi MAS624
1 bc520 59 Streptococcus constellatus subsp. pharyngis C1050
bc521 59 Streptococcus constellatus subsp. pharyngis C232
bc522 59 Streptococcus constellatus subsp. pharyngis C818
1 bc523 57 Streptococcus dysgalactiae subsp. equisimilis 167
bc524 57 Streptococcus dysgalactiae subsp. equisimilis AC-2713
bc525 57 Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
bc526 57 Streptococcus dysgalactiae subsp. equisimilis GGS 124
bc527 57 Streptococcus dysgalactiae subsp. equisimilis RE378
1 bc528 66 Streptococcus equi subsp. equi 4047
bc529 57 Streptococcus equi subsp. zooepidemicus ATCC 35246
bc530 51 Streptococcus equi subsp. zooepidemicus CY
bc531 57 Streptococcus equi subsp. zooepidemicus H70
1 bc532 57 Streptococcus equi subsp. zooepidemicus MGCS10565 ATCC BAA1716
bc533 61 Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
bc534 81 Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
bc535 72 Streptococcus gallolyticus UCN34
1 bc536 60 Streptococcus gordonii str. Challis substr. CH1
1 bc537 69 Streptococcus infantarius subsp. infantarius CJ18
1 bc538 45 Streptococcus iniae ISET0901
bc539 45 Streptococcus iniae ISNO
bc540 47 Streptococcus iniae SF1
bc541 58 Streptococcus iniae YSFST01-82
1 bc542 60 Streptococcus intermedius B196
bc543 60 Streptococcus intermedius C270
bc544 67 Streptococcus intermedius JTH08
1 bc545 60 Streptococcus lutetiensis 033
1 bc546 71 Streptococcus macedonicus ACA-DC 198
1 bc547 61 Streptococcus mitis B6
1 bc548 65 Streptococcus mutans GS-5
bc549 65 Streptococcus mutans LJ23
bc550 65 Streptococcus mutans NN2025
bc551 65 Streptococcus mutans UA159
bc552 65 Streptococcus mutans UA159-FR
1 bc553 51 Streptococcus oligofermentans AS 1.3089
1 bc554 61 Streptococcus oralis Uo5
1 bc555 62 Streptococcus parasanguinis ATCC 15912
bc556 62 Streptococcus parasanguinis FW213
1 bc557 60 Streptococcus parauberis KCTC 11537
bc558 58 Streptococcus parauberis NCFD 2020
1 bc559 60 Streptococcus pasteurianus ATCC 43144
1 bc560 60 Streptococcus pneumoniae 670-6B
bc561 59 Streptococcus pneumoniae 70585
bc562 59 Streptococcus pneumoniae A026
bc563 58 Streptococcus pneumoniae AP200
bc564 58 Streptococcus pneumoniae ATCC 700669
bc565 58 Streptococcus pneumoniae CGSP14
bc566 59 Streptococcus pneumoniae D39
bc567 59 Streptococcus pneumoniae G54
bc568 58 Streptococcus pneumoniae gamPNI0373
bc569 59 Streptococcus pneumoniae Hungary19A-6
bc570 59 Streptococcus pneumoniae INV104
bc571 59 Streptococcus pneumoniae INV200
bc572 59 Streptococcus pneumoniae JJA
bc573 60 Streptococcus pneumoniae NT 110 58
bc574 59 Streptococcus pneumoniae OXC141
bc575 59 Streptococcus pneumoniae P1031
bc576 54 Streptococcus pneumoniae PCS8235
bc577 59 Streptococcus pneumoniae R6
bc578 59 Streptococcus pneumoniae SPN032672
bc579 59 Streptococcus pneumoniae SPN033038
bc580 59 Streptococcus pneumoniae SPN034156 SNP034156
bc581 59 Streptococcus pneumoniae SPN034183 SNP034183
bc582 59 Streptococcus pneumoniae SPN994038 SNP994038
bc583 59 Streptococcus pneumoniae SPN994039 SNP994039
bc584 59 Streptococcus pneumoniae SPNA45
bc585 59 Streptococcus pneumoniae ST556
bc586 59 Streptococcus pneumoniae Taiwan19F-14
bc587 59 Streptococcus pneumoniae TCH8431/19A
bc588 59 Streptococcus pneumoniae TIGR4
bc589 59 Streptococcus pneumoniae TIGR4 ATCC BAA-334
1 bc590 42 Streptococcus pseudopneumoniae IS7493
1 bc591 67 Streptococcus pyogenes 1E1
bc592 67 Streptococcus pyogenes 7F7
bc593 67 Streptococcus pyogenes A20
bc594 67 Streptococcus pyogenes Alab49
bc595 68 Streptococcus pyogenes ATCC 19615
bc596 69 Streptococcus pyogenes HKU QMH11M0907901
bc597 69 Streptococcus pyogenes HKU360
bc598 67 Streptococcus pyogenes HSC5
bc599 57 Streptococcus pyogenes M1 476
2*60 bc600 120 Streptococcus pyogenes M1 GAS SF370
bc601 57 Streptococcus pyogenes M23ND
bc602 67 Streptococcus pyogenes MGAS10270
bc603 67 Streptococcus pyogenes MGAS10394
bc604 67 Streptococcus pyogenes MGAS10750
bc605 57 Streptococcus pyogenes MGAS15252
bc606 57 Streptococcus pyogenes MGAS1882
bc607 68 Streptococcus pyogenes MGAS2096
bc608 67 Streptococcus pyogenes MGAS315
bc609 67 Streptococcus pyogenes MGAS5005
bc610 67 Streptococcus pyogenes MGAS6180
bc611 68 Streptococcus pyogenes MGAS8232
bc612 68 Streptococcus pyogenes MGAS9429
bc613 67 Streptococcus pyogenes NZ131 ATCC BAA-1633
bc614 57 Streptococcus pyogenes SSI-1
bc615 66 Streptococcus pyogenes STAB1102
bc616 67 Streptococcus pyogenes STAB901
bc617 59 Streptococcus pyogenes STAB902
bc618 66 Streptococcus pyogenes str. Manfredo
1 bc619 68 Streptococcus salivarius 57.I
bc620 68 Streptococcus salivarius CCHSS3
bc621 68 Streptococcus salivarius JIM8777
bc622 68 Streptococcus salivarius NCTC 8618
1 bc623 61 Streptococcus sanguinis SK36
1 bc624 60 Streptococcus sp. I-G2
1 bc625 86 Streptococcus sp. I-P16
1 bc626 69 Streptococcus sp. VT 162
1 bc627 56 Streptococcus suis 05HAS68
bc628 56 Streptococcus suis 05ZYH33
bc629 59 Streptococcus suis 6407
bc630 56 Streptococcus suis 98HAH33
bc631 56 Streptococcus suis A7
bc632 56 Streptococcus suis BM407
bc633 56 Streptococcus suis D12
bc634 54 Streptococcus suis D9
bc635 49 Streptococcus suis GZ1
bc636 62 Streptococcus suis JS14
bc637 56 Streptococcus suis P1/7
bc638 56 Streptococcus suis S735
bc639 56 Streptococcus suis SC070731
bc640 56 Streptococcus suis SC84
bc641 59 Streptococcus suis SS12
bc642 58 Streptococcus suis ST1
bc643 56 Streptococcus suis ST3
bc644 56 Streptococcus suis T15
bc645 56 Streptococcus suis TL13
bc646 56 Streptococcus suis YB51
1 bc647 55 Streptococcus thermophilus ASCC 1275
bc648 67 Streptococcus thermophilus CNRZ1066
bc649 67 Streptococcus thermophilus JIM 8232
bc650 67 Streptococcus thermophilus LMD-9
bc651 67 Streptococcus thermophilus LMG 18311
bc652 57 Streptococcus thermophilus MN-ZLW-002
bc653 57 Streptococcus thermophilus ND03
bc654 67 Streptococcus thermophilus SMQ-301
1 555 1 bc655 59 Streptococcus uberis 0140J
1 888 1 bc656 56 Terribacillus aidingensis MP602
1 555 1 bc657 62 Tetragenococcus halophilus NBRC 12172
1 555 1 bc658 61 Thermobacillus composti KWC4
1 777 1 bc659 54 Virgibacillus sp. SK37
1 766 1 bc660 75 Weissella ceti WS08
bc661 71 Weissella ceti WS105
bc662 77 Weissella ceti WS74
1 bc663 56 Weissella koreensis KACC 15510
1 en001 55 Erysipelothrix rhusiopathiae str. Fujisawa
433 1 en002 53 Erysipelothrix rhusiopathiae SY1027
1 111 1 en003 40 Faecalitalea cylindroides T2-87
1 777 1 en004 77 Lactobacillus salivarius UCC118
1 666 1 en005 60 Acidaminococcus fermentans DSM 20731
1 333 1 en006 53 Acidaminococcus intestini RyC-MR95
1 en007 51 Megamonas hypermegale ART12/1
1 777 1 en008 65 Megasphaera elsdenii DSM 20460
1 10,9,9 1 en009 77 Pelosinus fermentans JBW45
1 16,15,14 1 en010 99 Pelosinus sp. UFO1
1 777 1 en011 73 Selenomonas ruminantium subsp. lactilytica TAM6421
1 444 1 en012 55 Selenomonas sputigena ATCC 35185
1 444 1 en013 49 Veillonella parvula DSM 2008
1 655 1 cd001 62 Acetobacterium woodii DSM 1030
1 555 1 cd002 67 Acetohalobium arabaticum DSM 5501
1 11,10,10 1 cd003 110 Alkaliphilus metalliredigens QYMF
1 cd004 88 Alkaliphilus oremlandii OhILAs
1 cd005 51 Ammonifex degensii KC4
1 cd006 48 Anaerococcus prevotii DSM 20548
1 cd007 27 butyrate-producing bacterium SM4/1
cd008 57 butyrate-producing bacterium SS3/4
cd009 53 butyrate-producing bacterium SSC/2
1 cd010 60 Butyrivibrio fibrisolvens 16/4
1 666 1 cd011 51 Butyrivibrio proteoclasticus B316
1 cd012 56 Caldanaerobacter subterraneus subsp. tengcongensis MB4
1 333 1 cd013 52 Caldicellulosiruptor bescii DSM 6725
1 cd014 50 Caldicellulosiruptor hydrothermalis 108
1 cd015 51 Caldicellulosiruptor kristjanssonii I77R1B
1 cd016 48 Caldicellulosiruptor kronotskyensis 2002
1 cd017 47 Caldicellulosiruptor lactoaceticus 6A
1 cd018 46 Caldicellulosiruptor obsidiansis OB47
1 cd019 49 Caldicellulosiruptor owensensis OL
1 cd020 48 Caldicellulosiruptor saccharolyticus DSM 8903
1 cd021 41 Candidatus Arthromitus sp. SFB-mouse-Japan
cd022 40 Candidatus Arthromitus sp. SFB-mouse-NL
cd023 40 Candidatus Arthromitus sp. SFB-mouse-Yit
1 cd024 39 Candidatus Arthromitus sp. SFB-rat-Yit
1 cd025 47 Candidatus Desulforudis audaxviator MP104C
1 cd026 53 Carboxydothermus hydrogenoformans Z-2901
1 cd027 75 Clostridium acetobutylicum ATCC 824
cd028 75 Clostridium acetobutylicum DSM 1731
cd029 77 Clostridium acetobutylicum EA 2018
1 cd030 69 Clostridium autoethanogenum DSM 10061
1 cd031 79 Clostridium baratii str. Sullivan
1 17,16,16 1 cd032 70 Clostridium beijerinckii 59B
cd033 95 Clostridium beijerinckii ATCC 35702 SA-1
cd034 95 Clostridium beijerinckii NCIMB 8052
1 cd035 84 Clostridium botulinum 111
cd036 70 Clostridium botulinum 202F
cd037 81 Clostridium botulinum A str. ATCC 19397
cd038 80 Clostridium botulinum A str. ATCC 3502
cd039 81 Clostridium botulinum A str. Hall
cd040 81 Clostridium botulinum A2 str. Kyoto
cd041 81 Clostridium botulinum A3 str. Loch Maree
cd042 77 Clostridium botulinum B str. Eklund 17B NRP
cd043 82 Clostridium botulinum B1 str. Okra
cd044 83 Clostridium botulinum Ba4 str. 657
10,10,10 1 cd045 87 Clostridium botulinum BKT015925
cd046 73 Clostridium botulinum CDC 1436
554 1 cd047 53 Clostridium botulinum CDC 297
cd048 79 Clostridium botulinum E3 str. Alaska E43
cd049 72 Clostridium botulinum F str. 230613
cd050 82 Clostridium botulinum F str. Langeland
cd051 72 Clostridium botulinum H04402 065
cd052 79 Clostridium botulinum NCTC 8266
cd053 79 Clostridium botulinum NCTC 8550
cd054 76 Clostridium botulinum Prevot 594
1 888 1 cd055 65 Clostridium cellulolyticum H10 ATCC 35319
1 cd056 60 Clostridium cellulosi
1 10,9,9 1 cd057 80 Clostridium cellulovorans 743B
1 cd058 50 Clostridium cf. saccharolyticum K10
1 666 1 cd059 61 Clostridium clariflavum DSM 19732
1 677 1 cd060 63 Clostridium kluyveri DSM 555
cd061 63 Clostridium kluyveri NBRC 12016
1 999 1 cd062 74 Clostridium ljungdahlii DSM 13528
1 10,10,10 1 cd063 81 Clostridium novyi NT
1 999 1 cd064 77 Clostridium pasteurianum BC1
2*81 cd065 162 Clostridium pasteurianum DSM 525 ATCC 6013
1 cd066 93 Clostridium perfringens ATCC 13124
10,10,10 1 cd067 96 Clostridium perfringens str. 13
1 cd068 85 Clostridium saccharobutylicum DSM 13864
cd069 68 Clostridium saccharolyticum WM1
1 cd070 71 Clostridium saccharoperbutylacetonicum N1-4HMT
1 999 1 cd071 66 Clostridium scatologenes ATCC 25775
1 cd072 84 Clostridium sordellii ATCC9714
cd073 85 Clostridium sordellii JGS6382
1 cd074 62 Clostridium sp. BNL1100
1 cd075 53 Clostridium sp. SY8519
1 cd076 81 Clostridium sporogenes NCIMB 10696
1 2*49 cd077 98 Clostridium stercorarium subsp. stercorarium DSM 8532
1 cd078 60 Clostridium sticklandii DSM 519
1 546 1 cd079 53 Clostridium tetani 12124569
cd080 54 Clostridium tetani E88 Massachusetts substr. E88
1 cd081 46 Coprococcus catus GD/7
1 cd082 28 Coprococcus sp. ART55/1
1 222 1 cd083 48 Coprothermobacter proteolyticus DSM 5265
1 444 1 cd084 54 Dehalobacter restrictus DSM 9455 PER-K23
1 cd085 53 Dehalobacter sp. CF
1 cd086 53 Dehalobacter sp. DCA
1 cd087 76 Desulfitobacterium dehalogenans ATCC 51507
1 cd088 73 Desulfitobacterium dichloroeliminans LMG P-21439
1 555 1 cd089 76 Desulfitobacterium hafniense DCB-2
cd090 63 Desulfitobacterium hafniense Y51
1 cd091 73 Desulfitobacterium metallireducens DSM 15288 853-15A
1 898 1 cd092 68 Desulfosporosinus acidiphilus SJ4
1 cd093 82 Desulfosporosinus meridiei DSM 13257
1 cd094 77 Desulfosporosinus orientis DSM 765
1 9,10,10 1 cd095 70 Desulfotomaculum acetoxidans DSM 771
1 cd096 66 Desulfotomaculum carboxydivorans CO-1-SRB
1 cd097 67 Desulfotomaculum gibsoniae DSM 7213
1 cd098 49 Desulfotomaculum kuznetsovii DSM 6115
1 cd099 74 Desulfotomaculum reducens MI-1
1 cd100 67 Desulfotomaculum ruminis DSM 2154
1 cd101 60 Ethanoligenens harbinense YUAN-3
1 777 1 cd102 69 Eubacterium acidaminophilum DSM 3953
1 cd103 47 Eubacterium eligens ATCC 27750
1 cd104 60 Eubacterium limosum KIST612
1 cd105 60 Eubacterium rectale ATCC 33656
cd106 44 Eubacterium rectale DSM 17629
cd107 53 Eubacterium rectale M104/1
1 cd108 50 Eubacterium siraeum 70/3
cd109 38 Eubacterium siraeum V10Sc8a
1 cd110 60 Faecalibacterium prausnitzii L2-6 L2/6
1 cd111 71 Faecalibacterium prausnitzii SL3/3
1 444 1 cd112 48 Filifactor alocis ATCC 35896
1 444 1 cd113 48 Finegoldia magna ATCC 29328
1 444 1 cd114 59 Halanaerobium hydrogeniformans
1 cd115 55 Halanaerobium praevalens DSM 2228
1 555 1 cd116 78 Halobacteroides halobius DSM 5150
1 cd117 57 Halothermothrix orenii H 168 DSM 9562
1 hmo 10,10,10 1 cd118 109 Heliobacterium modesticaldum Ice1 ATCC 51547
1 cd119 61 Lachnoclostridium phytofermentans ISDg
1 cd120 46 Mageeibacillus indolicus UPII9-5
1 cd121 51 Mahella australiensis 50-1 BON
1 cd122 52 Moorella thermoacetica ATCC 39073
1 cd123 52 Natranaerobius thermophilus JW/NM-WN-LF
1 cd124 72 Oscillibacter valericigenes Sjm18-20
1 cd125 42 Parvimonas micra KCOM 1535 ChDC B708
1 cd126 53 Pelotomaculum thermopropionicum SI
1 cd127 67 Peptoclostridium difficile 2007855
cd128 89 Peptoclostridium difficile 630
cd129 91 Peptoclostridium difficile 630 cultivar NCTC 13307 /strain
cd130 91 Peptoclostridium difficile 630Derm
cd131 80 Peptoclostridium difficile BI1
cd132 22 Peptoclostridium difficile BI9
9,10,10 1 cd133 85 Peptoclostridium difficile CD196
cd134 66 Peptoclostridium difficile CF5
cd135 88 Peptoclostridium difficile M120
14,16,13 1 cd136 110 Peptoclostridium difficile M68
cd137 67 Peptoclostridium difficile R20291
1 cd138 53 Peptoniphilus sp. 1-1
1 cd139 58 Roseburia hominis A2-183
1 cd140 52 Roseburia intestinalis M50/1
cd141 66 Roseburia intestinalis XB6B4
1 cd142 57 Ruminiclostridium thermocellum ATCC 27405
cd143 57 Ruminiclostridium thermocellum DSM 1313
1 cd144 79 Ruminococcus albus 7 DSM 20455
1 cd145 57 Ruminococcus bicirculans 80/3
1 cd146 36 Ruminococcus bromii L2-63
1 cd147 45 Ruminococcus champanellensis 18P13 JCM 17042
1 cd148 46 Ruminococcus obeum A2-162
1 cd149 47 Ruminococcus sp. SR1/5
1 cd150 47 Ruminococcus torques L2-14
1 cd151 57 Sulfobacillus acidophilus DSM 10332
cd152 56 Sulfobacillus acidophilus TPY
1 666 1 cd153 98 Symbiobacterium thermophilum IAM 14863 IAM14863
1 444 1 cd154 55 Syntrophobotulus glycolicus DSM 8271
1 533 1 cd155 48 Syntrophomonas wolfei subsp. wolfei str. Goettingen G311
1 222 1 cd156 47 Syntrophothermus lipocalidus DSM 12680
1 2*53 222 1 cd157 106 Tepidanaerobacter acetatoxydans Re1
1 333 1 cd158 53 Thermacetogenium phaeum DSM 12270
1 222 1 cd159 51 Thermaerobacter marianensis DSM 12885
1 333 1 cd160 53 Thermincola potens JR
1 444 1 cd161 57 Thermoanaerobacter brockii subsp. finnii Ako-1
1 cd162 56 Thermoanaerobacter italicus Ab9
1 cd163 58 Thermoanaerobacter kivui DSM 2030
1 cd164 59 Thermoanaerobacter mathranii subsp. mathranii str. A3
1 cd165 57 Thermoanaerobacter pseudethanolicus ATCC 33223 39E
1 cd166 56 Thermoanaerobacter sp. X513
1 cd167 54 Thermoanaerobacter sp. X514
1 cd168 57 Thermoanaerobacter wiegelii Rt8.B1
1 cd169 58 Thermoanaerobacterium saccharolyticum JW/SL-YS485
1 555 1 cd170 58 Thermoanaerobacterium thermosaccharolyticum DSM 571
cd171 58 Thermoanaerobacterium thermosaccharolyticum M0795
1 cd172 58 Thermoanaerobacterium xylanolyticum LX-11
1 222 1 cd173 48 Thermodesulfobium narugense DSM 14796
1 333 1 cd174 53 Thermosediminibacter oceani DSM 16646

Noms méthode[modifier | modifier le wikicode]

17.8.19 Paris
Métode pour lister les génomes avec leur total tRNAs

- à partir de gtRNAdb copier sans le dessin dans .txt
- puis de celui-ci dans .ods
- garder les 2 colonnes des anti-codons et du nom
-copier la colonne des anti-codons dans .odt (non formaté)
- Remplacer $ (régulière) en *
- Puis ** en ;
- Puis * en rien
- copier le tout dans .txt
- Remplacer ; en \n
- copier le tout dans .ods
- limiter à une colonne avec des *
- puis =NBCAR(cellule)/3, (ou 4 si l’ant-codon est suivi d’un blanc)
- sauvegarder
- copier la colonne des noms dans une page vierge (pour ctrl+schift+fin)
- sélectionner la plage des noms sans déplacer le curseur
- Taper 5 dans la cellule haut gauche sans déplacer le curseur
- alt+entrée
- puis ctrl+schift+v
- cocher “ignorer les cellules vides”
- entrée
- entrer un symbole dans une cellule
- Dans la cellule vide au-dessus de la colonne
- “=concat($symbole$, 1er cellule de la colonne)
- entrée
- copier la cellule du concat
- sélectionner la plage, ctrl+schift+fin
- Remplacer 5 par concat (cocher cellule entière)
- sauvegarder: ctrl+x, ctrl+schift+v (décocher “ignorer cellules vides”
- trier la plage ordre croissant.
- La liste des noms est prête, remplacer le symbole par rien.
- Mettre cote à cote les 2 colonnes de noms et du nombre de tRNAs par génome

génomes bacilli[modifier | modifier le wikicode]

bc001bc004bc008bc014bc015bc025bc029bc034bc063bc065bc066bc067bc074bc090bc097bc125bc147bc158bc165bc244bc328bc384bc393bc413bc499bc655bc656bc657bc658bc659bc660

bc001[modifier | modifier le wikicode]

  • chromosome
bc001. Aerococcus urinae ACS-120-V-Col10a
bc001 rRNAs tRNAs
16s23s5s 444 60
16atcgca235-aac-acc
16atcgca235-22aas
16s23s5s-12aas
interc interc
203 16s 16 gaa
75 23s 12 ttc
13 5s 22 gac
34 aac 41 atgf
13 tcc 9 gaa
21 gaa 12 agc
14 gta 10 atc
12 gac 3 gga
7 ttc 17 gac
29 tac 11 atgf
27 tgg 18 tca
7 cac 9 atgi
74 caa 14 atgj
11 tgc 5 gca
12 ttg 4 cca
18 cgt
32 tta
11 ggc
8 aca
7 cta
4 aaa
10 gta
75 5s
165 23s
34 gca
75 atc
24 16s

bc004[modifier | modifier le wikicode]

  • chromosome
bc004. Amphibacillus xylanus NBRC 15112
bc004 rRNAs tRNAs
2*16s23s5s 666 56
16atcgca235-aac-acc
16s23s5s-atgf-gac
16s23s5s-9aas
16s23s5s-13aas
interc interc
388 16s 483 16s
186 23s 201 23s
4 5s 11 5s
3 gta 4 aac
21 aca 43 tcc
7 aaa 32 gaa
18 cta 31 atgf
45 ggc 26 gac
3 tta 7 ttc
4 cgt 28 tac
24 cca 11 tgg
9 gca 32 cac
6 caa
25 ggc
5 tgc
13 ttg

bc008[modifier | modifier le wikicode]

  • chromosome
bc008. Bacillus amyloliquefaciens IT-45
bc008 rRNAs tRNAs         
2*16atcgca235 10,10,10 95
2*16s23s5s
5*16s23s5s-21,16,9,9,5 aas
cgt gga 16s23s5s atgf gac
interc interc interc interc
170 16s 246 ttg 4 gca 16 cca
47 23s 7 tta 16 cca 32 cgt
23 5s 6 tgc 11 cgt 296 ggc
29 gta 53 ggc 14 tta 2 acc
37 aca 9 caa 24 ggc 45 aac
10 aaa 29 cac 6 cta 47 5s
9 ctg 10 tgg 36 aaa 170 23s
19 ggc 11 tac 5 aca 5 16s
9 tta 3 aca 23 gta
17 cgt 10 ttc 47 5s
4 cca 7 gac 170 23s
19 gca 7 atgf 9 16s
2 atgj 10 gta
7 atgi 36 gaa 4 gca 10 gac comp
19 tca 5 tcc 16 cca 19 atgf comp
7 atgf 9 aac 11 cgt 47 5s comp
10 gac 99 5s 14 tta 228 23s comp
20 ttc 228 23s 24 ggc 97 16s comp
8 cac 16 16s 6 cta 8 gga comp
15 gga 36 aaa 4 cgt comp
10 atc 5 aca
3 aac 23 gta
3 agc 47 5s
21 gaa 170 23s
9 16s

bc014[modifier | modifier le wikicode]

  • chromosome
bc014. Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19
bc014 rRNAs tRNAs      
4*16s23s5s 10,8,10 89
cgt-gga-16s23s5s-atgf-gac
16s°atcgca235
16s23s5s-x aas
16atcgca235-x aas
interc interc interc
3 gaa -2934 16s° 228 16s
3 agc 98 23s 47 23s
10 aac 9 5s 23 5s
15 atc 5 aac 5 gta
8 gga 36 tcc 36 aca
20 cac 10 gaa 6 aaa
10 ttc 7 gta 24 cta
6 gac 9 atgf 14 ggc
19 atgf 10 gac 11 tta
7 tca 3 ttc 16 cgt
2 atgi 11 aca 4 cca
20 atgj 10 tac 9 gca
4 gca 29 tgg
17 cca 9 cac
9 cgt 53 caa 170 16s
19 tta 6 ggc 47 23s
9 ggc 7 tgc 46 5s
10 ctg 245 tta 2 aac
37 aaa 16 ttg 342 acc
29 aca 32 ggc
23 gta 16 cgt
47 5s 4 cca
81 23s 20 gca
14 gca 7 atgj
96 atc
23 16s

bc015[modifier | modifier le wikicode]

  • chromosome
bc015. Bacillus amyloliquefaciens subsp. plantarum AS43.3
bc015 rRNAs tRNAs
3*16s23s5s 10,9,10 89      
16atcgca235
16s23s5s-21,16,9,7 aas
16s23s5s-atgf-gac
16s°atcgca235
interc interc interc
3 gaa 170 16s 170 16s
3 agc 97 23s 47 23s
10 aac 9 5s 23 5s
15 atc 5 aac 5 gta
8 gga 36 tcc 36 aca
20 cac 10 gaa 6 aaa
11 ttc 7 gta 24 cta
6 gac 7 atgf 14 ggc
19 atgf 10 gac 11 tta
7 tca 3 ttc 16 cgt
2 atgi 11 aca 4 cca
20 atgj 10 tac 9 gca
4 gca 29 tgg
17 cca 9 cac
9 cgt 52 caa 170 16s
19 tta 6 ggc 47 23s
9 ggc 7 tgc 46 5s
10 ctg 246 tta 2 aac
37 aaa 16 ttg 342 acc
29 aca 32 ggc
23 gta 16 cgt
47 5s 4 cca
170 23s 20 gca
21 16s 7 atgj

bc025[modifier | modifier le wikicode]

  • chromosome
bc025. Bacillus amyloliquefaciens TA208
bc025 rRNAs tRNAs   
2*16s23s5s 666 70
16atcgca235
cgt-gga-16s23s5s-atgf-gac
16s23s5s-x aas
interc interc
3 gaa 228 16s
3 agc 98 23s
10 aac 9 5s
15 atc 5 aac
9 gga 35 tcc
21 cac 10 gaa
11 ttc 7 gta
6 gac 11 atgf
19 atgf 12 gac
7 tca 3 ttc
2 atgi 11 aca
20 atgj 10 tac
4 gca 29 tgg
18 cca 9 cac
9 cgt 50 caa
20 tta 6 ggc
9 ggc 7 tgc
10 ctg 242 tta
37 aaa 16 ttg
29 aca
23 gta
47 5s
170 23s
21 16s

bc029[modifier | modifier le wikicode]

  • chromosome
bc029. Bacillus anthracis 2002013094
bc029 rRNAs tRNAs      
4*16s23s5s 11,11,11 112
2*16atcgca235
4*16s23s5s-20,19,11,9 aas
33aas-16s23s5s-atgf-gac
interc interc interc
139 16s 10 gca 3 gac comp
97 23s 5 ggc 12 atgf comp
4 5s 5 aaa 46 5s comp
4 gta 65 caa 141 23s comp
9 aca 17 tac 75 16s comp
22 cac 5 gta 1 gga comp
29 cta 24 gaa 4 cca comp
16 ggc 4 acc 3 cgt comp
3 tta 9 aac 16 tta comp
10 cgt 82 5s 29 ggc comp
16 cca 141 23s 14 cta comp
20 gca 9 16s 5 aaa comp
54 tca 87 caa comp
20 cta 1 gaa 46 gac comp
1 atgf 8 aac 4 gta comp
12 gac 11 atc 1 gaa comp
14 ttc 6 tgg 8 aac comp
10 aca 9 aca 11 atc comp
13 aaa 9 ttc 6 tgg comp
10 gga 4 gac 9 aca comp
7 atc 20 atgf 8 ttc comp
7 aac 54 tca 4 gac comp
20 agc 20 tca 20 atgf comp
16 gca 54 tca comp
10 ttg 10 cca 20 tca comp
14 tgc 3 cgt 16 gca comp
5 ggc 16 tta 10 cca comp
63 caa 29 ggc 3 cgt comp
19 cac 22 cta 16 tta comp
7 tgg 9 cac 29 ggc comp
17 tac 4 aca 13 cta comp
5 gta 4 gta 5 aaa comp
24 gaa 97 5s 87 caa comp
4 acc 141 23s 46 gac comp
9 aac 19 16s 4 gta comp
96 5s 8 gaa comp
141 23s 3 agc comp
11 16s 35 aac comp

bc034[modifier | modifier le wikicode]

  • chromosome
bc034. Bacillus anthracis BA1015
bc034 rRNAs tRNAs         
5*16s23s5s 10,10,10 94
16atcgca235-15aas
3*16s23s5s-22,20,9aas
11aas-16s23s5s-atgf-gac
interc interc interc interc
10 ttg 140 16s 1 gaa 3 gac comp
14 tgc 97 23s 8 aac 12 atgf comp
5 ggc 4 5s 10 atc 45 5s comp
63 caa 4 gta 6 tgg 141 23s comp
19 cac 9 aca 9 aca 75 16s comp
7 tgg 22 cac 8 ttc 1 gga comp
10 tac 29 cta 4 gac 4 cca comp
18 aca 16 ggc 20 atgf 98 cgt comp
9 ttc 3 tta 54 tca 16 ctc comp
3 gac 10 cgt 20 tca 5 aaa comp
24 atgf 15 cca 16 gca 88 caa comp
5 gta 20 gca 10 cca 46 gac comp
17 gaa 4 atgj 3 cgt 4 gta comp
2 tcc 17 atgi 16 tta 8 gaa comp
8 aac 27 tca 29 ggc 3 agc comp
96 5s 1 atgf 14 cta 13 aac comp
77 23s 12 gac 4 aaa
8 gca 14 ttc 11 caa 10 gca
130 atc 10 aca 8 tac 5 ggc
17 16s 13 aaa 5 gta 5 aaa
10 gga 97 5s 65 caa
7 atc 141 23s 17 tac
7 aac 20 16s 5 gta
6 agc 24 gaa
22 gaa 4 acc
9 aac
82 5s
141 23s
9 16s

bc063[modifier | modifier le wikicode]

  • chromosome
bc063. Bacillus atrophaeus 1942
bc063 rRNAs tRNAs   
16s23s5s 777 75
2*16atcgca235
16s23s5s-aac-acc
16s23s5s-atgf-gac
2*16s23s5s-21,16 aas
interc interc
176 16s 4 gaa
106 23s 3 agc
9 5s 17 aac
5 aac 15 atc
35 tcc 9 gga
10 gaa 24 cac
7 gta 14 ttc
38 atgf 39 gac
15 gac 36 atgf
5 ttc 6 tca
18 aca 2 atgi
10 tac 21 atgj
25 tgg 6 gca
9 cac 14 cca
47 caa 11 cgt
5 ggc 14 tta
6 tgc 42 ggc
673 tta 7 cta
16 ttg 37 aaa
41 aca
22 gta
54 5s
176 23s
21 16s

bc065[modifier | modifier le wikicode]

  • chromosome
bc065. Bacillus atrophaeus subsp. globigii BSS
bc065 rRNAs tRNAs   
3*16s23s5s 888 80
16s23s5s-atgf-gac
16s23s5s-aac-acc
3*16s23s5s-21,16,9 aas
interc interc
176 16s 4 gaa
106 23s 3 agc
9 5s 17 aac
5 acc 15 atc
35 tcc 9 gga
10 gaa 24 cac
7 gta 14 ttc
38 atgf 39 gac
15 gac 36 atgf
5 ttc 6 tca
18 aca 2 atgi
10 tac 21 atgj
25 tgg 6 gca
9 cac 14 cca
47 caa 11 cgt
5 ggc 14 tta
6 tgc 42 ggc
673 tta 7 cta
16 ttg 37 aaa
41 aca
176 16s 22 gta
54 23s 54 5s
22 5s 176 23s
30 gta 21 16s
37 aca
8 aaa
42 cta
14 ggc
9 tta
14 cgt
6 cca
9 gca

bc066[modifier | modifier le wikicode]

  • chromosome
bc066. Bacillus bombysepticus str. Wang
bc066 rRNAs tRNAs         
8*16s23s5s 13,13,13 95
4*16s23s5s-22,19,15,8 aas
12aas-16s23s5s-atgf-gac
interc interc interc interc
140 16s 140 16s 5 gaa 3 aac
96 23s 97 23s 7 agc 8 agc
8 5s 4 5s 7 aac 5 gaa
2 aac 4 gta 10 atc 25 gta
17 tcc 9 aca 13 gga 3 atgf
4 gaa 22 cac 10 aaa 87 gac
26 gta 29 cta 14 aca 5 caa
3 atgf 16 ggc 13 ttc 16 aaa
9 gac 3 tta 3 gac 93 ctc
18 ttc 10 cgt 27 atgf 4 cgt
10 aca 16 cca 62 tca 1 cca
7 tac 20 gca 4 atgi 75 gga
20 tgg 54 tca 20 atgj 140 16s
63 cac 20 tca 15 gca 44 23s
5 caa 3 atgf 10 cca 12 5s
14 ggc 8 gac 3 cgt 3 atgf
10 tgc 9 ttc 16 tta 174 gac
15 ttg 3 aca 29 ggc 14
10 tgg 22 cta
140 16s 8 atc 9 cac
86 23s 1 aac 4 aca
9 5s 19 gaa 4 gta
4 aac 97 5s
24 acc 140 23s
5 gaa 22 16s
17 gta
65 tac
5 caa
86 aaa
8 gca

bc067[modifier | modifier le wikicode]

  • chromosome
bc067. Bacillus cellulosilyticus DSM 2522
bc067 rRNAs tRNAs      
7*16s23s5s 10,10,10 83
16atcgca235-9aas
2*16s23s5s-16,16aas
interc interc interc
159 16s 303 16s 71 aaa
13 atc 67 23s 32 gaa
176 gca 8 5s 5 agc
67 23s 3 aac 1 aac
8 5s 11 tcc 32 atc
5 gta 150 gaa 39 gga
18 aca 261 gta 3 cgt
14 aaa 55 atgf 6 ggc
48 cta 33 gac 10 caa
25 ggc 10 ttc 19 cac
3 tta 62 aca 6 tgg
64 cgt 20 tac 28 tac
7 cca 23 tgg 5 gac
11 gca 10 cac 12 tca
7 caa 25 atgj
6 ggc 5 gca
30 tgc 67 5s
41 tta 316 23s
16 ttg 16 16s

bc074[modifier | modifier le wikicode]

  • chromosome
bc074. Bacillus cereus Al Hakam
bc074 rRNAs tRNAs   
5*16s23s5s 14,14,14 118
16s23s5s-atgf-gac
2*16atcgca235
5*16s23s5s-22,20,15,9,9 aas
13aas-16s23s5s
interc interc interc
1 gaa 10 ttg 10 gca
3 aac 14 tgc 9 cca
10 atc 5 ggc 3 cgt
3 tgg 65 caa 16 tta
16 aca 12 cac 29 ggc
10 ttc 14 tgg 13 cta
3 gac 10 tac 13 aaa
24 atgf 14 aca 5 aca
93 tca 9 ttc 4 gta
15 tca 3 gac 87 5s
14 gca 24 atgf 139 23s
10 cca 5 gta 9 16s
3 cgt 10 gaa
16 tta 5 tcc 140 16s
29 ggc 9 aac 98 23s
16 cta 92 5s 4 5s
4 aaa 140 23s 6 gta
11 caa 15 16s 9 aca
9 tac 24 cac
4 gta 45 5s comp 29 cta
98 5s 140 23s comp 16 ggc
140 23s 75 16s comp 3 tta
20 16s 1 gga comp 10 cgt
3 cca comp 14 cca
10 gca 92 cgt comp 16 gca
5 ggc 3 ctc comp 4 atgj
5 aaa 15 cta comp 17 atgi
65 caa 5 aaa comp 24 tca
16 tac 85 caa comp 2 atgf
5 gta 2 gac comp 11 gac
23 gaa 24 atgf comp 14 ttc
4 acc 5 gta comp 10 aca
8 aac 8 gaa comp 12 aaa
98 5s 3 agc comp 11 gga
141 23s 13 aac comp 4 atc
9 16s 8 aac
6 agc
22 gaa

bc090[modifier | modifier le wikicode]

  • chromosome
bc090. Bacillus cereus Q1
bc090 rRNAs tRNAs
7*16s23s5s 13,13,13 95         
16atcgca235
4*16s23s5s-22,20,15,9 aas
11aas-16s23s5s-atgf-gac
interc interc interc interc
141 16s 140 16s 6 gaa 3 aac dir
96 23s 97 23s 7 agc 8 agc dir
8 5s 5 5s 7 aac 4 gaa dir
2 aac 8 gta 10 atc 46 gta dir
17 tcc 11 tac 13 gga 87 gac dir
5 gaa 4 caa 10 aaa 5 caa dir
24 gta 14 aaa 14 aca 17 aaa dir
3 atgf 29 cta 12 ttc 97 ctc dir
9 gac 16 ggc 1 gac 4 cgt dir
18 ttc 3 tta 27 atgf 1 cca dir
10 aca 10 cgt 17 tca 75 gga dir
7 tac 15 cca 4 atgi 141 16s dir
19 tgg 20 gca 20 atgj 45 23s dir
63 cac 51 tca 16 gca 12 5s dir
5 caa 27 tca 10 cca 3 atgf dir
14 ggc 3 atgf 3 cgt 13 gac dir
10 tgc 9 gac 16 tta
15 ttg 9 ttc 29 ggc 140 16s
6 aca 22 cta 82 23s
10 tgg 9 cac 9 5s
8 atc 4 aca 4 aac
1 acc 4 gta 24 acc
20 gaa 98 5s 5 gaa
141 23s 17 gta
22 16s 65 tac
5 caa
5 aaa
10 ggc
9 gca

bc097[modifier | modifier le wikicode]

  • chromosome
  • RND: efflux RND transporter permease subunit
  • SprT: SprT family protein
  • K-ligase: lysine--tRNA ligase
  • CBS: CBS domain-containing protein
  • TsaE: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
  • gsp: group-specific protein
  • MgtC: MgtC/SapB family protein
  • HNH: HNH endonuclease
  • kinase: glycerate kinase
bc097. Bacillus cytotoxicus NVH 391-98
bc097 rRNAs tRNAs
5*16s23s5s 13,13,13 107
2*16atcgca235
12aas-16s23s5s-atgf-gac
5*16s23s5s-22,20,15,9,9aas
interc
comp 753 cds RND
dir 242 16s
dir 222 23s long interc
dir 4 5s dir 465 101 cds SprT
dir 9 gta dir 72 6 aac
dir 10 tac dir 91 6 agc interc
dir 5 caa dir 75 5 gaa dir 381 cds K-ligase
dir 13 aaa dir 76 35 gta dir 242 16s
dir 29 cta dir 76 74 gac dir 144 23s
dir 10 ggc dir 75 5 caa dir 4 5s
dir 3 tta dir 73 15 aaa dir 5 gta
dir 4 cgt dir 81 3 cta dir 10 aca
dir 10 cca dir 86 91 ctc dir 14 aaa
dir 14 gca dir 77 4 cgt dir 29 cta
dir 59 tca dir 77 1 cca dir 10 ggc
dir 19 tca dir 71 71 gga dir 3 tta
dir 3 atgf dir 1554 242 16s dir 8 cgt
dir 8 gac dir 2926 92 23s dir 10 cca
dir 14 ttc dir 116 10 5s dir 9 gca -
dir 6 aca dir 77 3 atgf
dir 11 tgg dir 76 176 gac
dir 9 atc dir 474 14 cds TsaE
dir 1 caa
dir 167 gaa
dir 20 cds CBS
< dir 273 cds gsp
comp 7 gaa
comp 4 agc interc
comp 4 aac comp 344 cds hp
comp 11 atc dir 242 16s
comp 13 gga dir 149 23s interc
comp 10 aaa dir 8 5s dir 218 cds hp
comp 14 aca dir 5 aac dir 242 16s
comp 9 ttc dir 12 tcc dir 145 23s
comp 1 gac dir 5 gaa dir 8 5s
comp 19 atgf dir 23 gta dir 4 aac
comp 17 tca dir 3 atgf dir 23 acc
comp 4 atgi dir 8 gac dir 5 gaa
comp 17 atgj dir 14 ttc dir 9 gta
comp 14 gca dir 9 aca dir 63 tac
comp 8 cca dir 7 tac dir 5 caa
comp 3 cgt dir 10 tgg dir 5 aaa
comp 10 tta dir 113 cac dir 10 ggc
comp 29 ggc dir 4 caa dir 97 gca
comp 18 cta dir 10 ggc dir 9 cds kinase
comp 9 cac dir 11 tgc
comp 5 aca dir 309 ttg
comp 4 gta dir 15 cds HNH
comp 144 5s
comp 237 23s
comp 366 16s
dir 22 cds MgtC

bc125[modifier | modifier le wikicode]

  • chromosome
  • Les blocs sont emboités. Ils sont tous 16s23s5s. Met avec atgj. Quand les blocs se suivent j’ajoute une ligne pour le 16s suivant.
    - Première boîte, les blocs sont tous 16s23s5s-xaas, 21 16 12 9.
    - Deuxième boîte, les blocs sont tous 16s23s5s-xaas, (14 10 12 9), sauf la boîte 12 qui est 10aas-16s23s5s-atgf-gac.
  • GlgB: 1,4-alpha-glucan branching protein GlgB
  • SIS: SIS domain-containing protein
  • kinase: kinase/pyrophosphorylase
  • exo III: exodeoxyribonuclease III
  • P3hi: 6-phospho-3-hexuloisomerase
  • MgtC: MgtC/SapB family protein
  • Y-rec: tyrosine-type recombinase/integrase
  • SprT: SprT family protein
  • TsaE: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
bc125.
bc125 rRNAs tRNAs
16s23s5s 12,12,12 123
2*16atcgca235
suite3-16s23s5s
10aas-16s23s5s-atgf-gac
7*16s23s5s-21,16,14,12,10,9,9
1ère bte
comp 466 cds GlgB
comp 5 gaa interc
comp 3 agc comp 808 cds SIS
comp 149 aac comp 17 aac interc
comp 4 atc comp 70 atc comp 517 cds kinase
comp 17 gga comp 9 tgc comp 4 atc
comp 22 cac comp 31 caa comp 9 gga dir 351 cds hp
comp 38 ttc comp 32 cac comp 7 tgg dir 307 16s
comp 3 gac comp 28 tac comp 24 tac dir 91 23s
comp 29 atgf comp 17 gac comp 15 tca dir 7 5s
comp 17 tca comp 104 tca comp 19 atgj dir 161 gta
comp 12 atgi comp 23 atgj comp 9 gca dir 19 aca
comp 19 atgj comp 17 cca comp 9 cca dir 9 aaa
comp 17 gca comp 12 cgt comp 5 tta dir 8 cta
comp 5 cca comp 11 ggc comp 8 ggc dir 5 ggc
comp 7 cgt comp 242 aaa comp 10 cta dir 13 tta
comp 5 tta comp 104 aca comp 186 aca dir 17 cgt
comp 9 ggc comp 4 gta comp 91 5s dir 18 cca
comp 9 cta comp 41 gaa comp 307 23s dir 9 gca
comp 163 aaa comp 91 5s comp 555 16s dir 16s suite2
comp 162 aca comp 284 23s comp 12 cds exo III
comp 8 gta comp 437 16s
comp 145 5s comp 16 cds P3hi
comp 286 23s
comp 506 16s
dir 21 cds MgtC
2ème bte
dir 271 cds hp dir 146 cds SprT
dir 284 16s interc dir 4 aac interc
dir 143 23s dir 254 cds hp dir 15 agc dir 307 16s suite2
dir 10 5s dir 142 16s dir 49 gaa dir 91 23s
dir 7 aac dir 144 23s dir 22 gac dir 7 5s
dir 18 tcc dir 10 5s dir 8 caa dir 161 gta
dir 4 gaa dir 26 aac dir 62 cta dir 19 aca
dir 20 gta dir 18 acc dir 60 ctc dir 9 aaa
dir 3 atgf dir 7 gaa dir 16 cgt dir 8 cta
dir 38 gac dir 176 gta dir 15 cca dir 5 ggc
dir 32 ttc dir 8 aca dir 106 gga dir 13 tta
dir 7 tac dir 46 tac dir 308 16s dir 17 cgt
dir 14 tgg dir 8 caa dir 91 23s dir 18 cca
dir 41 cac dir 56 aaa dir 165 5s dir 9 gca
dir 5 caa dir 6 ggc dir 3 atgf dir 16s suite3
dir 8 ggc dir 255 gca dir 155 gac
dir 6 tgc dir 10 cds arginase dir 12 cds TsaE
dir 132 ttg
dir 14 cds Y-rec

bc147[modifier | modifier le wikicode]

  • chromosome
bc147. Bacillus subtilis subsp. subtilis str. 168
bc147 rRNAs tRNAs      
3*16s23s5s encadrés 10,10,10 86
2*16atcgca235
cgt-gga-16s23s5s-atgf-gac
16s23s5s-21, 16, 9, 6aas
interc interc interc
16s 164 cgt 13 gaa 25
23s 55 gga 159 agc 3
5s 20 16s 167 aac 10
gta 4 23s 55 atc 15
aca 36 5s 13 gga 10
aaa 6 atgf 60 cac 17
cta 40 gac 4 ttc 12
ggc 14 gac 11
tta 9 16s 167 atgf 17
cgt 27 23s 111 tca 6
cca 9 5s 9 atgi 2
gca 170 aac 5 atgj 19
16s 164 tcc 34 gca 5
23s 55 gaa 9 cca 15
5s 9 gta 9 cgt 9
atgf 11 tta 14
16s 164 gac 12 ggc 5
23s 55 ttc 5 ctg 10
5s 46 aca 22 aaa 37
aac 4 tac 5 aca 32
acc 56 tgg 24 gta 20
ggc 30 cac 9 16s 55
cgt 27 caa 49 23s 167
cca 8 ggc 5 5s 21
gca 171 tgc 7
16s 164 tta 265
23s 55 ttg 16
5s 183
16s 164
23s 55
5s 6

bc158[modifier | modifier le wikicode]

  • chromosome
  • Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 22 20 15 9 9, sauf 14 avec 12aas-16s23s5s-atgf-gac.
  • lactate: L-lactate dehydrogenase
  • CBS: CBS domain-containing protein
  • SprT: SprT family protein
  • K-ligase: lysine--tRNA ligase
  • TsaE: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
  • DUF3884: DUF3884 family protein
  • kinase: glycerate kinase
bc158. Bacillus thuringiensis Bt407
bc158 rRNAs tRNAs
5*16s23s5s 14,14,14 142
2*16atcgca235
suite2-16s23s5s
5*16s23s5s-22,20,15,9,9aas
12aas-16s23s5s-atgf-gac
interc
comp 680 cds lactate interc
comp 6 gaa dir 113 cds hp
comp 7 agc dir 140 16s
comp 7 aac dir 97 23s
comp 10 atc dir 5 5s
comp 13 gga dir 8 gta
comp 10 aaa dir 11 tac
comp 14 aca dir 4 caa
comp 9 ttc dir 15 aaa
comp 3 gac dir 29 cta
comp 28 atgf dir 16 ggc
comp 17 tca dir 3 tta
comp 4 atgi dir 10 cgt
comp 20 atgj dir 15 cca
comp 15 gca dir 20 gca
comp 10 cca dir 53 tca
comp 3 cgt dir 19 tca
comp 16 tta dir 3 atgf
comp 29 ggc dir 8 gac
comp 22 cta dir 10 ttc
comp 10 cac dir 3 aca
comp 4 aca dir 10 tgg
comp 4 gta dir 8 atc
comp 97 5s dir 1 aac
comp 140 23s dir 129 gaa
comp 103 16s dir 20 cds CBS
comp 22 cds hp
interc
dir 113 cds SprT
dir 3 aac interc
dir 8 agc dir 372 cds K-ligase
dir 4 gaa dir 140 16s
dir 26 gta dir 97 23s
dir 3 atgf dir 4 5s
dir 86 gac dir 4 gta
dir 5 caa dir 13 aca
dir 17 aaa dir 14 aaa
dir 93 ctc dir 29 cta
dir 4 cgt dir 16 ggc
dir 1 cca dir 3 tta
dir 76 gga dir 8 cgt
dir 139 16s dir 9 cca
dir 46 23s dir 9 gca
dir 12 5s dir - 16s suite2
dir 3 atgf
dir 174 gac
dir 14 cds TsaE
interc
dir 112 cds hp
dir 139 16s
dir 97 23s interc
dir 8 5s dir 103 cds hp
dir 2 aac dir 140 16s
dir 17 tcc dir 86 23s
dir 4 gaa dir 9 5s
dir 26 gta dir 4 aac
dir 3 atgf dir 21 acc
dir 9 gac dir 5 gaa
dir 18 ttc dir 16 gta
dir 10 aca dir 65 tac
dir 7 tac dir 5 caa
dir 19 tgg dir 5 aaa
dir 63 cac dir 10 ggc
dir 5 caa dir 116 gca
dir 14 ggc dir 9 cds kinase
dir 10 tgc
dir 144 ttg
comp 15 cds DUF3884

bc165[modifier | modifier le wikicode]

  • chromosome
  • Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 20 15 9, sauf 14 avec 12aas-16s23s5s-atgf-gac.
  • DUF3884: DUF3884 family protein
  • CBS: CBS domain-containing protein
  • SprT: SprT family protein
  • kinase: glycerate kinase
  • TsaE: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
bc165. Bacillus thuringiensis MC28
bc165 rRNAs tRNAs
10*16s23s5s 15,15,15 78
16s23s5s-gaa
3*16s23s5s-20,15,9
12aas-16s23s5s-atgf-gac
interc
dir 139 cds hp
dir 141 16s
dir 97 23s interc
dir 4 5s dir 403 cds hp
dir 8 gta comp 141 16s
dir 12 tac comp 98 23s
dir 4 caa comp 8 5s
dir 18 aaa fin comp 2 aac
dir 31 cta deb comp 18 tcc
dir 16 ggc comp 4 gaa
dir 3 tta comp 26 gta
dir 10 cgt comp 3 atgf
dir 15 cca comp 11 gac
dir 20 gca comp 18 ttc
dir 56 tca comp 10 aca
dir 20 tca comp 7 tac
dir 3 atgf comp 19 tgg
dir 8 gac comp 63 cac
dir 10 ttc comp 5 caa
dir 6 aca comp 14 ggc
dir 10 tgg comp 10 tgc
dir 9 atc comp 152 ttg
dir 1 aac dir 15 cds DUF3884
dir 132 gaa
dir 20 cds CBS
interc
dir 114 cds SprT
dir 3 aac
dir 8 agc interc
dir 4 gaa dir 224 cds hp
dir 25 gta dir 141 16s
dir 3 atgf dir 86 23s
dir 87 gac dir 9 5s
dir 5 caa dir 4 aac
dir 16 aaa dir 22 acc
dir 98 ctc dir 5 gaa
dir 4 cgt dir 16 gta
dir 1 cca dir 65 tac
dir 76 gga dir 5 caa
dir 141 16s dir 5 aaa
dir 45 23s dir 10 ggc
dir 12 5s dir 117 gca
dir 2 atgf dir 9 cds kinase
dir 174 gac
dir 14 cds TsaE

bc244[modifier | modifier le wikicode]

  • chromosome
bc244. Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
bc244 rRNAs tRNAs   
4*16atcgca235 999 98
16atcgca235-5aas
2*16s23s5s
16s23s5s-6, 5aas
interc interc
cds 161 cds 298
gta 3 5s 68
gaa 138 23s 208
atgj 6 16s 436
tcc 8 cds -8
aac 7 cds 138
5s 69 gac 3
23s 126 gta 2
gca 69 cgt 35
atc 105 ggc 19
16s 547 cca 3
cds 7 aac 7
5s 68
cds 200 23s 208
gac 26 16s 501
gaa 3 cds 6
gta 2
cgt 35
ggc 36
5s 68
23s 208
16s 153
cds 5

bc328[modifier | modifier le wikicode]

  • chromosome
bc328. Listeria monocytogenes EGD
bc328 rRNAs tRNAs      
2*16s23s5s 666 67
2*16s23s5s-21,9
16atcgca235-14aas
16atcgca235-aac-acc
interc interc interc
16s 244 gaa 5 ttg 45
23s 80 agc 34 tgc 19
5s 13 aac 6 ggc 5
gta 8 atc 25 caa 29
aca 41 gga 23 cac 15
aaa 5 cac 28 tgg 7
cta 14 ttc 4 tac 20
ggc 21 gac 4 ttc 4
tta 12 atgf 42 gac 6
cgt 10 tca 22 atgf 21
cca 19 atgi 11 gta 56
gca 341 atgj 42 gaa 33
16s 244 gca 22 tcc 6
23s 80 cca 10 aac 14
5s 9 cgt 9 5s 80
tta 14 23s 172
ggc 15 gca 46
acc 24 cta 5 atc 127
aac 14 aaa 41 16s 16
5s 80 aca 8
23s 172 gta 13
gca 46 5s 81
atc 127 23s 244
16s 4 16s 21

bc384[modifier | modifier le wikicode]

  • chromosome
bc384. Paenibacillus mucilaginosus 3016
bc384 rRNAs tRNAs            
5*16s23s5s 14,14,14 175
9*16s23s5s-23 22 19
17 16 12 11 9 9
interc interc interc interc interc
cds 342 cds 677 cds 537 cds 373 cds 324
ctc 28 16s 268 16s 252 16s 260 16s 258
tcc 12 23s 95 23s 94 23s 168 23s 166
atgf 14 5s 55 5s 43 5s 9 5s 31
atgj 14 atc 19 atc 19 aac 6 aac 6
agc 8 gca 16 gca 17 tcc 38 tcc 38
tcg 4 gaa 9 gaa 8 gaa 11 gaa 11
acc 4 tac 20 gta 5 gta 17 gta 17
gca 119 aac 3 aca 10 atgf 13 atgf 15
ncRNA 36 gta 19 tac 18 gac 49 gac 67
cca 6 gac 20 aac 4 ttc 4 acg 11
cgt 104 ttc 15 gta 21 aca 13 cac 10
ggc 7 aaa 10 atgf 12 tac 8 caa 5
ctg 9 ctg 3 gac 34 tgg 13 aaa 17
aaa 9 ggc 12 cac 13 cac 26 ggc 40
caa 9 tgc 15 caa 8 caa 9 ggc 24
cac 17 cgt 5 aaa 17 ggc 12 ttg 5
gac 12 cca 158 ctc 13 tgc 10 cca 19
gta 4 gca 4 ctg 5 tta 20 gga 1
aac 15 acc 5 ggc 14 cgt 3 aga 187
tac 8 tcg 19 tgc 10 ttg 147 cds 16
aca 5 agc 17 cgt 5 cds 17
gaa 15 gtc 5 cca 105 cds 83
gcc 9 acg 39 cds 19 cds 797 gga 5
atc 54 tcc 41 16s 261 cca 16
5s 112 ctc 283 cds 298 23s 94 cgt 4
23s 258 cds 22 16s 254 5s 43 ggc 8
16s 403 23s 168 atc 11 cta 42
cds 23 cds 104 5s 15 gaa 5 aaa 8
ggg 5 agc 29 gtc 5 caa 9
cca 106 atgj 39 atgf 4 tgg 4
cgt 11 gta 15 tgg 9 atgf 5
ggc 5 atgf 14 caa 8 gtc 5
ctg 13 gac 48 aaa 18 gaa 11
ctc 16 ttc 5 ctg 4 atc 43
aaa 10 aca 9 ggc 11 5s 94
tac 28 tac 15 cgt 12 23s 255
ttc 12 aaa 183 cca 577 16s 306
5s 159 cds 9 cds 11 cds 12
23s 256
16s 537
cds 9

bc393[modifier | modifier le wikicode]

  • chromosome
bc393. Paenibacillus polymyxa SC2
bc393 rRNAs tRNAs
7*16s23s5s 14,13,13 165      
16s-gca-235
16s-5s-atcgca-23s-8aas
16s-5s-atcgca-23s-5s-11aas
3*16s23s5s-11, 17, 21 aas
interc interc interc
cds 392 cds 1 116 cds 726
16s 207 16s 207 gga 9
23s 76 23s 76 cca 22
5s 34 5s 82 cgt 5
atc 22 gca 4 ggc 10
gca 4 aac 3 cta 11
aac 34 tcc 19 aaa 4
atgj 3 gaa 9 caa 55
agc 31 gta 29 gta 11
gaa 6 atgf 25 gaa 11
gta 10 gac 13 acc 3
atgf 25 aca 4 aac 18
gac 50 tac 102 5s 76
ttc 22 caa 4 23s 129
aca 5 aaa 12 gca 20
tac 16 cta 10 atc 38
cac 18 ggc 5 5s 93
caa 4 cgt 12 16s 367
aaa 15 ttg 7 cds 13
ctg 6 cca 7
ggc 10 gga 1 133 cds 107
tgc 26 cds 17 cca 7
cgt 22 ttg 12
cca 9 cds 412 cgt 5
gga 204 16s 108 ggc 35
cds 21 5s 39 aaa 28
atc 20 gac 26
gca 128 atgf 30
23s 130 gta 9
agc 28 gaa 17
atgj 10 tcc 3
gta 4 aac 18
aca 19 5s 76
gac 77 23s 400
ttc 6 16s 493
tac 7 cds 11
aaa 154
cds 10

bc413[modifier | modifier le wikicode]

  • chromosome
bc413. Staphylococcus aureus 04-02981
bc413 rRNAs tRNAs   
16atcgca235 755 63
16atcgca-235-26aas
16s23s5s-6aas
5s-8aas-16s-atc-235
ctc-gga-16s23s5s
23s°5s
interc interc
ttg 38 5s 70 comp
gga 103 23s 468 comp
gga 7 16s 118 comp
tgc 5 gga 21 comp
caa 11 ctc 2 comp
cac 2
tgg 15 5s 12 direct
tac 5 gta 16 direct
aca 7 aca 6 direct
ttc 18 aaa 33 direct
gac 21 ggc 7 direct
atgf 14 tta 5 direct
tca 38 cgt 20 direct
gac 10 cca 23 direct
tca 9 gca 121 direct
atgi 28 16s 92 direct
atgj 21 atc 166 direct
gca 17 23s 70 direct
cca 9 5s 9 direct
cgt 18
tta 10 aaa 3
ggc 3 caa 9
cta 3 tac 29
aaa 5 gta 7
aca 16 gaa 1
gta 11 aac 10
5s 70 5s 70
23s 212 23s 468
gca 18 16s 6
atc 89
16s 28

bc499[modifier | modifier le wikicode]

  • chromosome
bc499. Streptococcus agalactiae 09mas018883
bc499 rRNAs tRNAs   
2*16-gca-235-aac 777 80
5*16-gca-235-17,15,12,9,4 aas
interc interc
16s 47 16s 47
gca 153 gca 155
23s 72 23s 72
5s 3 5s 3
gta 2 gta 2
gac 2 gac 2
aaa 9 aaa 9
cta 10 cta 10
aca 35 aca 28
ggc 8 atc 10
tta 11 gaa 13
cgt 7 tca 10
cca 15 atgf 2
atgj 19 ttc 11
atgi 15 tac 6
tca 10 tgg 14
atgf 2 cac 6
ttc 20 caa 10
gga 34 ttg 16
atc 13
agc 18 16s 47
gca 153
16s 47 23s 72
gca 153 5s 3
23s 72 gta 2
5s 3 gac 2
gta 5 aaa 9
gga 36 cta 10
atc 10 aca 35
gaa 13 ggc 8
tca 10 tta 11
atgf 2 cgt 7
ttc 11 cca 10
tac 6
tgg 14 16s 47
cac 6 gca 153
caa 10 23s 72
ttg 13 5s 3
gta 5
gga 36
atc 10
gaa 5

bc655[modifier | modifier le wikicode]

  • chromosome
  • permease: amino acid permease
  • PL17: 50S ribosomal protein L17
  • AraC: AraC family transcriptional regulator
  • MreC: rod shape-determining protein MreC
  • RaiA: ribosome-associated translation inhibitor RaiA
bc655. Streptococcus uberis 0140J
bc655 rRNAs tRNAs
2*16-gca-235-aac-cgt 555 59
16s-gca-235-17, 12, 7 aas
interc
dir 361 cds permease
dir 66 16s interc
dir 193 gca dir 592 cds PL17
dir 200 23s dir 66 16s
dir 15 5s dir 193 gca
dir 18 gta dir 200 23s
dir 73 gac dir 15 5s
dir 5 aaa dir 9 gta
dir 10 cta dir 31 gga
dir 13 aca dir 16 atc
dir 8 ggc dir 5 caa
dir 18 tta dir 10 tca
dir 3 cgt dir 21 atgf
dir 5 cca dir 17 ttc
dir 24 atgj dir 5 tac
dir 6 atgi dir 11 tgg
dir 10 tca dir 8 cac
dir 21 atgf dir 22 caa
dir 11 ttc dir 82 ttg
dir 32 gga <>dir 13 cds AraC
dir 7 atc
dir 69 agc
dir 18 cds MreC
interc
dir 83 cds hp
comp 16 gaa
comp 50 atc
comp 10 aca
comp 5 cta
comp 73 aaa
comp 18 gac
comp 15 gta
comp 200 5s
comp 193 23s
comp 66 gca
comp 345 16s
comp 8 cds RaiA

bc656[modifier | modifier le wikicode]

  • chromosome
  • SprT: SprT family protein
bc656. Terribacillus aidingensis MP602
bc656 rRNAs tRNAs
4*16s23s5s 888 56
16s23s5s-aac-acc
16atcgca235
11aas-16s23s5s-atgf-gac
16s23s5s-13aas
interc interc
dir 167 cds SprT dir 393 cds hp
dir 2 aac dir 173 16s
dir 8 agc dir 233 23s
dir 30 gaa dir 12 5s
dir 5 gac dir 1 aac
dir 16 caa dir 17 tcc
dir 77 aaa dir 20 gaa
dir 58 ctc dir 36 gta
dir 9 cgt dir 122 atgf
dir 35 cca dir 28 gac
dir 20 gga dir 8 ttc
dir 97 atc dir 1 tac
dir 173 16s dir 16 tgg
dir 288 23s dir 74 cac
dir 21 5s dir 5 ggc
dir 70 atgf dir 15 tgc
dir 45 gac dir 215 ttg
comp 13 cds hp <>dir 13 cds hp

bc657[modifier | modifier le wikicode]

  • chromosome
  • Met: methionine adenosyltransferase
  • integrase: site-specific integrase
  • K-ligase: lysine--tRNA ligase
  • ISL3: ISL3 family transposase
  • regulator: response regulator transcription factor
bc657. Tetragenococcus halophilus NBRC 12172
bc657 rRNAs tRNAs
16s23s5s 555 62
16s23s5s-aac
2*16s-gca-235-25, 8aas
16s23s5s-12aas
interc
comp 208 cds Met
comp 7 gaa
comp 24 agc dir 230 cds integrase
comp 19 atc comp 18 ttg
comp 9 gga comp 41 tgc
comp 4 ttc comp 11 caa
comp 43 gac comp 2 cac
comp 47 atgf comp 5 tgg
comp 16 tca comp 4 tac
comp 13 gaa comp 22 ttc
comp 17 atc comp 3 gac
comp 1 gga comp 13 gta
comp 40 gac comp 11 gaa
comp 47 atgf comp 47 tcc
comp 29 tca comp 5 aac
comp 16 atgi comp 78 5s
comp 22 atgj comp 218 23s
comp 14 gca comp 406 16s
comp 3 cca comp 12 cds hp
comp 13 cgt
comp 15 tta
comp 11 ggc
comp 11 aca
comp 13 cta
comp 2 aaa
comp 7 gta
comp 79 5s
comp 181 23s
comp 60 gca
comp 538 16s
comp 26 cds K-ligase
dir 40 cds ISL3
dir 69 rpr
comp 3 cca
comp 13 cgt
comp 15 tta
comp 11 ggc
comp 11 aca
comp 13 cta
comp 2 aaa
comp 7 gta
comp 82 5s
comp 181 23s
comp 60 gca
comp 596 16s
dir 9 cds regulator

bc658[modifier | modifier le wikicode]

  • chromosome
  • MFS: MFS transporter
  • Penol: phosphoenolpyruvate carboxylase
  • transferase: undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase
  • SigmaK: SigmaK-factor processing regulatory protein BofA
bc658. Thermobacillus composti KWC4
bc658 rRNAs tRNAs
16s23s5s 555 61
16s-5s-23s-atgf-ctc-ctg
2*16s-5s-atcgca-23s-9,5aas
16s-5s-23s-14aas
interc
dir 368 cds MFS
dir 101 16s
dir 63 5s comp 132 cds transferase
dir 21 atc comp 15 tac
dir 179 gca comp 10 ttc
dir 85 23s comp 21 gac
dir 3 aac comp 5 gta
dir 24 acc comp 156 atgj
dir 40 gaa comp 166 23s
dir 6 caa comp 22 gca
dir 9 aaa comp 63 atc
dir 133 cta comp 104 5s
dir 9 ggc comp 319 16s
dir 7 cgt comp 7 cds SigmaK
dir 157 gga
dir 11 cds Penol
dir 94 cds hp
comp 21 ttg
comp 15 cgt
comp 11 tgc
comp 6 ggc
comp 10 caa
comp 20 cac
comp 39 tgg
comp 89 aca
comp 37 gac
comp 41 atgf
comp 82 gta
comp 18 gaa
comp 6 tcc
comp 146 aac
comp 97 23s
comp 104 5s
comp 378 16s
comp 14 cds hp

bc659[modifier | modifier le wikicode]

  • chromosome
  • SprT: SprT family protein
  • B1: thiamine-phosphate kinase
  • ISL3: ISL3 family transposase
bc659. Virgibacillus sp. SK37
bc659 rRNAs tRNAs
4*16s23s5s 777 54
16atcgca235-aac-acc
12aas-16s23s5s-atgf-gac
16s23s5s-14aas
interc interc
dir 175 cds SprT dir 528 cds hp
dir 3 aac dir 329 16s
dir 7 agc dir 151 23s
dir 25 gaa dir 36 5s
dir 5 gac dir 2 aac
dir 263 caa dir 16 tcc
dir 17 aaa dir 4 gaa
dir 34 cta dir 24 gta
dir 58 ctc dir 46 atgf
dir 5 cgt dir 38 gac
dir 33 cca dir 21 ttc
dir 5 gga dir 22 tac
dir 226 atc dir 10 tgg
dir 309 16s dir 22 cac
dir 119 23s dir 3 caa
dir 180 5s dir 9 ggc
dir 131 atgf dir 7 tgc
dir 211 gac dir 219 ttg
dir 14 cds B1 dir 14 cds ISL3

bc660[modifier | modifier le wikicode]

  • chromosome
  • K-ligase: lysine--tRNA ligase
bc660. Weissella ceti WS08
bc660 rRNAs tRNAs
16atcgca235 766 75
16s23s5s
16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca
2*16atcgca235-17aas, 4aas-5s-aac
gga-16atcgca235-gta
interc
dir 434 cds K-ligase
dir 84 16s
dir 6 atc
dir 202 gca interc
dir 103 23s dir 452 cds hp
dir 4 5s dir 84 16s
dir 2 gta dir 6 other
dir 42 aaa dir 203 gca
dir 76 aca dir 90 23s
dir 8 tta dir 5 5s
dir 37 cgt dir 8 aac
dir 26 cca dir 82 acg
dir 24 atgj dir 33 gta
dir 35 tca dir 139 aca
dir 3 atgf dir 5 5s
dir 8 gac dir 63 aac
dir 40 ttc dir 7 cds hp
dir 17 gga
dir 17 gga
dir 16 gga
dir 4 gga
dir 42 atc
dir 71 agc
dir 19 cds hp

génomes clostridia[modifier | modifier le wikicode]

cd001cd002cd003cd011cd032cd045cd047cd063cd064cd079cd084cd092cd102cd112cd113cd114cd116cd118cd133cd136cd153cd155cd160cd161cd170

cd001[modifier | modifier le wikicode]

  • chromosome
cd001. Acetobacterium woodii DSM 1030
cd001 rRNAs tRNAs
3*16s23s5s 655 62
16s-gcaatc-235-6aas
5aas-16s-gcaatc-235-6aas
5s
interc interc
226 aaa 169 aaa
22 tac 23 tac
77 aca 163 aca
15 gac 15 gac
53 gaa 53 gaa
11 aac 11 aac
346 5s 346 5s
333 23s 330 23s
18 atc 18 atc
245 gca 92 gca
268 16s 8 16s
9 tgc
6 ggc
311 ttc
12 gac
13 gta

cd002[modifier | modifier le wikicode]

  • chromosome
cd002. Acetohalobium arabaticum DSM 5501
cd002 rRNAs tRNAs
16atcgca235 555 67
16atcgca235-6aas
3*16s23s5s-12,9,4 aas
interc interc
80 16s 109 16s
20 atc 109 23s
53 gca 28 v5s
109 23s 9 caa
27 5s 117 gaa
9 aac 5 gta
132 caa 3 gac
5 gta 8 aca
3 gac 17 aaa
8 aca 57 atgf
8 aaa 16 ttc
10 cta
30 cca 8 gga
56 gga 13 aga
17 atgf 12 cac
8 aaa
3 aca 109 16s
5 gac 109 23s
132 gta 28 5s
8 gaa 8 caa
28 caa 139 gaa
109 5s 7 tac
109 23s 4 ggc
9 16s

cd003[modifier | modifier le wikicode]

  • cd003   11,10,10 chromosome 110 tRNAs
3*16s23s5s
16-gca-2355
16-atc-235
3*16s23s5s-22,13,9aas
2*16-gca-235,22,13aas
beCoA: bifunctional enoyl-CoA hydratase/phosphate acetyltransferase
2pK:  two pore domain potassium channel family protein
Aspam:  aspartate aminotransferase family protein
cd003. Alkaliphilus metalliredigens QYMF
cd003 long inter
comp 1538 315 16s suite1
comp 74 8 gga
comp 76 13 aca
comp 77 12 gac long interc
comp 77 83 atgf dir 909 505 cds beCoA
comp 76 77 atgj dir 1538 61 16s
comp 76 9 ttc dir 76 290 gca
comp 77 5 atc dir 2938 179 23s
comp 77 6 cca dir 117 8 5s
comp 76 22 tgg dir 75 5 aac
comp 77 14 atgi dir 89 15 tta
comp 77 9 cca dir 76 5 atgf
comp 92 14 agc dir 77 9 atgj
comp 89 8 tca dir 75 8 gaa
comp 76 4 aaa dir 76 125 gta
comp 76 6 caa dir 77 69 gac
comp 77 8 aga dir 85 39 tac
comp 74 8 gga dir 83 321 cta
comp 76 13 aca dir 75 12 ggc
comp 77 125 gac dir 76 12 cac
comp 76 12 gta dir 75 4 tgc
comp 75 6 gaa dir 77 642 cgt
comp 76 68 atgf comp 261 14 cds hp
comp 117 126 5s
comp 2938 248 23s
comp 1538 589 16s
dir 819 22 cds 2pK
long interc
dir 819 135 cds 2pK
comp 74 36 gga long interc
comp 77 83 atgj comp 1422 126 cds Aspam
comp 76 77 atgf comp 76 9 ttc
comp 76 9 ttc comp 77 5 atc
comp 77 5 atc comp 76 4 aaa
comp 77 6 cca comp 75 27 ggc
comp 76 22 tgg comp 83 137 cta
comp 77 14 atgi comp 85 12 tac
comp 77 9 cca comp 76 13 aca
comp 92 14 agc comp 77 126 gac
comp 89 8 cta comp 76 12 gta
comp 76 4 aaa comp 75 6 gaa
comp 75 27 ggc comp 76 15 atgf
comp 83 84 cta comp 89 5 tta
comp 85 12 tac comp 75 8 aac
comp 76 13 aca comp 117 126 5s
comp 77 125 gac comp 2938 349 23s
comp 76 12 gta comp 1538 13 16s suite1
comp 75 6 gaa
comp 76 14 atgf comp 1538 378 16s suite2
comp 89 5 tta comp 76 9 ttc
comp 75 8 aac comp 77 4 atc
comp 117 179 5s comp 76 4 aaa
comp 2938 166 23s comp 76 6 caa
comp 76 61 gca comp 77 8 aga
comp 1538 23 16s suite2 comp 74 8 gga
comp 76 133 aca
comp 76 12 gta
comp 75 4 gaa
comp 117 161 5s
comp 2938 381 23s
comp 1538 472 16s
comp 387 9 cds hp

cd011[modifier | modifier le wikicode]

  • chromosome
cd011. Butyrivibrio proteoclasticus B316
cd011 rRNAs tRNAs
16s5s23s 666 51
16s5s23s-gac-aca
16s5s-atc-23s
agc-16s5s23s-6aas
tca-tcc-16s5s23s-5aas
16s5s-gca-23s-aac-gaa-tgc
interc interc
510 agc 59 tca
61 16s 156 tcc
256 5s 61 16s
76 23s 256 5s
34 gac 77 23s
30 gta 41 aac
6 aca 5 gaa
66 tac 36 atgi
6 atgf 57 gta
7 ttc 7 tta
61 16s
5 5s
212 gca
113 23s
43 aac
13 gaa
4 tgc

cd032[modifier | modifier le wikicode]

  • chromosome
  • tRNAs: 70 obsolète, c'est 93
cd032. Clostridium beijerinckii 59B
cd032 rRNAs tRNAs
7*16s23s5s 17,16,16 70
NCBI et gtRNAdb ne concordent pas.
2*16s23s5s-atgi-gca
16s23s5s-ttc-gac-gaa
2*16s23s-aac-5s
16s-atc-23s-aac
5s-ttc
16s-gca-23s5s
16235-aaa-cds-5s-aaa
16s-gcaatc-23s5s-ttc-tgc
interc long aas
190 250 cds direct
5 aaa comp
159 5s comp
294 316 cds comp
7 aaa comp
138 5s comp
339 23s comp
771 16s comp
2 371 cds comp
543 341 cds comp
140 16s direct
3 gca direct
111 atc direct
70 23s direct
5 5s direct
4 ttc direct
167 tgc direct
4 99 cds direct

cd045[modifier | modifier le wikicode]

  • chromosome
cd045. Clostridium botulinum BKT015925
cd045 rRNAs tRNAs
3*16s23s5s 10,10,10 87
16s23s5s-atgi-gca
16s23s5s-aaa
16s23s-aac-5s-aac
16s23s5s-ttc-5s-ttc-aaa
16s-gca-atc-235-6aas
gca-atc-gga-16s23s5s
16s-gca-atc-23s-aac
interc
61 gag
6 caa
4 aga
19 gga
16 cta
4 gaa
97 5s
94 23s
3 atc
74 gca
8 16s

cd047[modifier | modifier le wikicode]

  • chromosome
cd047. Clostridium botulinum CDC 297
cd047 rRNAs tRNAs
16s23s5s 554 53
16s23s5s-aac
16s23s5s-ttc
16s23s5s-aac-aac
16s5s-atgi-gca
interc long
3 gca
8 atgi
79 5s
117 16s
2 cds 108 pb

cd063[modifier | modifier le wikicode]

  • chromosome
  • SfsA: DNA/RNA nuclease SfsA
cd063. Clostridium novyi NT
cd063 rRNAs tRNAs
4*16s23s5s 10,10,10 81
16s23s-aac-5s-aac
16-gca-atc-23-aac
16s23s5s-ttc-5s-ttc-aaa
16s23s5s-aaa
16s23s5s-atgi-gca
16-gca-atc-235-6 aas
interc
comp 237 cds SfsA
comp 53 gag
comp 6 caa
comp 5 aga
comp 14 gga
comp 17 cta
comp 6 gaa
comp 24 5s
comp 127 23s
comp 3 atc
comp 80 gca
comp 405 16s
comp 8 cds hp

cd064[modifier | modifier le wikicode]

  • chromosome
  • sigmaK: pro-sigmaK processing inhibitor BofA
  • SfsA: DNA/RNA nuclease SfsA
cd064. Clostridium pasteurianum BC1
cd064 rRNAs tRNAs
16s23s5s 999 77
16s23s5s-atgi-gca
2*16s23s5s-aaa
16s23s5s-ttc
16-atc-235-ttc-tgc
16s23s5s-aac
atgi-gca-16s23s5s-aac
16s23s5s-5aas
long interc
dir 255 844 cds sigmaK
dir 1513 235 16s
dir 2907 118 23s
dir 117 26 5s
dir 75 62 gaa
dir 84 7 cta
dir 75 7 ggc
dir 74 3 gga
dir 77 509 aga
dir 693 5 cds SfsA

cd079[modifier | modifier le wikicode]

  • chromosome
cd079. Clostridium tetani 12124569
cd079 rRNAs tRNAs
16s23s5s-atgi-gca 546 53
16s23s5s-aaa
16s23s5s-ttc
16s-atc-23s
16s°-atc-235-atgi-gca
23s5s-aaa
interc long
200 2848 23s comp
66 atc comp
166 553 16s° comp
6 gca comp
6 atgi comp
107 117 5s comp
200 2822 23s comp
66 atc comp
3 1467 16s comp

cd084[modifier | modifier le wikicode]

  • chromosome
  • cds: MLMPSVAHFNIAPSMARRSLSLFAIHGIAILEHPCSLKTAQREKQNAKCESKDNEMAFKF
cd084. Dehalobacter restrictus DSM 9455 PER-K23
cd084 rRNAs tRNAs
2*16-gca-235 444 54
16s23s5s
16atcgca-cds-235

cd092[modifier | modifier le wikicode]

  • chromosome
  • cobI: cob(I)yrinic acid a,c-diamide adenosyltransferase
cd092. Desulfosporosinus acidiphilus SJ4
cd092 rRNAs tRNAs
5*16s23s5s 898 68
2*16atcgca235
16-gca-235
8aas-16s
comp 456 cds cobI
comp 4 tta
comp 11 tgc
comp 1 gga
comp 7 aac
comp 61 agc
comp 6 acc
comp 6 tca
comp 215 gac
comp 47 16s
dir 8 cds hp

cd102[modifier | modifier le wikicode]

  • chromosome
cd102. Eubacterium acidaminophilum DSM 3953
cd102 rRNAs tRNAs
2*16-gca-235 777 69
2*16s23s5s
2*16-gca-235-22,21aas
16s23s5s-8aas
interc long interc long interc long
356 1911 cds 415 1605 cds 196 828 cds
65 1534 16s 65 1534 16s 5 gga
34 gca 34 gca 27 ggc
93 2916 23s 93 2916 23s 79 cta
5 117 5s 5 117 5s 11 tac
17 aac 11 aac 6 aca
7 atgf 15 tta 6 gac
17 gaa 7 atgf 16 gta
5 gta 17 gaa 5 gaa
9 gac 5 gta 93 117 5s
5 aca 49 gac 82 2916 23s
7 tac 8 aca 510 1534 16s
9 gga 24 cta 8 888 cds
10 aga 9 ggc
8 caa 23 aga
34 aaa 9 caa
7 tca 11 aaa
25 ttc 24 tca
4 atgj 5 agc
29 atgi 7 cca
9 cca 25 atc
9 cac 40 atgi
8 aaa 6 tgg
16 tgc 47 cca
22 cta 6 atgi
88 cgt 34 ttc
22 279 cds 23 atgj

cd112[modifier | modifier le wikicode]

  • chromosome
  • tcc-16s-cds-235-19aas hp ci-dessous
    - MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT
  • 16s-cds-235 cds ci-dessous
    - MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT
  • tcg-16s23s-gca-5s-12aas
    - 50S ribosomal protein L32 ci-dessous
    - MAVPKRKTAKSATRSRRSANMKMTAKTLVKCSNCGEFALPHHVCAECGHYKGREVIAK
  • DUF2232: DUF2232 domain-containing protein
  • nucD: nucleoside deaminase
  • CDP-arc: CDP-archaeol synthase
  • PL32: 50S ribosomal protein L32
cd112. Filifactor alocis ATCC 35896
cd112 rRNAs tRNAs
16s23s-gca-5s-gta-tac-gga-cga 444 48
tcc-16s-cds-235-19aas
16s-cds-235
tcg-16s23s-gca-5s-12aas
interc interc
comp 403 cds DUF2232 comp 118 cds CDP-arc
comp 109 agg comp 57 tgg
comp 6 tgc comp 6 atc
comp 41 cac comp 13 cca
comp 9 atgi comp 26 agc
comp 14 atgj comp 16 aag
comp 4 ttc comp 18 aaa
comp 15 tca comp 63 gga
comp 4 aaa comp 10 tac
comp 10 caa comp 28 aca
comp 11 aga comp 5 gac
comp 6 ggc comp 35 gta
comp 6 cta comp 5 gaa
comp 28 aca comp 172 5s
comp 5 gac comp 62 gca
comp 35 gta comp 606 23s
comp 2 gaa comp 495 16s
comp 7 atgf comp 200 tcg
comp 8 tta Comp 14 cds PL32
comp 29 aac
comp 234 5s
comp 54 23s
comp 253 cds hp
comp 841 16s
comp 54 tcc
Comp 20 cds nucD

cd113[modifier | modifier le wikicode]

  • chromosome
  • pepb: peptidoglycan-binding protein
  • prepilin: prepilin-type N-terminal cleavage/methylation domain-containing protein
cd113. Finegoldia magna ATCC 29328
cd113 rRNAs tRNAs
16s-atc-235 444 48
16s23s5s
16s-gca-235-11 aas
16s-gca-235-18 aas
interc interc
dir 337 cds pepb dir 430 cds aminopeptidase
dir 42 16s dir 42 16s
dir 124 gca dir 124 gca
dir 43 23s dir 43 23s
dir 318 5s dir 193 5s
dir 3 aac dir 3 aac
dir 4 tta dir 4 tta
dir 26 atgf dir 129 atgf
dir 101 atgj dir 7 gaa
dir 7 gaa dir 41 gta
dir 41 gta dir 5 gac
dir 5 gac dir 23 aca
dir 23 aca dir 35 tac
dir 11 tac dir 5 gga
dir 39 ggc dir 7 aga
dir 875 cgt dir 4 gaa
dir 12 cds hp 4904 aas!! dir 5 aaa
dir 19 tca
dir 20 agc
dir 69 atgi
dir 0 ttc
dir 135 tgg
dir 86 cgg
comp 19 cds prepilin

cd114[modifier | modifier le wikicode]

  • chromosome
  • Alag: alanine--glyoxylate aminotransferase family protein
  • D-alanyl: D-alanyl-D-alanine carboxypeptidase
cd114. Halanaerobium hydrogeniformans
cd114 rRNAs tRNAs
16atcgca235 444 59
2*16atcgca235-acc
16s23s5s-13 aas
comp 184 cds Alag
comp 4 ggc
comp 48 tac
comp 8 gcc
comp 6 acc
comp 74 gac
comp 29 gta
comp 11 gaa
comp 11 agc
comp 12 atgj
comp 36 gga
comp 8 atgf
comp 20 aaa
comp 29 caa
comp 32 5s
comp 94 23s
comp 680 16s
comp 13 cds D-alanyl

cd116[modifier | modifier le wikicode]

  • chromosome
  • SppA : signal peptide peptidase SppA
  • MnmAa : tRNA 2-thiouridine(34) synthase MnmA assembly pathway, ATPase PilB
  • MnmA : tRNA 2-thiouridine(34) synthase MnmA
cd116. Halobacteroides halobius DSM 5150
cd116 rRNAs tRNAs
16s23s5s-aac 555 78
16s23s5s-caa-gaa-tac-ggc
16atcgca235-acc
16s23s5s-8 aas
16s23s5s-21 aas
interc
comp 381 cds hp
dir 95 16s
dir 89 23s
dir 76 5s
dir 22 caa
dir 54 gaa
dir 128 gta
dir 4 gac
dir 6 aca
dir 18 aaa
dir 4 gga
dir 150 cca
dir 8 cds SppA
comp 110 cds MnmAa
comp 131 riboswitch
comp 133 cac
comp 9 aga
comp 13 gga
comp 13 ttc
comp 4 atgf
comp 10 aaa
comp 18 gcc
comp 54 gta
comp 39 gaa
comp 133 cac
comp 9 aga
comp 7 gga
comp 13 cta
comp 13 ttc
comp 4 atgf
comp 6 aaa
comp 4 aca
comp 5 gac
comp 55 gta
comp 22 gaa
comp 76 caa
comp 90 5s
comp 95 23s
comp 404 16s
comp 21 cds MnmA

cd118[modifier | modifier le wikicode]

  • chromosome
  • blocs rares 16s5s-gcc-23s
cd118. Heliobacterium modesticaldum Ice1 ATCC 51547
cd118 rRNAs tRNAs
2*16s5s-gcc-23s 10,10,10 109
16s5s-gcc-23s-19aas
16s5s-gcc-23s-5aas
16s5s23s-aaa-acc-ctc
16s5s-atc-23s-aac
16s5s-atcgca-23s-aac-atgf
15aas-16s5s-atcgca-23s
cgg-tgg-16s5s-gcc-23s-5aas
ttc-cds-16s5s-atc-23s-aac-atgf
interc interc interc interc
541 cds 260 cds 219 cds 487 cds
253 16s 5 gac 236 23s 252 16s
64 5s 10 gta 6 gca 64 5s
234 gcc 4 gaa 64 atc 6 atc
119 23s 18 aaa 328 5s 229 gca
6 tcc 103 caa 505 16s 112 23s
10 ccg 237 23s 1 ggc 6 aac
14 gga 64 gcc 32 ctg 243 atgf
1 cac 328 5s 42 ccc 4 cds
9 tgc 651 16s 4 cgt
3 gtc 6 cds 120 ggc 155 cds
6 ttc 42 atgj 213 ttc
4 tac 439 cds 16 agc 563 cds
17 caa 237 23s 6 atgf 252 16s
4 aaa 64 gcc 7 aac 64 5s
5 gaa 328 5s 4 gaa 141 atc
5 gta 460 16s 18 aaa 100 23s
7 gac 5 tgg 4 caa 6 aac
43 agc 207 cgg 91 tac 102 atgf
30 ccc 3 cds 7 gtc 4 cds
3 ctg 325 tgc
4 ggc 464 cds 17 cds 704 cds
4 cgt 327 16s 252 16s
352 acc 226 5s 64 5s
20 cds 98 23s 194 atc
4 aaa 112 23s
8 acc 109 aac
89 ctc 2 cds
3 cds

cd133[modifier | modifier le wikicode]

  • chromosome
  • CwlD: N-acetylmuramoyl-L-alanine amidase CwlD
  • glycosyl: glycosyl transferase
  • B6: pyridoxal phosphate-dependent aminotransferase
  • anar: anaerobic ribonucleoside triphosphate reductase
  • anara: anaerobic ribonucleoside-triphosphate reductase activating protein
  • TIGR00159: TIGR00159 family protein
cd133.
cd133 rRNAs tRNAs
3*16s23s5s 9,10,10 85
2*16s-gca-235
16s23s-gga-5s
16s23s5s-43aas
16s23s5s-18aas
16s-gca-235-9aas
16s23s-aca
long interc long interc
1206 505 cds glycosyl 705 281 cds CwlD
1508 279 16s 1509 279 16s
2900 180 23s 2901 131 23s
117 6 5s 117 6 5s
75 6 aac 75 4 aac
86 15 tta 75 5 gaa
76 7 atgf 76 5 gta
75 9 gaa 77 10 gac
74 5 gga 75 14 aca
76 5 gta 85 9 tac
77 9 gac 74 10 gga
75 14 aca 77 9 aga
85 8 tac 76 11 caa
84 29 cta 76 2 aaa
77 7 aga 89 17 tca
76 88 caa 91 8 agc
89 3 tca 77 85 cca
76 6 ttc 76 60 tgg
77 11 atgj 77 6 cca
77 23 atgi 77 3 atc
77 7 cca 76 7 ttc
77 8 cac 77 114 atg 18
76 7 aaa 1391 68 16s
74 6 tgc 76 271 gca
75 5 aac 2900 126 23s
86 15 tta 117 213 5s
76 7 atgf 1185 372 cds B6
75 9 gaa 2352 21 cds anar
74 5 gga 540 776 cds anara
76 5 gta 1508 52 16s
77 9 gac 76 373 gca
75 14 aca 2900 126 23s
85 9 tac 117 7 5s
84 23 cta 75 5 aac
75 24 ggc 86 15 tta
77 9 aga 76 7 atgf
76 8 caa 75 14 gaa
76 2 aaa 74 5 gga
89 3 tca 76 5 gta
76 6 ttc 77 10 gac
77 11 atgj 75 9 ggc
77 17 atgi 74 975 aga
77 8 cac 840 10 cds TIGR00159
76 7 aaa
74 7 tgc
77 12 cgt
76 75 gta
414 43 cds hp

cd136[modifier | modifier le wikicode]

  • chromosome
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
  • Y-rec1: tyrosine-type recombinase/integrase
  • helix: helix-turn-helix domain-containing protein
  • SigB1: SigB/SigF/SigG family RNA polymerase sigma factor
  • xylose: xylose isomerase
  • NadR: transcription repressor NadR
  • A-1 chlor: type A-1 chloramphenicol O-acetyltransferase
  • SigB2: B/F/G family RNA polymerase sigma-70 factor
  • B6: pyridoxal phosphate-dependent aminotransferase
  • anar: anaerobic ribonucleoside triphosphate reductase
  • anara: anaerobic ribonucleoside-triphosphate reductase activating protein
  • pyruvate: pyruvate carboxylase
  • Phagep: phage portal protein
  • CwlD: N-acetylmuramoyl-L-alanine amidase CwlD
  • TIGR00159: TIGR00159 family protein
cd136. Peptoclostridium difficile M68
cd136 rRNAs tRNAs
3*16s23s5s 14,16,13 110
16s’-gca-23s°-16s°-23s 16s°-gca-23s’
16s23s-gga-5s
16s23s-aca
16s-cds-23s°-5s-43aas
cds-cds-23s°-5s-18aas
16s°-23s°-5s-9aas
16s23s5s-19aas 16s 14
16s23s5s-tta-atgi 16s’ 2
16s23s5s 16s° 5
16’-gca-235-tta-atgi 23s 10
23s5s 23s’ 3
16s 23s° 11
16s23s°-cds 5s 14
3*16s-23s°
16s°-23s°-23s’-5s
23s°-5s
16s°gca-23s°
long interc long interc
dir 774 179 cds SigB1
dir 645 214 cds Y-rec1 dir 1438 161 16s
dir 459 554 cds helix comp 117 201 5s
dir 1740 0 cds hp comp 2893 217 23s
dir 204 168 cds hp comp 1508 108 16s
dir 827 133 23s° comp 77 11 atgi
dir 117 7 5s comp 89 5 tta
dir 75 5 aac comp 117 201 5s
dir 75 6 gaa comp 2900 375 23s
dir 76 6 gta comp 76 52 gca
dir 77 12 gac comp 1264 100 16s’
dir 75 15 aca dir 1166 52 16s’
dir 85 10 tac dir 76 248 gca
dir 74 11 gga dir 596 100 23s°
dir 77 10 aga dir 577 321 16s°
dir 76 12 caa dir 2228 100 23s
dir 76 3 aaa dir 568 320 16s°
dir 89 19 tca dir 1633 100 23s°
dir 91 9 agc dir 2449 126 23s’
dir 77 86 cca dir 117 127 5s
dir 76 61 tgg dir 510 cds NadR
dir 77 6 cca
dir 77 4 atc comp 660 228 cds A-1 chlor
dir 76 8 ttc dir 1351 321 16s
dir 77 115 atgj 18 dir 488 101 23s°
dir 1198 1 16s comp 1420 250 23s°
dir 687 100 cds xylose comp 76 52 gca
dir 796 182 23s° comp 564 100 16s°
dir 117 7 5s comp 285 217 23s°
dir 75 7 aac comp 1508 179 16s
dir 86 16 tta >comp 446 386 cds SigB2
dir 76 8 atgf dir 1508 321 16s
dir 75 10 gaa dir 2900 181 23s
dir 74 6 gga dir 117 6 5s
dir 76 6 gta dir 75 6 aac
dir 77 10 gac dir 86 15 tta
dir 75 15 aca dir 76 7 atgf
dir 85 11 tac dir 75 9 gaa
dir 84 29 cta dir 74 5 gga
dir 77 8 aga dir 76 5 gta
dir 76 90 caa dir 77 9 gac
dir 89 4 tca dir 75 14 aca
dir 76 7 ttc dir 85 10 tac
dir 77 12 atgj dir 84 28 cta
dir 77 30 atgi dir 77 7 aga
dir 77 8 cca dir 76 89 caa
dir 77 9 aca dir 89 3 tca
dir 76 8 aaa dir 76 6 ttc
dir 74 7 tgc dir 77 11 atgj
dir 75 7 aac dir 77 29 atgi
dir 86 16 tta dir 77 7 cca
dir 76 8 atgf dir 77 8 cac
dir 75 10 gaa dir 76 353 aaa 19
dir 74 6 gga comp 117 126 5s
dir 76 6 gta comp 2036 582 23s'
dir 77 10 gac dir 1506 217 16s
dir 75 15 aca dir 2900 126 23s
dir 85 10 tac dir 117 216 5s
dir 84 25 cta comp 1185 372 cds B6
dir 75 25 ggc dir 2352 21 cds anar
dir 77 10 aga dir 540 778 cds anara
dir 76 9 caa dir 1537 261 16s
dir 76 3 aaa dir 2899 201 23s
dir 89 4 tca dir 117 5 5s
dir 76 7 ttc dir 89 11 tta
dir 77 12 atgj dir 77 108 atgi
dir 77 18 atgi dir 1508 184 16s
dir 77 9 cac dir 645 100 23s°
dir 76 8 aaa <dir 259 112 cds hp
dir 74 8 tgc comp 2110 375 23s’
dir 77 13 cgt comp 76 52 gca
dir 76 76 gta 43 comp 578 282 16s°
dir 414 308 cds hp dir 204 12 cds hp
dir 3432 cds pyruvate dir 1278 cds Phagep
dir 705 281 cds CwlD
dir 977 100 16s°
dir 1519 126 23s°
dir 117 7 5s
dir 75 6 aac
dir 86 15 tta
dir 76 7 atgf
dir 75 8 gaa
dir 74 4 gga
dir 76 5 gta
dir 77 10 gac
dir 75 9 ggc
dir 74 954 aga
dir 840 9 cds TIGR00159

cd153[modifier | modifier le wikicode]

  • chromosome
  • Glutl: glutamate--tRNA ligase
  • Polyamine: polyamine aminopropyltransferase
  • DUF1646: DUF1646 domain-containing protein
  • MFS:MFS transporter
  • ABC: ABC transporter permease
cd153. Symbiobacterium thermophilum IAM 14863 IAM14863
cd153 rRNAs tRNAs
2*16s23s5s 666 98
16s23s5s-gtg-gaa-cgg
2*16s23s5s-12aas
16s23s5s-13aas
interc interc
dir 463 cds Glutl comp 333 cds MFS
dir 212 16s comp 80 ccg
dir 46 23s comp 6 ccc
dir 58 5s comp 4 gcc
dir 3 aac comp 8 cac
dir 6 ggc comp 7 tgg
dir 95 atgj comp 5 cgg
dir 5 ttc comp 34 cgt
dir 6 tac comp 5 acc
dir 7 ggc comp 4 ctg
dir 116 gtc comp 47 ctc
dir 5 gac comp 5 gag
dir 3 ctg comp 112 cag
dir 18 atc comp 44 5s
dir 2 acg comp 281 23s
dir 145 tcg comp 914 16s
dir 12 cds Polyamine comp 12 cds ABC
dir 416 cds DUF1646
dir 280 16s
dir 46 23s
dir 6 5s
dir 5 aag
dir 25 gag
dir 5 atgj
dir 5 ttc
dir 6 tac
dir 7 ggc
dir 31 gcc
dir 19 gtc
dir 5 gac
dir 49 ctg
dir 3 acc
dir 9 atc
Dir 13 atgf

cd155[modifier | modifier le wikicode]

  • chromosome
  • permease: sulfate permease
  • HAMP: HAMP domain-containing protein
  • YunB: sporulation protein YunB
  • hCyst: 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase
cd155. Syntrophomonas wolfei subsp. wolfei str. Goettingen G311
cd155 rRNAs tRNAs
16atcgca235 533 48
16s23s5s
16s23s°23s5s
16s23s°23s5s-5s-5s
long interc
comp 1119 606 cds permease
dir 1706 -1607 16s
dir 104 1767 23s°
dir 3095 50 23s
dir 114 602 5s
dir 3084 0 cds HAMP
dir 660 232 cds YunB
dir 1656 -1583 16s
dir 107 1859 23s°
dir 3267 50 23s
dir 114 330 5s
dir 109 557 5s
dir 109 564 5s
dir 2277 0 cds hCyst

cd160[modifier | modifier le wikicode]

  • chromosome
  • 16-cds-atcgca-23s16s°5s cds 222 (1er bloc)
    - MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS
  • 16-cds-atcgca-23s16s°5s cds 222 (2ème bloc)
    - MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS
  • 16s-cds-16s°-23s-cds-5s le 1er cds 222 (3ème bloc)
    - MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS
cd160. Thermincola potens JR
cd160 rRNAs tRNAs
16-cds-atcgca-23s16s°5s 333 53
16-cds-atcgca-23s16s°5s
16s-cds-16s°-23s-cds-5s
long interc
<comp 411 185 cds hp
dir 1541 12 16s
dir 222 207 cds hp
dir 77 94 atc
dir 76 356 gca
dir 3168 -2889 23s
dir 102 3026 16s°
dir 117 89 5s
comp 1143 2 cds peptidase C45
long interc
comp 429 185 cds hp
dir 1541 12 16s
dir 222 207 cds hp
dir 77 94 atc
dir 76 186 gca
dir 3166 -2889 23s
dir 102 3026 16s°
dir 117 336 5s
comp 549 2 cds cytochrome c3
long interc
dir 1242 56 cds hp
comp 117 126 5s
dir 210 29 cds hp
comp 3168 -381 23s
comp 102 761 16s°
comp 222 12 cds hp
comp 1541 185 16s
dir 447 0 cds hp

cd161[modifier | modifier le wikicode]

  • chromosome
  • PS9: 30S ribosomal protein S9
  • tetra: tetratricopeptide repeat protein
  • SDR: SDR family oxidoreductase
  • DUF1657: DUF1657 domain-containing protein
cd161. Thermoanaerobacter brockii subsp. finnii Ako-1
cd161 rRNAs tRNAs
2*16s23s5s 444 57
16s-23s°-gca-atc-23s-16s°-5s-6aas
23s°-16s-16s°-23s-5s-aac-ggg
long interc
dir 393 324 cds PS9
dir 1622 -1554 16s
dir 106 1501 23s°
dir 76 1 gca
dir 77 64 atc
dir 3351 -3087 23s
dir 86 3032 16s°
dir 152 9 5s
dir 75 6 aac
dir 75 9 gaa
dir 76 25 atgi
dir 77 9 gac
dir 76 29 ttc
dir 75 254 acg
dir 1287 8 cds tetra
long interc
comp 738 128 cds SDR
comp 75 13 ggg
comp 75 10 aac
comp 109 32 5s
comp 3731 -350 23s
comp 86 331 16s°
comp 1790 -1696 16s
comp 447 1614 23s°
comp 264 2 cds DUF1657

cd170[modifier | modifier le wikicode]

  • chromosome
  • PS9: 30S ribosomal protein S9
  • HlyD: HlyD family efflux transporter periplasmicadaptor subunit
cd170. Thermoanaerobacterium thermosaccharolyticum DSM 571
cd170 rRNAs tRNAs
3*16s23s5s 555 58
16s23s5s-aac-ggg
16-gcaatc-235-6aas
interc
dir 353 cds PS9
dir 273 16s
dir 1 gca
dir 74 atc
dir 266 23s
dir 6 5s
dir 6 aac
dir 7 gaa
dir 18 atgi
dir 13 gac
dir 269 ttc
comp 186 acg
dir 8 cds HlyD

génomes negativicutes[modifier | modifier le wikicode]

en004en010en011en012

en004[modifier | modifier le wikicode]

  • chromosome Lactobacillus
en004. Lactobacillus salivarius UCC118
en004 rRNAs tRNAs            
16s23s5s 777 77
16atcgca235-9aas
2*16atcgca235-12aas
16235-19aas
16s23s5s-cds-tac-caa
16235-aac-gaa-acg
interc interc interc interc
331 cds 356 cds 3 caa 15 acg
103 16s 13 16s 151 tac 4 gaa
31 atc 244 23s 248 cds 5 aac
126 gca 5 5s 35 5s 240 5s
244 23s 3 gta 13 23s 13 23s
5 5s 65 aaa 2 16s 3 16s
14 aac 4 aca
14 tcc 12 ggc 527 cds 30 ttg
2 gaa 8 tta 103 16s 24 tgc
9 gta 6 cgt 31 atc 10 caa
25 gac 24 cca 126 gca 6 cac
4 ttc 16 atg 244 23s 12 tgg
12 tac 40 atg 5 5s 4 tac
6 tgg 10 tca 3 gta 25 ttc
11 cac 4 atg 15 aaa 9 gac
9 caa 9 gac 8 cta 2 gta
30 tgc 19 ttc 4 aca 14 gaa
149 ttg 8 gga 9 ggc 14 tcc
14 cds 3 atc 8 tta 5 aac
4 agc 47 cgt 244 5s
22 gaa 4 cgt 126 23s
4 atg 403 cca 31 gca
201 gac 11 cds 103 atc
19 cds 14 16s

en010[modifier | modifier le wikicode]

  • chromosome Negativicutes
en010. Pelosinus sp. UFO1
en010 rRNAs tRNAs
6*16s23s5s 16,15,14 99
3*16atcgca235
16-gca-235
16s23s5s-5s
16-gca-235-aac
16atcgca235-aac
16s23s5s-acc
16s-23s°
gga-5s-5aas-ncRNA-9aas
interc
212 gga
8 5s
5 aac
53 atg
14 cac
4 caa
44 agc
25 ncRNA
6 cgt
1 ttc
9 aca
11 tac
2 aaa
6 gaa
20 gta
3 gac
15 ggc

en011[modifier | modifier le wikicode]

  • chromosome Negativicutes
en011. Selenomonas ruminantium subsp. lactilytica TAM6421
en011 rRNAs tRNAs
4*16s23s5s 777 73
16-gcaatc-235-cac-tgg-agc
16-gcaatc-2355-13 aas
16s23s
interc
133 cds comp
87 16s
4 gca
168 atc
70 23s
4 5s
26 5s
24 aac
6 caa
8 aaa
7 gaa
6 aag
6 gta
39 gac
10 ttc
14 aca
18 gga
23 tta
55 ctg
102 ctc
15 cds

en012[modifier | modifier le wikicode]

  • chromosome Negativicutes
en012. Selenomonas sputigena ATCC 35185
en012 rRNAs tRNAs
16s23s5s 444 55
16-gca-atc-235
16s23s5s-cac-tgg
16s23s5s-12aas
interc
320 cds comp
27 ctc comp
31 ctg comp
10 tta comp
12 gga comp
8 aca comp
5 ttc comp
4 gac comp
61 gta comp
41 aag comp
4 aaa comp
18 caa comp
4 aac comp
174 5s comp
406 23s comp
159 16s comp
293 cds dir
24 cgt comp
74 atg comp
5 ggc comp
105 ggc comp
15 cds comp