Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Proteobacteria

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Fiche mémoire sur Proteobacteria
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Fiche : Proteobacteria
Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Proteobacteria
 », n'a pu être restituée correctement ci-dessus.


  • Fiche en préparation

Paris le 12.12.19

Gamma[modifier | modifier le wikicode]

gamma blocs[modifier | modifier le wikicode]

  • Lien tableur: gamma blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
Gamma blocs
lien blocs 16s total aas avec sans total page Gm001-47 Notes
gm0001 atgf-16atcgca235 2 54 3 51 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235 sans 27 11 1 4 avant
gac-tgg 1 0 3 3*atgf-16atcgca235
gm0003 atgf-16atcgca235 2 51 3 48 gac 1 3 cgg-cac-cca-16atcgca2355-gac-tgg
16atcgca235 acc-5s cgg-cac-cca-16atcgca235
tgg 2*cgg-cac-cca-16gaa2355-gac-tgg
gm0005 atgf-16atcgca235 2 50 3 47 51 total 0 29 0 14 1 0 7
16atcgca235 incomplets
16gaa23?
gm0017 16atcgca235 +5s 1 63 2 61
différents
gm0036 6*16atcgca235 6 70 12 58 16gaa235-acc
16atcgca235-acc
gm0037 6*16atcgca235 6 72 12 60
5s en trop
gm0039 2*16atcgca235 6 64 14 50 16atcgca2355-gac-tgg
3*16gaa235 cgg-cac-cca-16atcgca2355-gac-tgg
cgg-cac-cca-16atcgca2355-gac-tgg 2*cgg-cac-cca-16gaa2355-gac-tgg
5s
gm0040 16atcgaa235 6 64 16 48
cgg-cac-cca-16gaa2355-gac-tgg
4*16atcgca235
gm0043 16atcgca235 6 61 14 47
cgg-cac-cca-16atcgca235
16atcgca2355-gac-tgg
3*16gaa235
gm0045 2*16gaa235 6 60 14 46
cgg-cac-cca-16gaa2355-gac-tgg
3*16atcgca235
gm0047 3*16gaa235+16gaa23? 11 129 20 109
3*16gaa235-gac
16atcgca235
16atcgca235-gac
16atcgca235-acc
16gaa235-acc 54
lien blocs 16s total aas avec sans total page Gm055-64 Notes
gm0055 3*16gaa235 131 17 114 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235 sans 4 10 11 1 avant
2*16atcgca235-gac gac-tgg 1 0 1 cgg-cac-cca-16atcgca235-x-tgg
16gaa235-acc gac 2 6 2 cgg-cac-cca-16atcgca235
16gaa235-acc-5s acc-5s 2 1
16gaa235-gac 9 tgg différents
41 total 4 15 0 18 2 0 2 2*16gaa235-acc
gm0056 3*16gaa235 111 17 94 16atcgca235-acc
3*16gaa235-gac 16gaa235-tca
16atcgca235
16atcgca235-acc-5s 5s en trop
16atcgca235-acc 9 16atcgca2355-gac-tgg
gm0057 3*16gaa235 103 18 85
2*16gaa235-gac
2*16atcgaa235-gac
16gaa235-tca
16atcgaa235-acc-5s
16gaa235-acc 10
gm0058 2*16atcgca235 52 13 39
2*16gaa235
cgg-cac-cca-16atcgca235-x-tgg
16s23s5s 6
gm0062 4*16atcgca235 60 17 43
cgg-cac-cca-16atcgca235
16atcgca2355-gac-tgg 6
gm0063 2*16s23s5s 43 2 41
16atcgca235 3
gm0064 16atcgca235 2 45 2 43
16s23s5s 45
lien blocs 16s total aas avec sans total page Gm065-73 Notes
gm0065 2*16atcgca235 2 48 4 44 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
sans 11 8 2 6 autres
gm0066 2*16s23s5s 104 26 78 gac-tgg 1 1 16gcc235-gac-tgg
2*16s23s5s-gac gac 4 1 1 2 16 atc-gcc 235-gac
16s23s5s-acc-5s acc-5s 2 16-gaa-aaa-gta-235
16atcgca235 tgg 1 16-gaa-aaa-gta-235-gac
16atcgca235-gac 40 total 17 9 2 2 0 10 0 16-gaa-aaa-gta-235-tgg
16gcc235-gac-tgg 16-gaa-aaa-gca-gta-235
16-gaa-aaa-gta-235 4*16-gca-cca-235
16-gaa-aaa-gta-235-gac
16-gaa-aaa-gta-235-tgg incomplets
16-gaa-aaa-gca-gta-235 12 16s-gaa-aaa-gta-5s
gm0067 2*16235-gac 91 14 77 à l’envers
16 atc-gcc 235-gac 2*5s-23s-16s
16gaa235-gac-tgg
16gaa235-gac
16235-acc-5s
16s-gaa-aaa-gta-5s 7
gm0068 2*16atcgca235 2 49 4 45
gm0069 3*16atcgca235 3 54 6 48
gm0070 2*16s23s5s 68 6 62
3*16-gca-cca-235 5
gm0071 16-gca-cca-235 5 57 2 55
4*16s23s5s
gm0073 2*16-gca-atc-235 5 54 4 50
2*5s-23s-16s
16s23s5s5s 41
lien blocs 16s total aas avec sans total page Gm079-129 Notes
gm0079 2*16-gca-atc-235 5 77 10 67 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16-gca-atc-2355 sans 2 13 3 3 1 avant
2*5s-23s-cp(atc-gca)-16s gac-tgg 2 1 cgg-cac-cca-16atcgca235
gac 1 1
gm0086 6*16atcgca235 12 70 12 58 acc-5s incomplets
gm0087 6*16atcgca235 66 12 54 tgg 1 2 16gaa23
30 total 2 17 3 7 0 0 1 2*16atcgca23
gm0090 2*16gaa235 6 58 15 43 2*16s23s
16gaa235-gac-5s
cgg-cac-cca-16atcgca235 à l’envers
16atcgca235-gac-tgg 2*5s-23s-cp(atc-gca)-16s
16atcgca235
autres incomplets
gm0094 16gaa23+5s 1 38 1 37 gaa-23s5s-gac
gm0098 16atcgca23+gaa-5s 1 32 3 29 5s en trop
16-gca-atc-2355
gm0114 16gaa235 2 40 4 36 16gaa235-gac-5s
16gaa235-gac-tgg 2*5s
gaa-5s
gm0115 16atcgca23+5s 1 41 2 39 atc-5s-aaa
gm0119 16s23s 1 27 0 27
gm0126 16s23s + atc-5s-aaa 1 33 2 31
gm0127 2*16gaa235-tgg 3 45 7 38
16atcgca235-tgg
gm0128 2*16s23s5s 3 37 4 33
16atcgca235-gac-tgg
gm0129 16atcgca235-gac 1 42 5 37
gaa-23s5s-gac 37
lien blocs 16s total aas avec sans total page Gm131-150 Notes
gm0131 16gaa235 40 3 37 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16s23s5s sans 2 16 9 1 autres
16gaa23-tgg 3 gac-tgg 1 3 16-atc-235
gac 3
gm0137 16-atc-235 1 33 1 32 acc-5s 2 1 incomplets
tgg 16gaa23-tgg
gm0140 16atcgca235 2 33 3 30 38 total 2 19 0 16 0 1 0 16atcgca
16gaa235 2*16s
gm0141 16atcgca235 1 37 2 35
gm0142 16atcgca235+16atcgca 5 57 7 50
16gaa235-gac-tgg+2*16s
gm0143 2*16atcgca235 83 14 69
16atcgca235-acc-5s
2*16gaa235
16gaa235-gac-tgg
16gaa235-gac 7
gm0147 3*16atcgca235 3 49 6 43
gm0148 5*16atcgca235 5 70 10 60
gm0149 3*16gaa235 84 14 70
16atcgca235-acc-5s
16atcgca235-gac-tgg
16atcgca235
16s23s5s
16gaa235-gac 8
gm0150 2*16gaa235 84 13 71
16gaa235-gac-tgg
16gaa235-gac
2*16atcgca235 7
16gaa235-acc-5s 42
lien blocs 16s total aas avec sans total page Gm151-169 Notes
gm0151 2*16gaa235 87 14 73 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16gaa235-gac sans 13 5 9 autres
2*16atcgca235 gac-tgg 2 1 7*16-gca-cds-235
16gaa235-gac-tgg gac 1 2 16-atc-235
16atcgca235-acc-5s 7 acc-5s 2 1 16-atc-235
tgg
gm0152 7*16-gca-cds-235 89 10 79 36 total 0 18 0 9 0 9 0 différents
16-atc-2355-tac 16-atc-2355-tac
16-atc-235 9
incomplets
gm0155 16atcgca235 44 2 42 16atcgca23
gm0158 16atcgca23+5s 43 2 41
gm0161 16atcgca235 3 39 2 37 cds
7*16-gca-cds-235
gm0162 2*16gaa235 85 14 71
16gaa235-gac 5s en trop
16gaa235-acc-5s 5s
16atcgca235-gac-tgg 16-atc-2355-tac
2*16atcgca235 7
gm0166 2*16atcgca235 86 16 70
16atcgca235-gac-tgg
16-atc-235
16atcgca235-acc-5s
16atcgca235-gac
16gaa235 7
gm0167 16atcgca235 1 36 2 34
gm0168 16atcgca235 1 36 2 34
gm0169 3*16atcgca235 3 47 6 41
38
lien blocs 16s total aas avec sans total page Gm170-182 Notes
gm0170 3*16gaa235 76 13 63 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235 sans 8 18 différents
16gaa235-gac gac-tgg 3 2 2*16gaa235-gac-gac
16atcgca235-gac-tgg gac 3
16gaa235-acc-5s 7 acc-5s 3 2
tgg
gm0173 3*16gaa235 91 14 77 39 total 0 14 0 25 0 0 0
16atcgca235
16gaa235-gac
16atcgca235-acc-5s
16atcgca235-gac-tgg 7
gm0175 2*16atcgca235 2 53 4 49
gm0177 3*16gaa235 95 15 80
2*16atcgca235
16gaa235-gac
16gaa235-gac-tgg
16atcgca235-acc-5s 8
gm0178 5*16gaa235 96 15 81
16gaa235-gac-gac
16atcgca235-gac-tgg
16atcgca235-acc-5s 8
gm0180 4*16gaa235 96 14 82
16gaa235-gac-gac
16atcgca235
16gaa235-gac-tgg
16gaa235-acc-5s 8
1
gm0182 16atcgca235 41 43 2 41
lien blocs 16s total aas avec sans total page Gm183-202 Notes
gm0183 4*16gaa235 90 15 75 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235-gac sans 3 6 14 différents
16atcgca235 gac-tgg 5 16s23s5s-acc-5s-acc-5s
16atcgca235-gac-tgg gac 5 16gaa235-ttc
16s23s5s-acc-5s-acc-5s 8 acc-5s 4
tgg 5s en trop
gm0185 2*16gaa235 85 15 70 37 total 3 16 0 18 0 0 0 16s23s5s-acc-5s-acc-5s
16atcgca235-gac
16gaa235-ttc
16s23s5s
16atcgca235-gac-tgg
16atcgca235
16gaa235-acc-5s 8
gm0190 3*16gaa235 90 14 76
16s23s5s
16atcgca235-gac
16gaa235-acc-5s
16atcgca235
16atcgca235-gac-tgg 8
gm0198 2*16atcgca235 89 15 74
16atcgca235-gac
2*16gaa235
16gaa235-acc-5s
16atcgca235-gac-tgg
16s23s5s 8
gm0202 3*16gaa235 83 14 69
16gaa235-acc-5s
16atcgca235-gac
16atcgca235 7
16atcgca235-gac-tgg 39
lien blocs 16s total aas avec sans total page Gm203-211 Notes
gm0203 3*16gaa235 87 14 73 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235-gac sans 2 6 15 différents
16gaa235-acc-5s gac-tgg 4 1 16gaa235-ttc
16atcgca235 gac 4 1
16atcgca235-gac-tgg 7 acc-5s 1 3 incomplets
tgg 16s-atc-gca-tgg
gm0204 3*16gaa235 89 18 71 37 total 2 15 0 20 0 0 0 16s-23s°-5s-gac
16atcgca235-acc-5s
16atcgca235
16atcgca235-gac-tgg
16s-atc-gca-tgg
16s23s5s
16gaa235-gac
16s-23s°-5s-gac 10
gm0205 4*16gaa235 88 15 73
16gaa235-acc-5s
16atcgca235-gac
16gaa235-ttc
16s23s5s
16atcgca235-gac-tgg 9
gm0206 3*16atcgca235 79 15 64
16gaa235
16gaa235-gac-tgg
16atcgca235-gac
16gaa235-acc-5s 7
gm0211 4*16gaa235 78 13 65
16atcgca235-gac-tgg
16atcgca235-gac 7
16atcgca235 40
lien blocs 16s total aas avec sans total page Gm212-319 Notes
gm0212 2*16atcgca235 76 14 62 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16gaa235-gac-tgg sans 9 16
2*16gaa235 gac-tgg 2 4
16atcgca235-acc-5s 7 gac 4 1
16gaa235-gac acc-5s 4 2
tgg
gm0214 3*16gaa235 78 14 64 42 total 0 19 0 23 0 0 0
16atcgca235
16atcgca235-gac-tgg
16gaa235-acc-5s
16atcgca235-gac 7
gm0215 16atcgca235 82 15 67
3*16gaa235
16atcgca235-gac-tgg
16atcgca235-acc-5s
16atcgca235-gac 7
gm0216 2*16gaa235 89 14 75
2*16atcgca235
16atcgca235-gac
16gaa235-gac-tgg
16gaa235-acc-5s 7
gm0309 3*16gaa235 86 13 73
2*16atcgca235
16atcgca235-acc-5s
16gaa235-gac-tgg 7
gm0319 3*16gaa235 89 14 75
16atcgca235-gac
16atcgca235-acc-5s
16atcgca235 7
16gaa235-gac-tgg
42
lien blocs 16s total aas avec sans total page Gm320-361 Notes
gm0320 16s23s5s-5s 122 11 111 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235 sans 1 27 5 1 4 avant
16s23s5s-gac gac-tgg 2 3*agc-gta-16atcgca235
16atcgca235-acc gac 1 1 cgg-cac-cca-16gaa235
16s23s5s-tgg acc-5s
16atcgca235-gac tgg 1 autres
16s23s5s-acc 7 43 total 3 28 0 7 0 1 4 16atcgca-cds-2355
gm0321 3*16atcgca235+5s 39 6 33 différents
gm0322 3*16atcgca235+5s 39 6 33 16atcgca235-acc
gm0323 3*16atcgca235+5s 9 39 6 33 16s23s5s-acc
gm0324 2*16atcgca235+5s 40 8 32
agc-gta-16atcgca235 3
gm0326 2*16atcgca235+5s 41 8 33 cds
agc-gta-16atcgca235 3 16atcgca-cds-2355
gm0333 3*16atcgca235+5s 3 39 6 33 5s en trop
16gaa2355-gac-tgg
gm0334 2*16atcgca235+5s 40 8 32 16atcgca-cds-2355
agc-gta-16atcgca235 3 16s23s5s-5s
8*5s
gm0335 3*16atcgca235+5s 3 39 6 33
gm0359 4*16atcgca235 4 76 8 68
gm0360 16atcgca235 54 8 46
16gaa235-gac-tgg
16gaa235
16atcgca-cds-2355 4
gm0361 4*16gaa235 59 11 48
16gaa235-5s-gac-tgg 6
cgg-cac-cca-16gaa235 45
lien blocs 16s total aas avec sans total page Gm363-392 Notes
gm0363 3*16atcgca235 53 9 44 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16gaa235-gac-tgg 4 sans 8 30 2 10 1 1 avant
gac-tgg 2 2 1 cgg-cac-cca-16-gaa-cds-235
gm0364 4*16atcgca235 4 55 8 47 gac 1
gm0365 6*16atcgca235 6 60 12 48 acc-5s 1 autres
tgg 16-gaa-cds-23555-gac-tgg
gm0366 3*16atcgca235 5 62 10 52 59 total 8 32 2 14 0 2 1 16-gaa-cds-235
2*16-gca-atc-235
gm0367 4*16s23s5s 4 50 0 50 différents
16gaa23-cds-5s-5s
gm0368 2*16atcgca235 6 50 11 39
16atcgca235-5s-gac-tgg cds
3*16gaa235 cgg-cac-cca-16-gaa-cds-235
16-gaa-cds-23555-gac-tgg
gm0369 3*16atcgca235 6 59 14 45 16-gaa-cds-235
cgg-cac-cca-16-gaa-cds-235 16gaa23-cds-5s-5s
16-gaa-cds-23555-gac-tgg
16-gaa-cds-235 5s en trop
16atcgca2355-gac-tgg
gm0386 4*16gaa235 6 57 8 49 16gaa2355-gac-tgg
16gaa23-cds-5s-5s 16-gaa-cds-23555-gac-tgg
16gaa235-5s-gac-tgg 16gaa23-cds-5s-5s
gm0390 3*16gaa235 8 94 15 79
2*16atcgca235
16atcgca235-gac-tgg
16gaa235-acc-5s
16gaa235-gac
gm0391 5*16atcgca235 5 69 10 59
gm0392 4*16s23s5s 6 61 4 57
2*16atcgca235 60
lien blocs 16s total aas avec sans total page Gm393-409 Notes
gm0393 4*16atcgca235 4 71 8 63 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
sans 6 19 8 1 avant
gm0394 4*16s23s5s 6 65 4 61 gac-tgg 1 1 aaa-16atcgca235
2*16atcgca235 gac 2 2
acc-5s 1 1 1 incomplets
gm0396 16atcgca235 2 48 2 46 tgg 16s
16235 43 total 7 23 0 12 0 0 1
autres incomplets
gm0397 16atcgca235 2 45 5 40 23s5s
aaa-16atcgca235 atc-gca-235-gac-tgg
gm0398 4*16atcgca235 4 57 8 49
gm0400 2*16atcgca235 2 42 4 38
gm0401 2*16atcgca235 7 85 15 70
16gaa235 + 23s5s
2*16gaa235-gac
16gaa235-gac-tgg
16atcgca235-acc-5s
gm0402 3*16gaa235 8 87 14 73
16atcgca235-gac
16gaa235-acc-5s
16s23s5s
16atcgca235-gac-tgg
16atcgca235
gm0409 4*16gaa235 + 16s 9 92 16 76
16s235-acc-5s
2*16atcgca235
16atcgca235-gac
atc-gca-235-gac-tgg 44
lien blocs 16s total aas avec sans total page Gm413-487 Notes
gm0413 4*16gaa235 8 87 14 73 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16s235-acc-5s sans 4 16 14 2 avant
16atcgca235-gac-tgg gac-tgg 3 1 ttc-16atcgca235
16atcgca235 gac 3 1 cgg-cac-cca-16atcgca235
16atcgca235-gac acc-5s 2 1
tgg 5s en trop
gm0420 4*16gaa235 + 5s 7 70 12 58 47 total 6 22 0 17 0 0 2 16atcgca235-5s-gac
16atcgca235-gac-tgg 5s
16gaa235-gac
16gaa235-acc-5s
gm0441 4*16gaa235 8 86 14 72
16s235-acc-5s
16atcgca235-gac
16atcgca235
16atcgca235-gac-tgg
gm0470 2*16-gaa-235 6 66 15 51
16atcgca235
cgg-cac-cca-16atcgca235
16-gaa-235-gac-tgg
16atcgca235-5s-gac
gm0476 3*16atcgca235 3 57 6 51
gm0478 3*16atcgca235 3 52 6 46
gm0483 4*16s23s5s 7 81 6 75
3*16atcgca235
gm0486 2*16atcgca235 2 47 4 43
gm0487 2*16atcgca235 3 47 7 40
ttc-16atcgca235 47
lien blocs 16s total aas avec sans total page Gm488-538 Notes
gm0488 2*16atcgca235 3 47 7 40 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235-tta sans 7 20 2 2 avant
gac-tgg 1 1 1 1 aaa-16atcgca235
gm0489 2*16atcgca235 3 44 7 37 gac 1 5 2 2 ttg-16-gaa-aaa-gta-235-gac-tgg
aaa-16atcgca235 acc-5s 1 0 atgj-16atcgca235
tgg
gm0491 3*16atcgca235 4 50 9 41 46 total 10 26 0 5 0 2 3 autres
atgj-16atcgca235 2*16-gaa-aaa-gta-235-gac
gm0494 2*16-gaa-235 + 16atcgca-23s°-5s-gac 82 14 68
2*16atcgca235 7 incomplets
16-gaa-235-gac-tgg 16atcgca-23s°-5s-gac
16-gaa-23-acc-5s
différents
gm0495 3*16atcgca235 11 132 25 107 16atcgca235-tta
5*16atcgca235-gac 16atcgca235-tgg-tgg
2*16atcgca235-5s 16-gaa-23-acc-5s
16atcgca235-tgg-tgg
5s en trop
gm0526 2*16-gaa-235-gac 9 137 25 112 2*16atcgca235-5s
2*16-gaa-aaa-gta-235-gac 16s23s5s-5s-gac-tgg
ttg-16-gaa-aaa-gta-235-gac-tgg 16s23s5s-5s
16atcgca235-gac-tgg
16s23s5s-acc-5s
16s23s5s-gac
16s23s5s-5s-gac-tgg
gm0535 6*16s23s5s 9 108 4 104
2*16atcgca235
16s23s5s-5s
gm0538 4*16atcgca235 4 66 8 58
50
lien blocs 16s total aas avec sans total page Gm666-1048 Notes
gm0666 3*16-gaa-235 83 14 69 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
16atcgca235-gac sans 8 5 2 8 1 autres
16atcgca235 gac-tgg 1 3 2 16-gcc-gaa-235-gac-tgg
16-gaa-235-gac-tgg gac 2 3 1 1 16-gaa-aaa-gca-gta-235-gac-tgg
16atcgca235-acc-5s 7 acc-5s 1 2 1 16-gaa-aaa-gta-cds-235
tgg 16-gaa-aaa-gta-cds-235-gac
gm0942 2*16-gaa-235 87 15 72 41 total 11 11 2 13 0 4 0
16-gaa-235-gac 7
16atcgca235 différents
16-gaa-235-acc-5s 16atcgca-235-acc-5s-gac
16atcgca235-gac-tgg 16atcgca-235-tca
16atcgca-23s° 16-gaa-aaa-gta-cds-235-tca
16s°-gaa-235
incomplets
gm0973 6*16s23s5s 11 149 9 140 16atcgca-23s°
16atcgca235-gac
16s23s5s-acc-5s autres incomplets
2*16atcgca235 16s°-gaa-235
16s23s5s-gac
cds
gm0984 3*16-gaa-235 7 103 14 89 16-gaa-aaa-gta-cds-235
16atcgca235-gac 16-gaa-aaa-gta-cds-235-gac
16atcgca235-acc-5s 16-gaa-aaa-gta-cds-235-tca
16-gaa-235-gac-tgg
16atcgca235 5s en trop
16-gca-atc-235-5s
gm1003 16-gca-atc-235 2 71 4 67 16atcgca-235-acc-5s-gac
16-gca-atc-235-5s
gm1048 16-gcc-gaa-235-gac-tgg 126 32 94
16atcgca-235-acc-5s-gac
16-gaa-235-gac-tgg
16-gaa-aaa-gca-gta-235-gac-tgg
2*16s23s5s
16s23s5s-gac
16atcgca-235-tca 11
16-gaa-aaa-gta-cds-235
16-gaa-aaa-gta-cds-235-gac
16-gaa-aaa-gta-cds-235-tca 45
lien blocs 16s total aas avec sans total page Gm1066-1149 Notes
gm1066 2*16-gca-atc-235 2 55 4 51 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
sans 5 5 11 1 avant
gm1072 2*16-gca-atc-235 2 55 4 51 gac-tgg 2 2 cgg-16-gca-atc-235
gac 1 3
gm1100 3*16-gaa-235 7 82 13 69 acc-5s 2 2
16-gaa-235-gac tgg
16atcgca235 34 total 0 10 5 18 0 0 1
16-gaa-235-gac-tgg
16atcgca235-acc-5s
gm1106 16-gca-atc-235 2 53 5 48
cgg-16-gca-atc-235
gm1115 3*16-gaa-235 7 85 14 71
16-gaa-235-gac
16atcgca235-acc-5s
16atcgca235-gac-tgg
16atcgca235
gm1128 3*16-gaa-235 7 73 12 61
16-gaa-235-acc-5s
16-gaa-235-gac-tgg
16-gaa-235-gac
16atcgca235
gm1149 2*16-gaa-235 7 82 15 67
2*16atcgca235
16atcgca235-gac-tgg
16-gaa-235-acc-5s
16atcgca235-gac 34
lien blocs 16s total aas avec sans total page Total
144 16s23s5s atcgca gcaatc gaa atcgaa autres av16s
sans 58 238 14 160 1 19 17
gac-tgg 1 31 0 25 0 4 5
Moyenne 68 10 58 gac 8 34 0 31 2 5 0
ecartype 25 6 20 acc-5s 7 19 0 20 0 0 0
max 149 32 140 tgg 1 1 0 2 0 1 0
min 27 0 27 704 total 75 323 14 238 3 29 22

gamma notes[modifier | modifier le wikicode]

  • Lien tableur: gamma notes
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
Gamma blocs, Notes
avant autres 5s en trop
3*agc-gta-16atcgca235 3*16-atc-235 2*16s23s5s-5s
3*atgf-16atcgca235 16gcc235-gac-tgg 16s23s5s-5s-gac-tgg
4*cgg-cac-cca-16atcgca235 16 atc-gcc 235-gac 16s23s5s-acc-5s-acc-5s
cgg-cac-cca-16atcgca2355-gac-tgg 16-gcc-gaa-235-gac-tgg
cgg-cac-cca-16atcgca235-x-tgg 4*16-gca-cca-235 2*16atcgca235-5s
2*aaa-16atcgca235 16atcgca235-5s-gac
ttc-16atcgca235 16-gaa-aaa-gta-235 3*16atcgca2355-gac-tgg
atgj-16atcgca235 3*16-gaa-aaa-gta-235-gac 16atcgca-235-acc-5s-gac
16-gaa-aaa-gta-235-tgg cgg-cac-cca-16atcgca2355-gac-tgg
2*cgg-cac-cca-16gaa2355-gac-tgg 16atcgca-cds-2355
cgg-cac-cca-16gaa235 16-gaa-aaa-gca-gta-235
16-gaa-aaa-gca-gta-235-gac-tgg 2*cgg-cac-cca-16gaa2355-gac-tgg
cgg-16-gca-atc-235 16gaa23-cds-5s-5s
16atcgca-cds-2355 16gaa235-gac-5s
cgg-cac-cca-16-gaa-cds-235 16-gaa-cds-23555-gac-tgg 2*16gaa2355-gac-tgg
ttg-16-gaa-aaa-gta-235-gac-tgg 16-gaa-cds-235 16-gaa-cds-23555-gac-tgg
7*16-gca-cds-235
différents 16-gaa-aaa-gta-cds-235 16-atc-2355-tac
16s23s5s-acc 16-gaa-aaa-gta-cds-235-gac 2*16-gca-atc-2355
16s23s5s-acc-5s-acc-5s
incomplets gaa-5s
16gaa235-tca 3*16atcgca23 atc-5s-aaa
3*16gaa235-acc 2*16s23s 13*5s
2*16gaa235-ttc 2*16gaa23
16gaa23-cds-5s-5s 16gaa23-tgg cds
2*16gaa235-gac-gac 16gaa23-cds-5s-5s
16-gaa-23-acc-5s 16s-gaa-aaa-gta-5s
16atcgca-23s°-5s-gac 16atcgca-cds-2355
3*16atcgca235-acc 16s-23s°-5s-gac 16-gaa-cds-23555-gac-tgg
16atcgca-235-tca 16-gaa-cds-235
16atcgca235-tta 16s-atc-gca-tgg 7*16-gca-cds-235
16atcgca235-tgg-tgg 16atcgca-23s° 16-gaa-aaa-gta-cds-235
16atcgca-235-acc-5s-gac 16atcgca 16-gaa-aaa-gta-cds-235-gac
3*16s cgg-cac-cca-16-gaa-cds-235
16-atc-2355-tac 16-gaa-aaa-gta-cds-235-tca
16-gaa-aaa-gta-cds-235-tca autres incomplets
23s5s à l’envers
16s°-gaa-235 2*5s-23s-16s
gaa-23s5s-gac 2*5s-23s-cp(atc-gca)-16s
atc-gca-235-gac-tgg

gamma cds notes[modifier | modifier le wikicode]

	23.7.20 Tanger		cds 	contrôles		date NCBI		
								
	gamma	gm0152	Colwellia psychrerythraea 34H		25/08/19		7 cds
sens	adresse			gène intercal	aas	cds		
	42409..43659		cds	668	417	DEAD/DEAH box helicase			
	44328..45874		16s	94				
	45969..46044		gca	95				
	46140..46343		cds	130	68	hp (voir tableur)		
	46474..49391		23s	152				
	49544..49658		5s	511				
	50170..51718		16s	94				
	51813..51888		gca	38				
<>	51927..52118		cds	199	64	P-hp		
	52318..55235		23s	152				
	55388..55502		5s	886				
	56389..56775		cds		129	ATP synthase subunit I		
								
comp	349644..350126		cds	798	161	RNA-binding protein		
	350925..352471		16s	94				
	352566..352641		gca	95				
	352737..352940		cds	130	68	hp1 (voir tableur)		
	353071..355988		23s	152				
	356141..356255		5s	518				
	356774..358322		16s	94				
	358417..358492		gca	95				
	358588..358791		cds	130	68	hp2 (voir tableur)		
	358922..361839		23s	152				
	361992..362106		5s	1173				
comp	363280..364287		cds		336	tRNA dihydrouridine(20/20a) synthase DusA		
								
	552484..553779		cds	855	432	phosphoribosylamine--glycine ligase		
	554635..556181		16s	94				
	556276..556351		gca	95				
	556447..556650		cds	130	68	hp1 (voir tableur)		
	556781..559698		23s	152				
	559851..559965		5s	511				
	560477..562025		16s	94				
	562120..562195		gca	92				
	562288..562491		cds	130	68	hp2 (voir tableur)		
	562622..565539		23s	144				
	565684..565798		5s	731				
comp	566530..568614		cds		695	YjbH domain-containing protein		
								
comp	4071788..4073749	cds	983	654	molecular chaperone HtpG		
comp	4074733..4074847	5s	150				
comp	4074998..4077915	23s	130				
comp	4078046..4078249	cds	112	68	hp (voir tableur)		
comp	4078362..4078437	gca	94				
comp	4078532..4080078	16s	999				
	4081078..4084206	cds		1043	S8 family serine peptidase		
								
	gamma	gm0360	Frischella perrara strain PEB0191	08/06/20		1 cds
								
	129653..130189		cds	517	179	D-glycero-beta-D-manno-heptose 1,7-bisphosphate
 							7-phosphatase
	130707..132243		16s	57				
	132301..132377		atc	90				
	132468..132543		gca	313				
	132857..134053		cds	433	399	histidinol-phosphate aminotransferase family protein 
							(voir tableur)		
	134487..137401		23s	60				
	137462..137577		5s	224				
	137802..137917		5s	169				
	138087..138686		cds		200	RNA pyrophosphohydrolase		
								
	gamma	gm0386						21/12/19		1 cds
								
	1509917..1513153	cds	373	1079	Ig-like domain-containing protein		
	1513527..1515080	16s	132				
	1515213..1515288	gaa	207				
	1515496..1518536	23s	129				
comp	1518666..1519652	cds	264	329	IS110 family transposase (voir tableur)		
	1519917..1520032	5s	51				
	1520084..1520199	5s	211				
	1520411..1522102	cds		564	D-lactate dehydrogenase		
								
gamma	gm0369	Haemophilus influenzae 10810			02/06/20		3 cds perdus
								
gamma	gm1048	Vibrio parahaemolyticus BB22OP			10/02/20		3 cds perdus

gamma typage[modifier | modifier le wikicode]

gamma type 16235-z après 5s[modifier | modifier le wikicode]

Gamma typage, après 5s
Blocs sans gac-tgg gac acc- 5s tgg total
16s23s5s 58 1 8 7 1 75
atcgca 238 31 34 19 1 323
gcaatc 14 0 0 0 0 14
gaa 160 25 31 20 2 238
atcgaa 1 0 2 0 3
autres 19 4 5 0 1 29
av16s 17 5 0 0 0 22
total 507 66 80 46 5 704
16s23s5s-z
Type total % tRNA total %
blocs sans 507 599
sans 507 699 gac 151 178
gac-tgg 66 91 tgg 73 86
gac 80 110 acc 57 67
acc- 5s 46 63 5s 50 59
tgg 5 7 tca 3 4
différents ttc 2 2
acc 7 10 tta 1 1
acc-5s-acc-5s 1 1 tac 1 1
acc-5s-gac 1 1 cds 1 1
23-acc-5s 1 1 846 1000
23-cds-5s-5s 1 1
tca 3 4
ttc 2 3
gac-gac 2 3
tta 1 1
tgg-tgg 1 1
tac 1 1
725 1000

gamma type 16-y-235 après 16s[modifier | modifier le wikicode]

Gamma typage, après 16s
16s-y-23s5s blocs autres avant 16s incomplets différents total
16s23s5s 75 2 2 79
atc-gca 323 16 3 7 349
gca-atc 14 1 15
atc 3 1 4
gaa 238 3 3 10 254
atc-gaa 3 3
gcc 1 1
atc-gcc 1 1
gcc-gaa 1 1
gca-cca 4 4
gaa-aaa-gta 5 1 6
gaa-aaa-gca-gta 2 2
atc-gca-cds 1 1
gaa-cds 2 1 3
gca-cds 7 7
gaa-aaa-gta-cds 2 1 3
653 29 22 8 21 733
Type total % tRNA total %
atc-gca 349 476 gca 378 330
gaa 254 347 atc 373 326
16s23s5s 79 108 gaa 272 238
gca-atc 15 20 16s 79 69
gca-cds 7 10 cds 14 12
gaa-aaa-gta 6 8 aaa 11 10
atc 4 5 gta 11 10
gca-cca 4 5 cca 4 3
atc-gaa 3 4 gcc 3 3
gaa-cds 3 4 1145 1000
gaa-aaa-gta-cds 3 4
gaa-aaa-gca-gta 2 3
gcc 1 1
atc-gcc 1 1
gcc-gaa 1 1
atc-gca-cds 1 1
733 1000

gamma type x-16235 avant 16s[modifier | modifier le wikicode]

  • Lien tableur: gamma type x-16235 avant 16s
  • Légende:
    Catégories des séquences x y z de tRNAs dans les blocs à rRNAs, 16s-23s-5s.
    - 16-y-235-z: tRNAs reportés dans le tableau des blocs avec des z et des y majoritaires.
    - x-16-y-235-z: x, av16s, avant 16s.
    - 16-y-235-z’: z' différents des z
    - 16-y-23-: blocs incomplets sans 5s, avec ou sans y
    - 5-23-y-16 à l’envers: blocs complets mais à l'envers
Gamma typage, avant 16s
Par séquence Par tRNA
avant x-16235 %
cgg-cac-cca 10 cgg 11 24
agc-gta 3 cac 10 22
atgf 3 cca 10 22
aaa 2 atgf 3 7
ttc 1 agc 3 7
atgj 1 gta 3 7
cgg 1 aaa 2 4
ttg 1 ttc 1 2
atgj 1 2
ttg 1 2
total 45

gamma comparaison des types x y z[modifier | modifier le wikicode]

  • Lien tableur: gamma comparaison des types x y z
  • Légende:
    couleurs
    - type x: 45
    - type y: 1070
    - type z: 1070
    sommes de 2 types, en gras, effectif (pourcentage)
    - cds 14y + z (1.31y + 0.35z)  ttc x + 2z (2.22x + 0.69z)  gta 3x + 11y (6.67x + 1.03y)  cca 10x + 4y (22.22x + 0.37y)  aaa 2x + 11y (4.44x + 1.03y)
    - 3+, somme des 3 types majoritaires
  • Notices:
    - Le type x, avant 16s, se comporte comme y et z, mais les 3 sont très différents. Le type x a ses propres séquences, ce qui prouve qu'il ne dérive pas des 2 autres. Ceci renforce l'idée qu'il a son propre processus et que ce n'est pas un artefact du aux éléments mobiles.
G. Gamma typage, comparaison des 3 types x y z
G1. Gamma typage, effectifs des 3 types x y z
3 + 31 1027 281
total 45 1070 289 1404
atgf 3 act aat cds 15
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 375 acc 57 aac agc 3
ctc ccc cac 10 cgt
gtc gcc 3 gac 151 ggc
ttc 3 tcc tac 1 tgc
atgi aca aaa 13 aga
cta cca 14 caa cga
gta 14 gca 380 gaa 272 gga
tta 1 tca 3 taa tga
atgj 1 acg aag agg
ctg ccg cag cgg 11
gtg gcg gag ggg
ttg 1 tcg tag tgg 73
G2. Gamma typage, pourcentage des 3 types x y z
3 + 69 96 97
total 100 100 100 300
atgf 6.7 act aat cds 1.7
ctt cct cat cgc
gtt gct gat ggt
ttt tct tat tgt
atc 35 acc 20 aac agc 6.7
ctc ccc cac 22 cgt
gtc gcc 0.3 gac 52 ggc
ttc 2.9 tcc tac 0.3 tgc
atgi aca aaa 5.5 aga
cta cca 23 caa cga
gta 7.7 gca 36 gaa 25 gga
tta 0.3 tca 1.0 taa tga
atgj 2.2 acg aag agg
ctg ccg cag cgg 24
gtg gcg gag ggg
ttg 2.2 tcg tag tgg 25

gamma. 5s se comporte comme un tRNA[modifier | modifier le wikicode]

  • Lien tableur: gamma. 5s se comporte comme un tRNA
  • Légende:
    - 23-acc-5s, le tRNA acc prend la place normale du 5s
    - 23-cds-5s-5s, le cds prend la place normale du 5s
    - gac-5s, c'est un type différent pris pour le type z gac, par erreur.
  • Notices:
    1. acc-5s, avec un effectif de 46, autant que les 2 tRNAs, gac-tgg avec 56, le 5s se comporte comme un tRNA. Sert-il de modèle?
    2. 16gaa23-cds-5s-5s, un cds qui se comporte comme 5s! le 5s sert-il à la création du cds?
    3. Le 5s se comporte comme un tRNA. Au total il y a 68 type z et z' qui contiennent au moins un 5s en trop et 2 où la place normale du 5s est prise par un tRNA, 23-acc-5s, ou un cds, 23-cds-5s-5s.
      - Sur les 68 à position normale du 1er 5s,
      - 49 ont les 5s en trop après un seul tRNA dont le type le plus fréquent est acc-5s avec 46 cas auquel il faut ajouter un semblable, gac-5s, et 2 commençant par acc-5s, acc-5s-acc-5s et acc-5s-gac, où le 5s se trouve entre 2 tRNAs.
      - 18 ont un seul 5s en trop avant les tRNAs dont 7 sans tRNA, 9 avec gac-tgg, 2 avec 1 seul tRNA, gac tca.
      - 1 seul a 2 5s après le 1er 5s en position normale, 55-gac-tgg. Il ressemble en cela avec l'interverti par un cds, 23-cds-5s-5s.
Sur les 725 blocs étudiés ici 723 ont le 1er 5s en position normale et 2 intervertis. 500 blocs n'ont pas de 5s en trop. Les 223 restants contiennent 1 à n tRNA ou 5s au-delà du bloc 23s5s:
n	tRNA	5s et/ou tRNA
1	96	7
2	59	49
3	0	10
4	0	2
Gamma typage, les 5s en trop
Tableau 16s23s5s atcgca gcaatc gaa atcgaa autres av16s différents total 5s+ total
des blocs sans 56 236 12 160 1 18 17 500
5s 2 2 2 1 7 7
gac-tgg 0 28 23 3 2 56
5s-gac-tgg 1 3 2 3 9 9
55-gac-tgg 1 1 1
gac 8 33 30 2 5 78
gac-5s 1 1 1
5s-gac 1 1 1
acc-5s 7 19 20 46
tgg 1 1 2 1 5
Différents acc 1 3 3 7
acc-5s-acc-5s 1 1 1
acc-5s-gac 1 1 1
tca 1 1 1 3
ttc 2 2
23-cds-5s-5s 1 1 1
gac-gac 2 2
23-acc-5s 1 1
tta 1 1
tgg-tgg 1 1
16-atc-2355-tac 1 1 1
total 77 330 14 248 3 30 22 1 23 725
tableau 75 323 14 238 3 29 22 0 19 704

Tableau des noms gamma[modifier | modifier le wikicode]

  • Lien tableur: Noms gamma
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
  • Légende
    - notes
    • - NCBI: [1]
    • - eco et semblables, code KEGG à partir duquel on peut retrouver le NCBI
    • - 2*95, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes gamma
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs           total           88462
génomes		ruptures	faits	total
total		314		144	1161
F. Noms des gamma
ruptures notes rRNAs fait code tRNAs génomes
1 222 1 gm0001 54 Acidithiobacillus caldus ATCC 51756
gm0002 55 Acidithiobacillus caldus SM-1
1 222 1 gm0003 51 Acidithiobacillus ferrivorans SS3
1 gm0004 88 Acidithiobacillus ferrooxidans ATCC 23270
222 1 gm0005 50 Acidithiobacillus ferrooxidans ATCC 53993
1 gm0006 72 Acinetobacter baumannii 1656-2
gm0007 75 Acinetobacter baumannii 6200
gm0008 73 Acinetobacter baumannii 6411
gm0009 74 Acinetobacter baumannii A1
gm0010 74 Acinetobacter baumannii AB0057
gm0011 75 Acinetobacter baumannii AB030
gm0012 74 Acinetobacter baumannii AB031
gm0013 74 Acinetobacter baumannii AB307-0294
gm0014 75 Acinetobacter baumannii AB5075-UW
gm0015 73 Acinetobacter baumannii AbH12O-A2
gm0016 39 Acinetobacter baumannii AC12
211 1 gm0017 63 Acinetobacter baumannii AC29
gm0018 48 Acinetobacter baumannii AC30
gm0019 65 Acinetobacter baumannii ACICU
gm0020 71 Acinetobacter baumannii ATCC 17978
gm0021 73 Acinetobacter baumannii AYE
gm0022 75 Acinetobacter baumannii BJAB07104
gm0023 76 Acinetobacter baumannii BJAB0715
gm0024 76 Acinetobacter baumannii BJAB0868
gm0025 66 Acinetobacter baumannii D1279779
gm0026 75 Acinetobacter baumannii IOMTU 433
gm0027 73 Acinetobacter baumannii LAC-4
gm0028 76 Acinetobacter baumannii MDR-TJ
gm0029 70 Acinetobacter baumannii MDR-ZJ06
gm0030 75 Acinetobacter baumannii NCGM 237
gm0031 81 Acinetobacter baumannii PKAB07
gm0032 65 Acinetobacter baumannii SDF
gm0033 43 Acinetobacter baumannii TCDC-AB0715
gm0034 76 Acinetobacter baumannii TYTH-1
gm0035 72 Acinetobacter baumannii ZW85-1
1 666 1 gm0036 70 Acinetobacter calcoaceticus PHEA-2
1 666 1 gm0037 72 Acinetobacter oleivorans DR1
gm0038 77 Acinetobacter sp. ADP1
1 766 1 gm0039 64 Actinobacillus equuli subsp. equuli 19392
1 766 1 gm0040 64 Actinobacillus pleuropneumoniae serovar 3 str. JL03
gm0041 63 Actinobacillus pleuropneumoniae serovar 5b str. L20
gm0042 65 Actinobacillus pleuropneumoniae serovar 7 str. AP76
1 766 1 gm0043 61 Actinobacillus succinogenes 130Z
1 gm0044 64 Actinobacillus suis ATCC 33415
766 1 gm0045 60 Actinobacillus suis H91-0380
1 gm0046 106 Aeromonas hydrophila 4AK4
11,11,11 1 gm0047 129 Aeromonas hydrophila AH10
gm0048 115 Aeromonas hydrophila AL06-06
gm0049 114 Aeromonas hydrophila AL09-71
gm0050 113 Aeromonas hydrophila J-1
gm0051 114 Aeromonas hydrophila ML09-119
gm0052 114 Aeromonas hydrophila pc104A
gm0053 128 Aeromonas hydrophila subsp. hydrophila ATCC 7966
gm0054 129 Aeromonas hydrophila YL17
1 10,9,9 1 gm0055 131 Aeromonas media WS
1 10,9,9 1 gm0056 111 Aeromonas salmonicida subsp. salmonicida A449
1 11,10,10 1 gm0057 103 Aeromonas veronii B565
1 666 1 gm0058 52 Aggregatibacter actinomycetemcomitans ANH9381
gm0059 57 Aggregatibacter actinomycetemcomitans D11S-1
gm0060 55 Aggregatibacter actinomycetemcomitans D7S-1
gm0061 55 Aggregatibacter actinomycetemcomitans HK1651
1 766 1 gm0062 60 Aggregatibacter aphrophilus NJ8700
1 333 1 gm0063 43 Alcanivorax borkumensis SK2
1 222 1 gm0064 45 Alcanivorax dieselolei B5
1 222 1 gm0065 48 Alcanivorax pacificus W11-5
1 13,12,12 1 gm0066 104 Aliivibrio salmonicida LFI1238
1 876 1 gm0067 91 Aliivibrio wodanis
1 222 1 gm0068 49 Alkalilimnicola ehrlichii MLHE-1
1 333 1 gm0069 54 Allochromatium vinosum DSM 180
1 555 1 gm0070 68 Alteromonas australica DE170
555 1 gm0071 57 Alteromonas australica H 17
1 gm0072 69 Alteromonas macleodii AltDE1
655 1 gm0073 54 Alteromonas macleodii ATCC 27126
gm0074 67 Alteromonas macleodii str. Aegean Sea MED64
gm0075 72 Alteromonas macleodii str. Balearic Sea AD45
gm0076 70 Alteromonas macleodii str. Black Sea 11
gm0077 64 Alteromonas macleodii str. Deep ecotype
gm0078 68 Alteromonas macleodii str. English Channel 615
655 1 gm0079 77 Alteromonas macleodii str. English Channel 673
gm0080 63 Alteromonas macleodii str. Ionian Sea U4
gm0081 63 Alteromonas macleodii str. Ionian Sea U7
gm0082 64 Alteromonas macleodii str. Ionian Sea U8
gm0083 59 Alteromonas macleodii str. Ionian Sea UM4b
gm0084 65 Alteromonas macleodii str. Ionian Sea UM7
1 gm0085 66 Alteromonas sp. SN2
1 666 1 gm0086 70 Azotobacter chroococcum NCIMB 8003
1 666 1 gm0087 66 Azotobacter vinelandii CA
gm0088 66 Azotobacter vinelandii CA6
gm0089 66 Azotobacter vinelandii DJ ATCC BAA-1303
1 766 1 gm0090 58 Bibersteinia trehalosi USDA-ARS-USMARC-188
gm0091 58 Bibersteinia trehalosi USDA-ARS-USMARC-189
gm0092 59 Bibersteinia trehalosi USDA-ARS-USMARC-190
gm0093 58 Bibersteinia trehalosi USDA-ARS-USMARC-192
1 111 1 gm0094 38 Blochmannia endosymbiont of Camponotus Colobopsis obliquus 757
gm0095 38 Blochmannia endosymbiont of Polyrhachis Hedomyrma turneri 675
gm0096 31 Buchnera aphidicola BCc
gm0097 31 Buchnera aphidicola Cinara tujafilina
1 111 1 gm0098 32 Buchnera aphidicola str. 5A Acyrthosiphon pisum
gm0099 32 Buchnera aphidicola str. Ak Acyrthosiphon kondoi
gm0100 32 Buchnera aphidicola str. APS Acyrthosiphon pisum
gm0101 32 Buchnera aphidicola str. Bp Baizongia pistaciae
gm0102 32 Buchnera aphidicola str. F009 Myzus persicae
gm0103 32 Buchnera aphidicola str. G002 Myzus persicae
gm0104 32 Buchnera aphidicola str. JF98 Acyrthosiphon pisum
gm0105 32 Buchnera aphidicola str. JF99 Acyrthosiphon pisum
gm0106 32 Buchnera aphidicola str. LL01 Acyrthosiphon pisum
gm0107 32 Buchnera aphidicola str. LSR1 Acyrthosiphon pisum
gm0108 32 Buchnera aphidicola str. Sg Schizaphis graminum
gm0109 32 Buchnera aphidicola str. TLW03 Acyrthosiphon pisum
gm0110 32 Buchnera aphidicola str. Tuc7 Acyrthosiphon pisum
gm0111 32 Buchnera aphidicola str. Ua Uroleucon ambrosiae
gm0112 32 Buchnera aphidicola str. USDA Myzus persicae
gm0113 32 Buchnera aphidicola str. W106 Myzus persicae
1 222 1 gm0114 40 Candidatus Baumannia cicadellinicola BGSS
1 111 1 gm0115 41 Candidatus Blochmannia chromaiodes str. 640
gm0116 37 Candidatus Blochmannia floridanus
gm0117 41 Candidatus Blochmannia pennsylvanicus str. BPEN
gm0118 38 Candidatus Blochmannia vafer str. BVAF
1 011 1 gm0119 27 Candidatus Carsonella ruddii CE isolate Thao2000
gm0120 26 Candidatus Carsonella ruddii CS isolate Thao2000
gm0121 27 Candidatus Carsonella ruddii DC
gm0122 24 Candidatus Carsonella ruddii HC isolate Thao2000
gm0123 26 Candidatus Carsonella ruddii HT isolate Thao2000
gm0124 27 Candidatus Carsonella ruddii PC isolate NHV
gm0125 26 Candidatus Carsonella ruddii PV
1 111 1 gm0126 33 Candidatus Evansia muelleri
1 333 1 gm0127 45 Candidatus Hamiltonella defensa 5AT Acyrthosiphon pisum T5A
1 333 1 gm0128 37 Candidatus Ishikawaella capsulata Mpkobe
1 212 1 gm0129 42 Candidatus Moranella endobia PCIT
gm0130 42 Candidatus Moranella endobia PCVAL
1 233 1 gm0131 40 Candidatus Pantoea carbekii
gm0132 39 Candidatus Pantoea carbekii US
gm0133 34 Candidatus Portiera aleyrodidarum AD-CAI
gm0134 35 Candidatus Portiera aleyrodidarum AF-CAI
2*33 gm0135 66 Candidatus Portiera aleyrodidarum BT-B-HRs
gm0136 66 Candidatus Portiera aleyrodidarum BT-QVLC
1 111 1 gm0137 33 Candidatus Portiera aleyrodidarum MED Bemisia tabaci BT-Q
gm0138 34 Candidatus Portiera aleyrodidarum TV
gm0139 34 Candidatus Portiera aleyrodidarum TV-BCN
1 222 1 gm0140 33 Candidatus Riesia pediculicola USDA
1 111 1 gm0141 37 Candidatus Ruthia magnifica str. Cm Calyptogena magnifica
1 252 1 gm0142 57 Candidatus Sodalis pierantonius str. SOPE
1 877 1 gm0143 83 Cedecea neteri M006
gm0144 84 Cedecea neteri ND14a
gm0145 77 Cedecea neteri ND14b
gm0146 83 Cedecea neteri SSMD04
1 333 1 gm0147 49 Cellvibrio japonicus Ueda107
1 555 1 gm0148 70 Chromohalobacter salexigens DSM 3043
1 988 1 gm0149 84 Citrobacter freundii CFNIH1
1 877 1 gm0150 84 Citrobacter koseri ATCC BAA-895
1 877 1 gm0151 87 Citrobacter rodentium ICC168
1 10,9,9 1 gm0152 89 Colwellia psychrerythraea 34H BAA-681
gm0153 43 Coxiella burnetii Cb175 Guyana
gm0154 43 Coxiella burnetii CbuG Q212
1 111 1 gm0155 44 Coxiella burnetii CbuK Q154
gm0156 44 Coxiella burnetii Dugway 5J108-111
gm0157 43 Coxiella burnetii RSA 331
1 111 1 gm0158 43 Coxiella burnetii RSA 493
gm0159 44 Coxiella burnetii str. Namibia
gm0160 43 Coxiella burnetii Z3055
1 111 1 gm0161 39 Coxiella endosymbiont of Amblyomma americanum
1 877 1 gm0162 85 Cronobacter sakazakii ATCC BAA-894
gm0163 85 Cronobacter sakazakii CMCC 45402 CMCC45402
gm0164 81 Cronobacter sakazakii ES15
gm0165 85 Cronobacter sakazakii SP291 Sp291
1 877 1 gm0166 86 Cronobacter turicensis z3032
1 111 1 gm0167 36 Cycloclasticus sp. P1 MCCC 1A01040
1 111 1 gm0168 36 Cycloclasticus zancles 7-ME
1 333 1 gm0169 47 Dichelobacter nodosus VCS1703A
1 877 1 gm0170 76 Dickeya dadantii 3937
gm0171 78 Dickeya dadantii Ech586
gm0172 75 Dickeya dadantii Ech703
1 877 1 gm0173 91 Dickeya zeae EC1
gm0174 76 Dickeya zeae Ech1591
1 222 1 gm0175 53 Dyella japonica A8
1 gm0176 57 Dyella jiangningensis SBZ 3-12
1 988 1 gm0177 95 Edwardsiella ictaluri 93-146
1 988 1 gm0178 96 Edwardsiella piscicida C07-087
1 gm0179 99 Edwardsiella tarda 080813
988 1 gm0180 96 Edwardsiella tarda EIB202
gm0181 96 Edwardsiella tarda FL6-60
1 111 1 gm0182 43 endosymbiont of unidentified scaly snail isolate Monju
1 10,8,8 1 gm0183 90 Enterobacter aerogenes EA1509E
gm0184 85 Enterobacter aerogenes KCTC 2190
1 988 1 gm0185 85 Enterobacter asburiae L1
gm0186 84 Enterobacter asburiae LF7a
1 gm0187 87 Enterobacter cloacae 34399
gm0188 86 Enterobacter cloacae 34977
gm0189 86 Enterobacter cloacae 34983
988 1 gm0190 90 Enterobacter cloacae ECNIH2
gm0191 84 Enterobacter cloacae ECNIH3
gm0192 85 Enterobacter cloacae ECNIH4
gm0193 84 Enterobacter cloacae ECNIH5
gm0194 84 Enterobacter cloacae ECR091
gm0195 84 Enterobacter cloacae EcWSU1
gm0196 85 Enterobacter cloacae GGT036
gm0197 104 Enterobacter cloacae P101
988 1 gm0198 89 Enterobacter cloacae subsp. cloacae ATCC 13047
gm0199 84 Enterobacter cloacae subsp. cloacae ENHKU01
gm0200 65 Enterobacter cloacae subsp. cloacae NCTC 9394
gm0201 80 Enterobacter cloacae subsp. dissolvens SDM
1 877 1 gm0202 83 Enterobacter lignolyticus SCF1
1 877 1 gm0203 87 Enterobacter sp. 638
1 11,10,8 1 gm0204 89 Enterobacter sp. R4-368
1 10,9,9 1 gm0205 88 Enterobacteriaceae bacterium strain FGI 57
1 877 1 gm0206 79 Erwinia amylovora ATCC 49946
gm0207 78 Erwinia amylovora CFBP1430
gm0208 60 Erwinia amylovora LA635
gm0209 60 Erwinia amylovora LA636
gm0210 60 Erwinia amylovora LA637
1 777 1 gm0211 78 Erwinia billingiae Eb661
1 877 1 gm0212 76 Erwinia pyrifoliae DSM 12163
gm0213 76 Erwinia pyrifoliae Ep1/96
1 877 1 gm0214 78 Erwinia sp. Ejp617
1 877 1 gm0215 82 Erwinia tasmaniensis Et1/99
1 877 1 gm0216 89 Escherichia albertii KF1
1 gm0217 93 Escherichia coli
gm0218 95 Escherichia coli 042
gm0219 91 Escherichia coli 1303
gm0220 81 Escherichia coli 536
gm0221 96 Escherichia coli 55989
gm0222 87 Escherichia coli 6409
gm0223 93 Escherichia coli 94-3024
gm0224 89 Escherichia coli ABU 83972
gm0225 89 Escherichia coli APEC IMT5155
gm0226 98 Escherichia coli APEC O1
gm0227 91 Escherichia coli APEC O78
gm0228 85 Escherichia coli ATCC 25922
gm0229 87 Escherichia coli ATCC 8739
gm0230 87 Escherichia coli B str. REL606
gm0231 87 Escherichia coli B7A
gm0232 86 Escherichia coli BL21 TaKaRa
gm0233 86 Escherichia coli BL21-GoldDE3pLysS AG
gm0234 172 Escherichia coli BL21DE3
gm0235 88 Escherichia coli BW25113 K-12 substr. BW25113
gm0236 89 Escherichia coli BW2952 K-12 substr. BW2952
gm0237 86 Escherichia coli C41DE3
gm0238 89 Escherichia coli CFT073
gm0239 92 Escherichia coli CI5
88+89 gm0240 177 Escherichia coli DH1
gm0241 91 Escherichia coli ECC-1470
gm0242 94 Escherichia coli ECONIH1
gm0243 92 Escherichia coli ED1a
gm0244 89 Escherichia coli ER2796
gm0245 92 Escherichia coli ETEC H10407
gm0246 95 Escherichia coli FAP1
gm0247 90 Escherichia coli HS
gm0248 93 Escherichia coli HUSEC2011
gm0249 87 Escherichia coli IAI1
gm0250 89 Escherichia coli IAI39
gm0251 100 Escherichia coli IHE3034
gm0252 91 Escherichia coli JJ1886
gm0253 89 Escherichia coli K-12 ER3413
gm0254 89 Escherichia coli K-12 ER3435
gm0255 89 Escherichia coli K-12 ER3440
gm0256 89 Escherichia coli K-12 ER3445
gm0257 89 Escherichia coli K-12 ER3446
gm0258 89 Escherichia coli K-12 ER3454
gm0259 89 Escherichia coli K-12 ER3466
gm0260 89 Escherichia coli K-12 ER3475
gm0261 89 Escherichia coli K-12 ER3476
gm0262 89 Escherichia coli K-12 substr. HMS174
gm0263 89 Escherichia coli K-12 substr. RV308
gm0264 89 Escherichia coli KLY
2*86 gm0265 172 Escherichia coli KO11FL
gm0266 87 Escherichia coli LF82
gm0267 86 Escherichia coli LY180
gm0268 88 Escherichia coli MNCRE44
gm0269 82 Escherichia coli NA114
NCBI 11,10,8 gm0270 123 Escherichia coli Nissle 1917
gm0271 104 Escherichia coli O103 H2 str. 12009
gm0272 99 Escherichia coli O104 H4 str. 2009EL-2050
gm0273 99 Escherichia coli O104 H4 str. 2009EL-2071
gm0274 94 Escherichia coli O104 H4 str. 2011C-3493
gm0275 116 Escherichia coli O111 H- str. 11128
gm0276 93 Escherichia coli O127 H6 str. E2348/69
gm0277 93 Escherichia coli O139 H28 str. E24377A
gm0278 113 Escherichia coli O145 H28 str. RM12581
gm0279 104 Escherichia coli O145 H28 str. RM12761
gm0280 113 Escherichia coli O145 H28 str. RM13514
gm0281 104 Escherichia coli O145 H28 str. RM13516
gm0282 96 Escherichia coli O157 H16 Santai
gm0283 113 Escherichia coli O157 H7 str. EC4115
gm0284 210 Escherichia coli O157 H7 str. EDL933
gm0285 108 Escherichia coli O157 H7 str. Sakai Sakai substr. RIMD 0509952
gm0286 112 Escherichia coli O157 H7 str. SS17
gm0287 111 Escherichia coli O157 H7 str. SS52
gm0288 112 Escherichia coli O157 H7 str. TW14359
gm0289 106 Escherichia coli O26 H11 str. 11368
gm0290 105 Escherichia coli O55 H7 str. CB9615
gm0291 108 Escherichia coli O55 H7 str. RM12579
gm0292 94 Escherichia coli O7 K1 str. CE10
gm0293 84 Escherichia coli O83 H1 str. NRG 857C
gm0294 88 Escherichia coli P12b
gm0295 90 Escherichia coli PMV-1
gm0296 96 Escherichia coli RM9387
gm0297 94 Escherichia coli S88
gm0298 92 Escherichia coli SE11
gm0299 87 Escherichia coli SE15
gm0300 91 Escherichia coli SMS-3-5
gm0301 91 Escherichia coli ST131 EC958
gm0302 284 Escherichia coli ST2747
gm0303 285 Escherichia coli ST540
gm0304 89 Escherichia coli str. clone D i14
gm0305 89 Escherichia coli str. clone D i2
gm0306 90 Escherichia coli str. K-12 substr. DH10B
gm0307 89 Escherichia coli str. K-12 substr. MC4100
gm0308 86 Escherichia coli str. K-12 substr. MDS42
4*86 877 1 gm0309 356 Escherichia coli str. K-12 substr. MG1655
gm0310 89 Escherichia coli str. K-12 substr. W3110
gm0311 86 Escherichia coli UM146
gm0312 89 Escherichia coli UMN026
gm0313 106 Escherichia coli UMNF18
gm0314 99 Escherichia coli UMNK88
gm0315 90 Escherichia coli UTI89
gm0316 94 Escherichia coli VR50
gm0317 176 Escherichia coli W
gm0318 97 Escherichia coli Xuzhou21
1 877 1 gm0319 89 Escherichia fergusonii ATCC 35469
1 877 1 gm0320 122 Ferrimonas balearica DSM 9799
1 433 1 gm0321 39 Francisella cf. novicida Fx1
1 433 1 gm0322 39 Francisella cf. tularensis subsp. novicida 3523
1 433 1 gm0323 39 Francisella guangzhouensis 08HL01032
1 433 1 gm0324 40 Francisella noatunensis subsp. orientalis LADL--07-285A
gm0325 36 Francisella noatunensis subsp. orientalis str. Toba 04
1 433 1 gm0326 41 Francisella philomiragia GA01-2794
gm0327 41 Francisella philomiragia GA01-2801
gm0328 40 Francisella philomiragia O#319-029
gm0329 40 Francisella philomiragia O#319-036 FSC 153
gm0330 40 Francisella philomiragia O#319-067
gm0331 40 Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L
gm0332 40 Francisella philomiragia subsp. philomiragia ATCC 25017
1 433 1 gm0333 39 Francisella sp. FSC1006
1 433 1 gm0334 40 Francisella sp. TX077308
1 433 1 gm0335 39 Francisella tularensis subsp. holarctica 425
gm0336 39 Francisella tularensis subsp. holarctica F92
gm0337 39 Francisella tularensis subsp. holarctica FSC200
gm0338 39 Francisella tularensis subsp. holarctica FTNF002-00
gm0339 39 Francisella tularensis subsp. holarctica FTT 1
gm0340 78 Francisella tularensis subsp. holarctica LVS
gm0341 78 Francisella tularensis subsp. holarctica OSU18
gm0342 39 Francisella tularensis subsp. holarctica PHIT-FT049
gm0343 39 Francisella tularensis subsp. holarctica VT68
gm0344 39 Francisella tularensis subsp. mediasiatica FSC147 GIEM 543
gm0345 39 Francisella tularensis subsp. novicida D9876
gm0346 39 Francisella tularensis subsp. novicida F6168
gm0347 78 Francisella tularensis subsp. novicida U112
gm0348 39 Francisella tularensis subsp. tularensis FSC198 FSC 198
gm0349 39 Francisella tularensis subsp. tularensis NE061598
gm0350 37 Francisella tularensis subsp. tularensis NIH B-38
gm0351 37 Francisella tularensis subsp. tularensis Scherm
gm0352 39 Francisella tularensis subsp. tularensis SCHU S4
gm0353 39 Francisella tularensis subsp. tularensis SCHU S4 SHU-S4
gm0354 39 Francisella tularensis subsp. tularensis str. SCHU S4 substr. NR-28534
gm0355 39 Francisella tularensis subsp. tularensis TI0902
gm0356 40 Francisella tularensis subsp. tularensis TIGB03
gm0357 39 Francisella tularensis subsp. tularensis WY96
gm0358 39 Francisella tularensis subsp. tularensis WY96-3418
1 444 1 gm0359 76 Frateuria aurantia DSM 6220
1 544 1 gm0360 54 Frischella perrara PEB0191
1 766 1 gm0361 59 Gallibacterium anatis UMN179
1 gm0362 51 gamma proteobacterium HdN1
1 444 1 gm0363 53 Gilliamella apicola wkB1
1 444 1 gm0364 55 Glaciecola nitratireducens FR1064
1 666 1 gm0365 60 Glaciecola psychrophila 170
1 555 1 gm0366 62 Glaciecola sp. 4H-3-7+YE-5
1 444 1 gm0367 50 Gynuella sunshinyii YC6258
1 766 1 gm0368 50 Haemophilus ducreyi 35000HP
1 866 1 gm0369 59 Haemophilus influenzae 10810
gm0370 60 Haemophilus influenzae 2019
gm0371 61 Haemophilus influenzae 477
gm0372 60 Haemophilus influenzae 723
gm0373 60 Haemophilus influenzae 86-028NP
gm0374 58 Haemophilus influenzae C486
gm0375 60 Haemophilus influenzae CGSHiCZ412602
gm0376 61 Haemophilus influenzae F3031
gm0377 59 Haemophilus influenzae F3047
gm0378 61 Haemophilus influenzae Hi375
gm0379 59 Haemophilus influenzae KR494
gm0380 59 Haemophilus influenzae PittEE
gm0381 58 Haemophilus influenzae PittGG
gm0382 58 Haemophilus influenzae R2846
gm0383 62 Haemophilus influenzae R2866
gm0384 59 Haemophilus influenzae Rd KW20
gm0385 59 Haemophilus parainfluenzae T3T1
1 866 1 gm0386 57 Haemophilus parasuis KL0318
gm0387 57 Haemophilus parasuis SH0165
gm0388 60 Haemophilus parasuis SH03
gm0389 64 Haemophilus parasuis ZJ0906
1 988 1 gm0390 94 Hafnia alvei FB1
1 555 1 gm0391 69 Hahella chejuensis KCTC 2396
1 666 1 gm0392 61 Halomonas campaniensis LS21
1 444 1 gm0393 71 Halomonas elongata DSM 2581
1 666 1 gm0394 65 Halomonas sp. KO116
1 gm0395 48 Halorhodospira halochloris str. A
1 222 1 gm0396 48 Halorhodospira halophila SL1
1 222 1 gm0397 45 Halothiobacillus neapolitanus c2
1 444 1 gm0398 57 Idiomarina loihiensis GSL 199
gm0399 57 Idiomarina loihiensis L2TR
1 222 1 gm0400 42 Kangiella koreensis DSM 16069
1 978 1 gm0401 85 Klebsiella michiganensis RC10
1 988 1 gm0402 87 Klebsiella oxytoca E718
gm0403 87 Klebsiella oxytoca HKOPL1
gm0404 85 Klebsiella oxytoca KCTC 1686
gm0405 88 Klebsiella oxytoca KONIH1
gm0406 83 Klebsiella oxytoca M1
gm0407 80 Klebsiella pneumoniae 30660/NJST258 1
gm0408 88 Klebsiella pneumoniae 30684/NJST258 2
1 10,9,9 1 gm0409 92 Klebsiella pneumoniae 32192
gm0410 89 Klebsiella pneumoniae 342
gm0411 89 Klebsiella pneumoniae 34618
gm0412 88 Klebsiella pneumoniae ATCC BAA-2146
1 988 1 gm0413 87 Klebsiella pneumoniae blaNDM-1
gm0414 82 Klebsiella pneumoniae CG43
gm0415 89 Klebsiella pneumoniae HK787
gm0416 86 Klebsiella pneumoniae JM45
gm0417 90 Klebsiella pneumoniae KCTC 2242
gm0418 86 Klebsiella pneumoniae Kp52.145
gm0419 90 Klebsiella pneumoniae PMK1
1 977 1 gm0420 70 Klebsiella pneumoniae SB3432
gm0421 81 Klebsiella pneumoniae subsp. pneumoniae 1084
gm0422 87 Klebsiella pneumoniae subsp. pneumoniae 1158
gm0423 87 Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
gm0424 91 Klebsiella pneumoniae subsp. pneumoniae HS11286
gm0425 87 Klebsiella pneumoniae subsp. pneumoniae Kp13
gm0426 79 Klebsiella pneumoniae subsp. pneumoniae KP5-1
gm0427 91 Klebsiella pneumoniae subsp. pneumoniae KPNIH1
gm0428 91 Klebsiella pneumoniae subsp. pneumoniae KPNIH10
gm0429 89 Klebsiella pneumoniae subsp. pneumoniae KPNIH24
gm0430 87 Klebsiella pneumoniae subsp. pneumoniae KPNIH27
gm0431 88 Klebsiella pneumoniae subsp. pneumoniae KPNIH29
gm0432 89 Klebsiella pneumoniae subsp. pneumoniae KPNIH30
gm0433 86 Klebsiella pneumoniae subsp. pneumoniae KPNIH31
gm0434 91 Klebsiella pneumoniae subsp. pneumoniae KPNIH32
gm0435 91 Klebsiella pneumoniae subsp. pneumoniae KPNIH33
gm0436 87 Klebsiella pneumoniae subsp. pneumoniae KPR0928
gm0437 88 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ATCC 700721
gm0438 88 Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
gm0439 87 Klebsiella pneumoniae subsp. pneumoniae PittNDM01
gm0440 86 Klebsiella pneumoniae XH209
1 988 1 gm0441 86 Klebsiella variicola At-22
gm0442 87 Klebsiella variicola DSM 15968
gm0443 89 Klebsiella variicola DX120E
1 gm0444 83 Kosakonia sacchari SP1
1 gm0445 49 Legionella fallonii LLAP-10
1 gm0446 45 Legionella hackeliae ATCC35250
1 gm0447 50 Legionella longbeachae NSW150
1 gm0448 45 Legionella oakridgensis ATCC 33761 DSM 21215 OR-10
1 gm0449 48 Legionella pneumophila 2300/99 Alcoy
gm0450 49 Legionella pneumophila str. Corby
gm0451 44 Legionella pneumophila str. Lens
gm0452 47 Legionella pneumophila str. Paris
gm0453 46 Legionella pneumophila subsp. pneumophila ATCC 43290
gm0454 48 Legionella pneumophila subsp. pneumophila HL06041035
gm0455 46 Legionella pneumophila subsp. pneumophila Lorraine
gm0456 46 Legionella pneumophila subsp. pneumophila LPE509
gm0457 43 Legionella pneumophila subsp. pneumophila str. Hextuple 2q Philadelphia 1 substr. Lp02
gm0458 43 Legionella pneumophila subsp. pneumophila str. Hextuple 3a Philadelphia 1 substr. Lp02
gm0459 46 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
gm0460 41 Legionella pneumophila subsp. pneumophila str. Thunder Bay
1 gm0461 67 Mannheimia haemolytica 89010807N
gm0462 67 Mannheimia haemolytica 89010807N lktA-
gm0463 64 Mannheimia haemolytica D153
gm0464 61 Mannheimia haemolytica D171
gm0465 68 Mannheimia haemolytica D174
gm0466 63 Mannheimia haemolytica M42548
gm0467 67 Mannheimia haemolytica USDA-ARS-USMARC-183
gm0468 64 Mannheimia haemolytica USDA-ARS-USMARC-184
gm0469 63 Mannheimia haemolytica USDA-ARS-USMARC-185
766 1 gm0470 66 Mannheimia haemolytica USMARC 2286
1 gm0471 61 Mannheimia succiniciproducens MBEL55E
1 gm0472 64 Mannheimia varigena USDA-ARS-USMARC-1261
gm0473 63 Mannheimia varigena USDA-ARS-USMARC-1296
gm0474 62 Mannheimia varigena USDA-ARS-USMARC-1312
gm0475 62 Mannheimia varigena USDA-ARS-USMARC-1388
1 333 1 gm0476 57 Marichromatium purpuratum 984 987
1 gm0477 55 Marinobacter adhaerens HP15
1 333 1 gm0478 52 Marinobacter hydrocarbonoclasticus ATCC 49840
gm0479 54 Marinobacter hydrocarbonoclasticus VT8
1 gm0480 44 Marinobacter salarius R9SW1
1 gm0481 48 Marinobacter similis A3d10
1 gm0482 54 Marinobacter sp. BSs20148
1 777 1 gm0483 81 Marinomonas mediterranea MMB-1
1 gm0484 80 Marinomonas posidonica IVIA-Po-181
1 gm0485 83 Marinomonas sp. MWYL1
1 222 1 gm0486 47 Methylococcus capsulatus str. Bath
1 333 1 gm0487 47 Methylomicrobium alcaliphilum 20Z
1 333 1 gm0488 47 Methylomonas methanica MC09
1 333 1 gm0489 44 Methylophaga frappieri JAM7
1 gm0490 47 Methylophaga nitratireducenticrescens JAM1
1 444 1 gm0491 50 Moraxella catarrhalis 25239
gm0492 50 Moraxella catarrhalis 25240
gm0493 50 Moraxella catarrhalis BBH18
1 776 1 gm0494 82 Morganella morganii subsp. morganii KT
1 13,11,11 1 gm0495 132 Moritella viscosa
1 gm0496 48 Nitrosococcus halophilus Nc 4
1 gm0497 48 Nitrosococcus oceani ATCC 19707
1 gm0498 48 Nitrosococcus watsonii C-113
1 gm0499 92 Oceanimonas sp. GK1
1 gm0500 52 Oleispira antarctica RB-8
1 gm0501 79 Pantoea ananatis AJ13355
gm0502 73 Pantoea ananatis LMG 20103
gm0503 80 Pantoea ananatis LMG 5342
gm0504 87 Pantoea ananatis PA13
1 gm0505 80 Pantoea rwandensis ND04
1 gm0506 83 Pantoea sp. At-9b
1 gm0507 85 Pantoea sp. PSNIH1
1 gm0508 87 Pantoea sp. PSNIH2
1 gm0509 80 Pantoea vagans C9-1
1 gm0510 56 Pasteurella multocida 36950
gm0511 59 Pasteurella multocida ATCC 43137
gm0512 61 Pasteurella multocida OH1905
gm0513 59 Pasteurella multocida subsp. multocida OH4807
gm0514 56 Pasteurella multocida subsp. multocida str. 3480
gm0515 55 Pasteurella multocida subsp. multocida str. HB03
gm0516 57 Pasteurella multocida subsp. multocida str. HN06
gm0517 58 Pasteurella multocida subsp. multocida str. Pm70
1 gm0518 79 Pectobacterium atrosepticum 21A
gm0519 78 Pectobacterium atrosepticum JG10-08
gm0520 78 Pectobacterium atrosepticum SCRI1043
1 gm0521 79 Pectobacterium carotovorum subsp. carotovorum PC1
gm0522 78 Pectobacterium carotovorum subsp. carotovorum PCC21
gm0523 78 Pectobacterium carotovorum subsp. odoriferum BC S7
1 gm0524 78 Pectobacterium sp. SCC3193
1 gm0525 76 Pectobacterium wasabiae WPP163
1 11,9,9 1 gm0526 137 Photobacterium gaetbulicola Gung47
1 gm0527 97 Photorhabdus asymbiotica
1 gm0528 62 Plautia stali symbiont
1 gm0529 86 Pluralibacter gergoviae FB2
1 gm0530 83 Proteus mirabilis BB2000
gm0531 85 Proteus mirabilis HI4320
1 gm0532 81 Providencia stuartii ATCC 33672
gm0533 78 Providencia stuartii MRSN 2154
1 gm0534 63 Pseudoalteromonas atlantica T6c
1 10,9,9 1 gm0535 108 Pseudoalteromonas haloplanktis TAC125
1 gm0536 97 Pseudoalteromonas sp. OCN003
1 gm0537 63 Pseudoalteromonas sp. SM9913
1 444 1 gm0538 66 Pseudomonas aeruginosa 19BR
gm0539 66 Pseudomonas aeruginosa 213BR
gm0540 67 Pseudomonas aeruginosa B136-33
gm0541 64 Pseudomonas aeruginosa c7447m C7447m
gm0542 65 Pseudomonas aeruginosa DK2
gm0543 66 Pseudomonas aeruginosa F22031
gm0544 67 Pseudomonas aeruginosa FRD1
gm0545 69 Pseudomonas aeruginosa LES400
gm0546 68 Pseudomonas aeruginosa LES431
gm0547 69 Pseudomonas aeruginosa LESB58
gm0548 65 Pseudomonas aeruginosa LESB65
gm0549 65 Pseudomonas aeruginosa LESlike1
gm0550 65 Pseudomonas aeruginosa LESlike4
gm0551 65 Pseudomonas aeruginosa LESlike5
gm0552 64 Pseudomonas aeruginosa LESlike7
gm0553 66 Pseudomonas aeruginosa M18
gm0554 68 Pseudomonas aeruginosa MTB-1
gm0555 72 Pseudomonas aeruginosa NCGM 1900
gm0556 73 Pseudomonas aeruginosa NCGM 1984
gm0557 70 Pseudomonas aeruginosa NCGM2.S1
gm0558 67 Pseudomonas aeruginosa PA1
gm0559 67 Pseudomonas aeruginosa PA1R
gm0560 67 Pseudomonas aeruginosa PA38182
gm0561 67 Pseudomonas aeruginosa PA7
gm0562 66 Pseudomonas aeruginosa PA96
gm0563 65 Pseudomonas aeruginosa PACS2
gm0564 64 Pseudomonas aeruginosa PAO1
gm0565 64 Pseudomonas aeruginosa PAO1-VE13
gm0566 64 Pseudomonas aeruginosa PAO1-VE2
gm0567 64 Pseudomonas aeruginosa PAO1H2O
gm0568 64 Pseudomonas aeruginosa PAO581
gm0569 65 Pseudomonas aeruginosa PSE305
gm0570 66 Pseudomonas aeruginosa RP73
gm0571 66 Pseudomonas aeruginosa SCV20265
gm0572 66 Pseudomonas aeruginosa UCBPP-PA14
gm0573 73 Pseudomonas aeruginosa VRFPA04
gm0574 67 Pseudomonas aeruginosa YL84
1 gm0575 72 Pseudomonas alkylphenolia KL28
1 gm0576 62 Pseudomonas balearica DSM 6083 DSM6083 SP1402
1 gm0577 66 Pseudomonas brassicacearum DF41
gm0578 68 Pseudomonas brassicacearum subsp. brassicacearum NFM421
1 gm0579 72 Pseudomonas chlororaphis PA23
gm0580 81 Pseudomonas chlororaphis PCL1606
gm0581 70 Pseudomonas chlororaphis subsp. aurantiaca JD37
1 gm0582 67 Pseudomonas cichorii JBC1
1 gm0583 76 Pseudomonas cremoricolorata ND07
gm0584 64 Pseudomonas denitrificans ATCC 13867
1 gm0585 78 Pseudomonas entomophila L48
1 gm0586 69 Pseudomonas fluorescens A506
gm0587 66 Pseudomonas fluorescens F113
gm0588 69 Pseudomonas fluorescens LBUM223
gm0589 71 Pseudomonas fluorescens PCL1751
gm0590 74 Pseudomonas fluorescens Pf0-1
gm0591 69 Pseudomonas fluorescens PICF7
gm0592 67 Pseudomonas fluorescens SBW25
gm0593 70 Pseudomonas fluorescens UK4
1 gm0594 67 Pseudomonas fulva 12-X
1 gm0595 62 Pseudomonas knackmussii B13
1 gm0596 68 Pseudomonas mandelii JR-1
1 gm0597 67 Pseudomonas mendocina NK-01
gm0598 67 Pseudomonas mendocina ymp
1 gm0599 69 Pseudomonas monteilii SB3078
gm0600 67 Pseudomonas monteilii SB3101
gm0601 81 Pseudomonas mosselii SJ10
1 gm0602 77 Pseudomonas parafulva CRS01-1
1 gm0603 73 Pseudomonas plecoglossicida NyZ12
1 gm0604 65 Pseudomonas poae RE1-1-14
1 gm0605 72 Pseudomonas protegens Cab57
gm0606 73 Pseudomonas protegens CHA0
gm0607 74 Pseudomonas protegens Pf-5
1 gm0608 69 Pseudomonas pseudoalcaligenes
gm0609 69 Pseudomonas pseudoalcaligenes CECT 5344 CECT5344
1 gm0610 66 Pseudomonas putida BIRD-1
gm0611 74 Pseudomonas putida DLL-E4
gm0612 62 Pseudomonas putida DOT-T1E
gm0613 76 Pseudomonas putida F1
gm0614 76 Pseudomonas putida GB-1
gm0615 70 Pseudomonas putida H8234
gm0616 72 Pseudomonas putida HB3267 PC9
gm0617 76 Pseudomonas putida KT2440
gm0618 75 Pseudomonas putida NBRC 14164
gm0619 76 Pseudomonas putida ND6
gm0620 61 Pseudomonas putida S12
gm0621 69 Pseudomonas putida S16
gm0622 77 Pseudomonas putida W619
1 gm0623 74 Pseudomonas resinovorans NBRC 106553
1 gm0624 72 Pseudomonas rhizosphaerae DSM 16299
1 gm0625 66 Pseudomonas savastanoi pv. phaseolicola 1448A BAA-978
1 gm0626 65 Pseudomonas simiae WCS417
1 gm0627 55 Pseudomonas sp. 20 BN
1 gm0628 75 Pseudomonas sp. FGI182
1 gm0629 77 Pseudomonas sp. MRSN12121
1 gm0630 59 Pseudomonas sp. MT-1
1 gm0631 72 Pseudomonas sp. StFLB209
1 gm0632 68 Pseudomonas sp. TKP
1 gm0633 72 Pseudomonas sp. UW4
1 gm0634 83 Pseudomonas sp. VLB120
1 gm0635 76 Pseudomonas sp. WCS374
1 gm0636 63 Pseudomonas stutzeri 19SMN4
gm0637 61 Pseudomonas stutzeri 28a24
gm0638 62 Pseudomonas stutzeri A1501
gm0639 61 Pseudomonas stutzeri ATCC 17588 LMG 11199
gm0640 64 Pseudomonas stutzeri CCUG 29243
gm0641 62 Pseudomonas stutzeri DSM 10701
gm0642 62 Pseudomonas stutzeri DSM 4166
gm0643 63 Pseudomonas stutzeri RCH2
1 gm0644 63 Pseudomonas syringae CC1557
gm0645 66 Pseudomonas syringae pv. syringae B728a
gm0646 69 Pseudomonas syringae pv. tomato str. DC3000
1 gm0647 50 Pseudoxanthomonas spadix BD-a59
1 gm0648 52 Pseudoxanthomonas suwonensis 11-1
gm0649 48 Pseudoxanthomonas suwonensis J1
1 gm0650 50 Psychrobacter arcticus 273-4
1 gm0651 49 Psychrobacter cryohalolentis K5
1 gm0652 49 Psychrobacter sp. G
1 gm0653 61 Psychrobacter sp. PRwf-1
1 gm0654 86 Psychromonas ingrahamii 37
1 gm0655 92 Psychromonas sp. CNPT3
1 gm0656 77 Rahnella aquatilis CIP 78.65 ATCC 33071
gm0657 77 Rahnella aquatilis HX2
1 gm0658 77 Rahnella sp. Y9602
1 gm0659 80 Raoultella ornithinolytica B6
gm0660 86 Raoultella ornithinolytica S12
1 gm0661 51 Rhodanobacter denitrificans 2APBS1
1 gm0662 41 Saccharophagus degradans 2-40
1 gm0663 88 Salmonella bongori N268-08
gm0664 88 Salmonella bongori NCTC 12419
gm0665 84 Salmonella bongori serovar 48 z41 -- str. RKS3044
1 877 1 gm0666 83 Salmonella enterica subsp. arizonae serovar 62 z36 str. RKS2983
gm0667 88 Salmonella enterica subsp. arizonae serovar 62 z4 z23 RSK2980
gm0668 91 Salmonella enterica subsp. enterica serovar 4 5 12 i str. 08-1736
gm0669 85 Salmonella enterica subsp. enterica serovar Abaetetuba str. ATCC 35640
gm0670 89 Salmonella enterica subsp. enterica serovar Abony str. 0014
gm0671 87 Salmonella enterica subsp. enterica serovar Agona str. 24249
gm0672 87 Salmonella enterica subsp. enterica serovar Agona str. 460004 2-1
gm0673 87 Salmonella enterica subsp. enterica serovar Agona str. SL483
gm0674 85 Salmonella enterica subsp. enterica serovar Anatum str. ATCC BAA-1592
gm0675 86 Salmonella enterica subsp. enterica serovar Anatum str. CDC 06-0532
gm0676 83 Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1175
gm0677 86 Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
gm0678 77 Salmonella enterica subsp. enterica serovar Bovismorbificans str. 3114
gm0679 87 Salmonella enterica subsp. enterica serovar Bredeney str. CFSAN001080
gm0680 86 Salmonella enterica subsp. enterica serovar Choleraesuis C500
gm0681 89 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
gm0682 88 Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050
gm0683 81 Salmonella enterica subsp. enterica serovar Dublin
gm0684 87 Salmonella enterica subsp. enterica serovar Dublin str. CT 02021853
gm0685 87 Salmonella enterica subsp. enterica serovar Enteritidis Durban
gm0686 88 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
gm0687 86 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE10-10052
gm0688 87 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE11-10058
gm0689 85 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE2-98984-6
gm0690 85 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE3-98983-4
gm0691 86 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE4-0317-8
gm0692 87 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE5-1104-2
gm0693 87 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE6-00219-16
gm0694 86 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE7-100819
gm0695 84 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE8-1021710
gm0696 83 Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE9-10012
gm0697 86 Salmonella enterica subsp. enterica serovar Enteritidis SEJ
gm0698 90 Salmonella enterica subsp. enterica serovar Enteritidis str. 77-1427
gm0699 89 Salmonella enterica subsp. enterica serovar Enteritidis str. CDC 2010K 0968 CDC 2010K-0968
gm0700 89 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090135
gm0701 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090193
gm0702 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090195
gm0703 88 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090332
gm0704 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090530
gm0705 85 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090531
gm0706 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090641
gm0707 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090698
gm0708 84 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090884
gm0709 78 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100088
gm0710 78 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100089
gm0711 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100100
gm0712 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100101
gm0713 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100103
gm0714 84 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100130
gm0715 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100131
gm0716 85 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100134
gm0717 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100325
gm0718 85 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110221
gm0719 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110222
gm0720 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110223
gm0721 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110353
gm0722 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110354
gm0723 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110355
gm0724 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110356
gm0725 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110357
gm0726 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110358
gm0727 85 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110359
gm0728 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110360
gm0729 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110361
gm0730 88 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111095
gm0731 89 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111174
gm0732 88 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111175
gm0733 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111510
gm0734 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111514
gm0735 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111515
gm0736 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111554
gm0737 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111561
gm0738 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111576
gm0739 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120002
gm0740 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120003
gm0741 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120005
gm0742 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120007
gm0743 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120008
gm0744 77 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120009
gm0745 79 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120051
gm0746 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120200
gm0747 72 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120213
gm0748 79 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120219
gm0749 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120229
gm0750 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120240
gm0751 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120356
gm0752 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120469
gm0753 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120496
gm0754 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120497
gm0755 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120498
gm0756 76 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120505
gm0757 75 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120528
gm0758 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120544
gm0759 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120548
gm0760 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120555
gm0761 75 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120580
gm0762 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120581
gm0763 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120590
gm0764 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120597
gm0765 63 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120677
gm0766 76 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120685
gm0767 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120686
gm0768 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120687
gm0769 64 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120697
gm0770 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120722
gm0771 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120734
gm0772 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120738
gm0773 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120765
gm0774 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120773
gm0775 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120774
gm0776 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120775
gm0777 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120776
gm0778 89 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120916
gm0779 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120917
gm0780 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120918
gm0781 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120925
gm0782 78 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120927
gm0783 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120929
gm0784 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120963
gm0785 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120968
gm0786 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120969
gm0787 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120970
gm0788 74 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120994
gm0789 43 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121004
gm0790 88 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121175
gm0791 90 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121176
gm0792 92 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121177
gm0793 93 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121178
gm0794 95 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121179
gm0795 93 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121180
gm0796 61 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121541
gm0797 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121542
gm0798 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121671
gm0799 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121672
gm0800 78 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121689
gm0801 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121744
gm0802 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121746
gm0803 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121747
gm0804 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121748
gm0805 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121750
gm0806 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121751
gm0807 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121753
gm0808 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121765
gm0809 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121812
gm0810 82 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121825
gm0811 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121826
gm0812 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121969
gm0813 79 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121970
gm0814 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121976
gm0815 80 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121986
gm0816 83 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121989
gm0817 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121990
gm0818 79 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122022
gm0819 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122026
gm0820 81 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122031
gm0821 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122033
gm0822 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122045
gm0823 86 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130345
gm0824 87 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130346
gm0825 64 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130347
gm0826 79 Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130348
gm0827 87 Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
gm0828 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19930684
gm0829 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19940857
gm0830 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19942384
gm0831 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19943269
gm0832 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19960848
gm0833 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19961622
gm0834 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970510
gm0835 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970769
gm0836 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19971331
gm0837 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19980677
gm0838 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981522
gm0839 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981857
gm0840 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19982831
gm0841 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19983126
gm0842 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19992322
gm0843 73 Salmonella enterica subsp. enterica serovar Enteritidis str. SA19994216
gm0844 59 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20082034
gm0845 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083456
gm0846 82 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083636
gm0847 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084384
gm0848 76 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084644
gm0849 71 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084824
gm0850 48 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20085285
gm0851 47 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090419
gm0852 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090435
gm0853 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090877
gm0854 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20091739
gm0855 102 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20092320
gm0856 102 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093266
gm0857 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093421
gm0858 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093430
gm0859 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093538
gm0860 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093543
gm0861 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093784
gm0862 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093788
gm0863 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093950
gm0864 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093977
gm0865 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094079
gm0866 74 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094177
gm0867 71 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094301
gm0868 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094350
gm0869 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094352
gm0870 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094383
gm0871 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094389
gm0872 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094521
gm0873 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094642
gm0874 81 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094682
gm0875 84 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094803
gm0876 83 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095309
gm0877 68 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095440
gm0878 47 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100239
gm0879 65 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100349
gm0880 77 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20121703
gm0881 80 Salmonella enterica subsp. enterica serovar Enteritidis str. SA20123395
gm0882 79 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
gm0883 78 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
gm0884 75 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
gm0885 89 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
gm0886 88 Salmonella enterica subsp. enterica serovar Heidelberg str. B182
gm0887 88 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064
gm0888 88 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
gm0889 89 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
gm0890 86 Salmonella enterica subsp. enterica serovar Infantis 1326/28
gm0891 88 Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
gm0892 88 Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20
gm0893 86 Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1903
gm0894 86 Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1921
gm0895 87 Salmonella enterica subsp. enterica serovar Newport str. CDC 2010K-2159
gm0896 89 Salmonella enterica subsp. enterica serovar Newport str. CVM 21538
gm0897 90 Salmonella enterica subsp. enterica serovar Newport str. CVM 21550
gm0898 87 Salmonella enterica subsp. enterica serovar Newport str. CVM 21554
gm0899 91 Salmonella enterica subsp. enterica serovar Newport str. CVM 22425
gm0900 91 Salmonella enterica subsp. enterica serovar Newport str. CVM 22462
gm0901 89 Salmonella enterica subsp. enterica serovar Newport str. CVM 22513
gm0902 89 Salmonella enterica subsp. enterica serovar Newport str. CVM N1543
gm0903 86 Salmonella enterica subsp. enterica serovar Newport str. CVM N18486
gm0904 89 Salmonella enterica subsp. enterica serovar Newport str. SL254
gm0905 88 Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1927
gm0906 92 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
gm0907 103 Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50503
gm0908 105 Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50973
gm0909 86 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU 12601 AKU12601
gm0910 87 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
gm0911 87 Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 SGSC4150
gm0912 87 Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594
gm0913 72 Salmonella enterica subsp. enterica serovar Pullorum
gm0914 81 Salmonella enterica subsp. enterica serovar Pullorum str. S06004
gm0915 87 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
gm0916 88 Salmonella enterica subsp. enterica serovar Tennessee str. TXSC TXSC08-19
gm0917 82 Salmonella enterica subsp. enterica serovar Thompson str. RM6836
gm0918 83 Salmonella enterica subsp. enterica serovar Typhi str. CT18
gm0919 81 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
gm0920 81 Salmonella enterica subsp. enterica serovar Typhi str. Ty2
gm0921 81 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
gm0922 89 Salmonella enterica subsp. enterica serovar Typhimurium 138736
gm0923 88 Salmonella enterica subsp. enterica serovar Typhimurium ATCC 13311
gm0924 89 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
gm0925 87 Salmonella enterica subsp. enterica serovar Typhimurium str. 798
gm0926 87 Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-0870
gm0927 93 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
gm0928 89 Salmonella enterica subsp. enterica serovar Typhimurium str. DT104
gm0929 87 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2
gm0930 90 Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553
gm0931 88 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
gm0932 90 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
gm0933 90 Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
gm0934 88 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
gm0935 87 Salmonella enterica subsp. enterica serovar Typhimurium str. U288
gm0936 89 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
gm0937 90 Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899
gm0938 89 Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
gm0939 89 Salmonella enterica subsp. enterica serovar Typhimurium VNP20009
1 gm0940 40 secondary endosymbiont of Ctenarytaina eucalypti
1 gm0941 38 secondary endosymbiont of Heteropsylla cubana
1 877 1 gm0942 87 Serratia liquefaciens ATCC 27592
gm0943 88 Serratia liquefaciens HUMV-21
1 gm0944 85 Serratia marcescens FGI94
gm0945 90 Serratia marcescens SM39
gm0946 90 Serratia marcescens subsp. marcescens Db11
gm0947 84 Serratia marcescens WW4
1 gm0948 82 Serratia multitudinisentens RB-25
1 gm0949 83 Serratia plymuthica 4Rx13
gm0950 88 Serratia plymuthica AS9
gm0951 85 Serratia plymuthica RVH1
gm0952 87 Serratia plymuthica S13
gm0953 67 Serratia plymuthica V4
1 gm0954 87 Serratia proteamaculans 568
1 gm0955 88 Serratia sp. AS12
1 gm0956 88 Serratia sp. AS13
1 gm0957 93 Serratia sp. FS14
1 gm0958 84 Serratia sp. SCBI
1 gm0959 36 Serratia symbiotica str. Cinara cedri
1 gm0960 102 Shewanella amazonensis SB2B
1 gm0961 110 Shewanella baltica BA175
gm0962 100 Shewanella baltica OS117
gm0963 122 Shewanella baltica OS155
gm0964 109 Shewanella baltica OS185
gm0965 109 Shewanella baltica OS195
gm0966 112 Shewanella baltica OS223
gm0967 107 Shewanella baltica OS678
1 gm0968 97 Shewanella denitrificans OS217
1 gm0969 99 Shewanella frigidimarina NCIMB 400
1 gm0970 128 Shewanella halifaxensis HAW-EB4
1 gm0971 102 Shewanella loihica PV-4
1 gm0972 106 Shewanella oneidensis MR-1
1 12,11,11 1 gm0973 149 Shewanella pealeana ATCC 700345
1 gm0974 94 Shewanella piezotolerans WP3
1 gm0975 102 Shewanella putrefaciens 200
gm0976 103 Shewanella putrefaciens CN-32
1 gm0977 134 Shewanella sediminis HAW-EB3
1 gm0978 108 Shewanella sp. ANA-3
1 gm0979 105 Shewanella sp. MR-4
1 gm0980 107 Shewanella sp. MR-7
1 gm0981 101 Shewanella sp. W3-18-1
1 gm0982 133 Shewanella violacea DSS12
1 gm0983 134 Shewanella woodyi ATCC 51908
1 877 1 gm0984 103 Shigella boydii CDC 3083-94 BS512
gm0985 94 Shigella boydii Sb227
1 gm0986 88 Shigella dysenteriae 1617
gm0987 87 Shigella dysenteriae Sd197
1 gm0988 99 Shigella flexneri
gm0989 104 Shigella flexneri 2002017
gm0990 99 Shigella flexneri 2003036
gm0991 103 Shigella flexneri 2a str. 2457T
gm0992 100 Shigella flexneri 2a str. 301
gm0993 99 Shigella flexneri 5 str. 8401
gm0994 100 Shigella flexneri Shi06HN006
1 gm0995 98 Shigella sonnei 53G
gm0996 98 Shigella sonnei Ss046
1 gm0997 90 Shimwellia blattae DSM 4481 NBRC 105725
1 gm0998 42 Simiduia agarivorans SA1 DSM 21679
1 gm0999 76 Sodalis glossinidius str. morsitans
1 gm1000 78 Sodalis praecaptivus HS1
1 gm1001 46 Spiribacter salinus M19-40
1 gm1002 46 Spiribacter sp. UAH-SP71
1 322 1 gm1003 71 Stenotrophomonas maltophilia 13637
gm1004 77 Stenotrophomonas maltophilia D457
gm1005 75 Stenotrophomonas maltophilia JV3
gm1006 76 Stenotrophomonas maltophilia K279a
gm1007 74 Stenotrophomonas maltophilia R551-3
1 gm1008 67 Stenotrophomonas rhizophila DSM14405
1 gm1009 89 synthetic Escherichia coli C321.deltaA
1 gm1010 47 Tatlockia micdadei ATCC33218
1 gm1011 41 Teredinibacter turnerae T7901
1 gm1012 51 Thalassolituus oleivorans MIL-1
gm1013 49 Thalassolituus oleivorans R6-15
1 gm1014 43 Thioalkalimicrobium aerophilum AL3
1 gm1015 41 Thioalkalimicrobium cyclicum ALM1
1 gm1016 46 Thioalkalivibrio nitratireducens DSM 14787
1 gm1017 49 Thioalkalivibrio sp. K90mix
1 gm1018 45 Thioalkalivibrio sulfidiphilus HL-EbGr7 HL-EbGR7
1 gm1019 48 Thioalkalivibrio thiocyanoxidans ARh 4
1 gm1020 53 Thiocystis violascens DSM 198
1 gm1021 48 Thioflavicoccus mobilis 8321
1 gm1022 40 Thiolapillus brandeum Hiromi 1
1 gm1023 45 Thiomicrospira crunogena XCL-2
1 gm1024 45 Thioploca ingrica
1 gm1025 92 Tolumonas auensis DSM 9187
1 gm1026 106 Vibrio alginolyticus NBRC 15630 ATCC 17749
1 gm1027 87 Vibrio anguillarum 775
gm1028 94 Vibrio anguillarum NB10
1 gm1029 96 Vibrio campbellii ATCC BAA-1116
gm1030 121 Vibrio campbellii ATCC BAA-1116 BB120
1 gm1031 94 Vibrio cholerae 10432-62
gm1032 104 Vibrio cholerae 1154-74
gm1033 99 Vibrio cholerae 2012EL-2176
gm1034 81 Vibrio cholerae H1
gm1035 98 Vibrio cholerae IEC224
gm1036 95 Vibrio cholerae LMA3984-4
gm1037 97 Vibrio cholerae M66-2
gm1038 98 Vibrio cholerae MJ-1236
gm1039 90 Vibrio cholerae MS6
gm1040 94 Vibrio cholerae O1 biovar El Tor FJ147
gm1041 98 Vibrio cholerae O1 biovar El Tor str. N16961
gm1042 79 Vibrio cholerae O1 str. 2010EL-1786
2*96 gm1043 192 Vibrio cholerae O395
1 gm1044 87 Vibrio coralliilyticus OCN014
gm1045 117 Vibrio coralliilyticus RE98
1 gm1046 100 Vibrio furnissii NCTC 11218
1 gm1047 104 Vibrio nigripulchritudo SFn1
1 12,11,11 1 gm1048 126 Vibrio parahaemolyticus BB22OP
1 gm1049 130 Vibrio parahaemolyticus O1 K33 str. CDC K4557
gm1050 131 Vibrio parahaemolyticus O1 Kuk str. FDA R31
gm1051 127 Vibrio parahaemolyticus RIMD 2210633 O3 K6 substr. RIMD 2210633
gm1052 122 Vibrio parahaemolyticus UCM-V493
1 gm1053 121 Vibrio sp. EJY3
1 gm1054 125 Vibrio sp. Ex25 EX25
1 gm1055 114 Vibrio tasmaniensis LGP32
1 gm1056 118 Vibrio tubiashii ATCC 19109
1 gm1057 109 Vibrio vulnificus 93U204
gm1058 113 Vibrio vulnificus CMCP6
gm1059 114 Vibrio vulnificus MO6-24/O
gm1060 113 Vibrio vulnificus YJ016
1 gm1061 34 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
1 gm1062 53 Xanthomonas albilineans GPE PC73
1 gm1063 55 Xanthomonas axonopodis pv. citri str. 306
gm1064 54 Xanthomonas axonopodis pv. citrumelo F1
gm1065 55 Xanthomonas axonopodis Xac29-1
1 222 1 gm1066 55 Xanthomonas campestris 17
gm1067 55 Xanthomonas campestris pv. campestris B100
gm1068 57 Xanthomonas campestris pv. campestris str. 8004
gm1069 58 Xanthomonas campestris pv. campestris str. ATCC 33913
gm1070 58 Xanthomonas campestris pv. raphani 756C
gm1071 59 Xanthomonas campestris pv. vesicatoria str. 85-10
1 222 1 gm1072 55 Xanthomonas citri subsp. citri 5208
gm1073 55 Xanthomonas citri subsp. citri A306
gm1074 57 Xanthomonas citri subsp. citri Aw12879
gm1075 57 Xanthomonas citri subsp. citri AW13
gm1076 57 Xanthomonas citri subsp. citri AW14
gm1077 57 Xanthomonas citri subsp. citri AW15
gm1078 57 Xanthomonas citri subsp. citri AW16
gm1079 55 Xanthomonas citri subsp. citri BL18
gm1080 55 Xanthomonas citri subsp. citri FB19
gm1081 55 Xanthomonas citri subsp. citri gd2
gm1082 55 Xanthomonas citri subsp. citri gd3
gm1083 55 Xanthomonas citri subsp. citri jx4
gm1084 55 Xanthomonas citri subsp. citri jx5
gm1085 55 Xanthomonas citri subsp. citri mf20
gm1086 55 Xanthomonas citri subsp. citri MN10
gm1087 55 Xanthomonas citri subsp. citri MN11
gm1088 55 Xanthomonas citri subsp. citri MN12
gm1089 55 Xanthomonas citri subsp. citri NT17
gm1090 55 Xanthomonas citri subsp. citri UI6
gm1091 55 Xanthomonas citri subsp. citri UI7
1 gm1092 55 Xanthomonas fuscans subsp. fuscans 4834-R
1 gm1093 55 Xanthomonas oryzae pv. oryzae KACC 10331 KACC10331
gm1094 54 Xanthomonas oryzae pv. oryzae MAFF 311018
gm1095 54 Xanthomonas oryzae pv. oryzae PXO86
gm1096 55 Xanthomonas oryzae pv. oryzae PXO99A
gm1097 54 Xanthomonas oryzae pv. oryzicola BLS256
gm1098 57 Xanthomonas oryzae pv. oryzicola CFBP7342
1 gm1099 57 Xanthomonas sacchari R1
1 877 1 gm1100 82 Xenorhabdus bovienii CS03
gm1101 88 Xenorhabdus bovienii SS-2004
1 gm1102 79 Xenorhabdus doucetiae FRM16
1 gm1103 81 Xenorhabdus nematophila AN6/1
gm1104 81 Xenorhabdus nematophila ATCC 19061
1 gm1105 80 Xenorhabdus poinarii G6
1 222 1 gm1106 53 Xylella fastidiosa 9a5c
gm1107 52 Xylella fastidiosa M12
gm1108 50 Xylella fastidiosa M23
gm1109 50 Xylella fastidiosa MUL0034
gm1110 49 Xylella fastidiosa subsp. fastidiosa GB514
gm1111 55 Xylella fastidiosa subsp. sandyi Ann-1
gm1112 49 Xylella fastidiosa Temecula1
1 gm1113 84 Yersinia aldovae 670-83
1 gm1114 79 Yersinia enterocolitica 2516-87
877 1 gm1115 85 Yersinia enterocolitica 8081
gm1116 83 Yersinia enterocolitica subsp. enterocolitica 8081
gm1117 73 Yersinia enterocolitica subsp. palearctica 105.5Rr
gm1118 72 Yersinia enterocolitica subsp. palearctica Y11
gm1119 79 Yersinia enterocolitica type O 5 str. YE53/03
gm1120 86 Yersinia enterocolitica WA
1 gm1121 86 Yersinia frederiksenii Y225
1 gm1122 82 Yersinia intermedia Y228
1 gm1123 85 Yersinia kristensenii ATCC 33639
gm1124 85 Yersinia kristensenii Y231
1 gm1125 140 Yersinia pestis A1122
gm1126 141 Yersinia pestis Angola
gm1127 142 Yersinia pestis Antiqua
877 1 gm1128 73 Yersinia pestis biovar Medievalis str. Harbin 35
gm1129 73 Yersinia pestis biovar Microtus str. 91001
gm1130 71 Yersinia pestis CO92
gm1131 71 Yersinia pestis D106004
gm1132 74 Yersinia pestis D182038
gm1133 72 Yersinia pestis Dodson
gm1134 70 Yersinia pestis El Dorado
gm1135 71 Yersinia pestis Harbin35
gm1136 72 Yersinia pestis Java9
gm1137 74 Yersinia pestis KIM10+
gm1138 75 Yersinia pestis KIM5
gm1139 72 Yersinia pestis Nairobi
gm1140 73 Yersinia pestis Nepal516
gm1141 73 Yersinia pestis Nicholisk 41
gm1142 72 Yersinia pestis PBM19
73+74 gm1143 147 Yersinia pestis Pestoides F
gm1144 74 Yersinia pestis Pestoides G
gm1145 71 Yersinia pestis Shasta
gm1146 74 Yersinia pestis str. Pestoides B
gm1147 69 Yersinia pestis Z176003
1 gm1148 83 Yersinia pseudotuberculosis 1
877 1 gm1149 82 Yersinia pseudotuberculosis ATCC 6904
gm1150 84 Yersinia pseudotuberculosis EP2/+
gm1151 87 Yersinia pseudotuberculosis IP 31758
gm1152 87 Yersinia pseudotuberculosis IP 32953
gm1153 87 Yersinia pseudotuberculosis IP 32953 IP32953
gm1154 86 Yersinia pseudotuberculosis MD67
gm1155 170 Yersinia pseudotuberculosis PB1/+
gm1156 88 Yersinia pseudotuberculosis str. PA3606 Pa3606
2*85 gm1157 170 Yersinia pseudotuberculosis YPIII
1 gm1158 82 Yersinia rohdei YRA
1 gm1159 84 Yersinia ruckeri Big Creek 74
gm1160 82 Yersinia ruckeri YRB
1 gm1161 88 Yersinia similis 228

Alpha[modifier | modifier le wikicode]

alpha blocs[modifier | modifier le wikicode]

alpha blocs
lien blocs 16s total aas avec sans total page alf001-34 Notes
alf001 5*16atcgca235-atgf 9 60 15 45 16-atcgca-35 16-gcaatc-35 16-atc-35 16-gca-35 16, 235
alf010 2*16atcgca235-atgf 48 6 42 sans 16 incomplets
alf011 2*16atcgca235-atgf 48 6 42 atgf 30 2*16s23s
4 autres 1-3 1 16atcgca23
alf012 3*16atcgca-cds-23-cds-5-atgf 55 12 43 cds 3 autres 1-3
16atcgca-cds-cds-23-cds-5-atgf cds, atgf 13 16atcgca235-cgg
63 total 60 0 3 différents
alf013 3*16atcgca235-atgf 56 9 47 3*16atcgca-cds-23-cds-5-atgf
3 16atcgca-cds-cds-23-cds-5-atgf
alf014 agr 5*16atcgca-cds-23-5-atgf 58 15 43
5
alf015 4*16atcgca-cds-23-5-atgf 57 15 42
16atcgca23-5-atgf 5
alf017 4*16atcgca235-atgf 56 12 44
4
alf020 16s-cds, 23s-5s 37 0 37
alf021 16s-cds, 23s-5s 3 35 0 35
alf025 16s-cds-cds, 23s-5s 37 0 37
alf029 2*16atcgca235-atgf 51 9 42
16atcgca235-cgg 3
alf030 3*16atcgca235 54 6 48
3
alf031 abq 5*16atcgca235 88 21 67
3*16atcgca235-atgf 9
16atcgca23
alf033 4*16atcgca235-atgf 83 20 63
4*16atcgca235 9
16s23s
alf034 4*16atcgca235-atgf 9 84 20 64
4*16atcgca235
16s23s 66
lien blocs 16s total aas avec sans total page alf035-159 Notes
alf035 2*16atcgca235-atgf 10 43 6 37 16-atcgca-35 16-gcaatc-35 16-atc-35 16-gca-35 16, 235
alf036 2*16atcgca235-atgf 45 6 39 sans 13 2
alf037 2*16atcgca235-atgf 42 6 36 atgf 19 8
alf038 2*16atcgca-cds-235-atgf 43 6 37 autres 1-3
alf039 2*16atcgca235-atgf 43 6 37 cds 1
cds, atgf 14
alf043 2*16atcgca-cds-235-atgf 4 43 6 37 57 total 46 9 2
alf044 2*16atcgca-cds-235-atgf 43 6 37
alf046 2*16atcgca-cds-235-atgf 8 43 6 37
alf047 3*16atcgca235-atgf 54 9 45
alf048 16atcgca235 60 2 58
alf049 2*16atcgca235 64 4 60
alf052 2*16atcgca235 12 57 4 53
alf053 2*16atcgca235 56 4 52
alf054 2*16atcgca235 52 4 48
alf055 16atcgca235 50 2 48
alf056 2*16atcgca235-atgf 49 6 43
alf057 3*16atcgca-cds-235-atgf 55 9 46
alf071 3*16atcgca-cds-235-atgf 11 55 9 46
alf105 16-gca-atc-235-atgf 42 3 39
alf111 3*16-gca-atc-235-atgf 46 9 37
alf117 2*16atcgca235 43 4 39
alf123 2*16atcgca235-atgf 52 6 46
alf130 16s, 23s5s 2 36 0 36
alf131 16s, 23s5s 37 0 37
alf146 4*16atcgca235-atgf 5 60 12 48
alf159 16atcgca235 53 2 51
alf162 4*16-gca-atc-235-atgf 5 58 14 44
16-gca-atc-cds-235 57
lien blocs 16s total aas avec sans total page alf166-317 Notes
alf166 5*16-gca-atc-235-atgf 7 66 15 51 16-atcgca-35 16-gcaatc-35 16-atc-35 16-gca-35 16, 235
alf174 2*16atcgca235-atgf 55 6 49 sans 10 2 2 différents
atgf 35 9 16atcgca23-cds-5-atgf
alf187 4*16atcgca235-atgf 6 72 14 58 autres 1-3
2*16-gca-235 cds
cds, atgf 4
alf198 16atcgca235 16 58 2 56 62 total 49 9 2 2
alf202 3*16atcgca235-atgf 59 9 50
alf203 oan 4*16atcgca-cds-235-atgf 61 12 49
alf212 4*16atcgca235-atgf 62 12 50
alf218 4*16-gca-atc-235-atgf 61 12 49
alf223 4*16atcgca235 6 70 14 56
2*16atcgca235-atgf
alf224 3*16atcgca235-atgf 3 54 9 45
alf298 rtb 16s,235s 2 33 0 33
alf301 16s,235s 39 0 39
alf303 16atcgca235 5 38 2 36
alf304 16atcgca235 38 2 36
alf305 2*16atcgca235-atgf 54 8 46
16atcgca235
alf306 5*16atcgca235-atgf 5 64 15 49
alf307 2*16atcgca235-atgf 3 56 9 47
16atcgca23-cds-5-atgf
alf308 3*16atcgca235-atgf 6 56 9 47
alf309 3*16atcgca235-atgf 56 9 47
alf317 2*16atcgca235 3 62 7 55
16atcgca235-atgf 62
lien blocs 16s total aas avec sans total page alf321-343 Notes
alf321 2*16atcgca235 3 63 7 56 16-atcgca-35 16-gcaatc-35 16-atc-35 16-gca-35 16, 235
16atcgca235-atgf sans 5 0 1
atgf 8 4
alf326 16atcgca235-atgf 1 47 3 44 autres 1-3
cds
alf329 3*16atcgca235-atgf 4 61 11 50 cds, atgf
16atcgca235 18 total 13 0 4 0 1
alf330 4*16-atc-235-atgf 7 58 8 50
alf331 16s,235s 34 0 34
alf341 2*16atcgca235 55 4 51
alf343 3*16atcgca235-atgf 3 52 9 43
18
lien blocs 16s total aas avec sans total page total Notes
70 16-atcgca-35 16-gcaatc-35 16-atc-35 16-gca-35 16, 235 incomplets
sans 44 0 0 2 5 2*16s23s
atgf 92 17 4 0 0 16atcgca23
Moyenne 53 8 46 autres 1-3 1 0 0 0 0 autres 1-3
ecartype 11 5 8 cds 0 1 0 0 3 16atcgca235-cgg
max 88 21 67 cds, atgf 31 0 0 0 0 différents
min 33 0 33 200 total 168 18 4 2 8 3*16atcgca-cds-23-cds-5-atgf
16atcgca-cds-cds-23-cds-5-atgf
16atcgca-23-cds-5-atgf

alpha notes[modifier | modifier le wikicode]

  • Lien tableur: alpha notes
  • Légende:
  • Notes du tableau des blocs, pour mémoire, les génomes étudiés ont très peu de variations et d'altérations
    - incomplets   2*16s23s  16atcgca23
    - Autres 1-3    16atcgca235-cgg
    - différents
    3*16atcgca-cds-23-cds-5-atgf
    16atcgca-cds-cds-23-cds-5-atgf
    16atcgca-23-cds-5-atgf

alpha typage[modifier | modifier le wikicode]

alpha type 16-y-235 après 16s[modifier | modifier le wikicode]

  • Lien tableur: alpha type 16-y-235 après 16s
  • Légende:
    - atcgca-cds° contient un 16atcgca-cds-cds-23-cds-5-atgf
    - 16s, 235 supposés être des 16s23s5s puisqu'ils sont les seuls dans le génome.
Alpha typage, après 16s
16s-y-23s5s tableau incomplets 16s, 235 total %
16s23s5s 0 2 8 10 4,9
atcgca 137 1 138 67
gcaatc 17 17 8
gca 4 4 2,0
atc 2 2 1,0
atcgca-cds° 31 31 16
gcaatc-cds 1 1 0,5
total 192 3 8 203 100

alpha type 16235-z après 5s[modifier | modifier le wikicode]

  • Lien tableur: alpha type 16235-z après 5s
  • Légende:
  • Noice: 5 blocs ont un cds entre 23s et 5s. En général l'intercalaire 23s-5s est relativement constant dans un génom et même en général. A comparer donc ces cds à ces intercalaires.
Alpha typage, après 5s
16s23s5s-z sans atgf cgg 23s-cds-5s-atgf total
tableau 47 139 1 5 192
% 24,5 72,4 0,5 2,6 100

alpha type x-16235 avant 16s[modifier | modifier le wikicode]

alpha gamma typage[modifier | modifier le wikicode]

  • Lien tableur: alpha gamma typage
  • Légende:
  • Notes: Pour les effectifs voir alpha blocs, les totaux de fin pour alpha, et gamma type 16235-z après 5s pour gamma et z,z'.
    - Pour alpha les 10 blocs 16s,23s5s sont considérés comme tel et n'ont pas donc de z.
    - Pour alpha les cds sont considérés comme des intercalaires.
Alpha gamma typage
après 16s
16-y-235-z 16s23s5s atcgca gcaatc gaa autres total %
gamma
sans z 58 238 14 160 37 507 72
avec z 17 85 0 78 17 197 28
total 75 323 14 238 54 704
% 11 46 2 34 8
alpha
sans z 0 44 1 0 10 55 27.5
avec z 0 124 17 0 4 145 72.5
total 0 168 18 0 14 200
% 0 84 9 0 7
après 5s
16-235-z,z' gac-tgg gac acc-5s atgf autres total
gamma 66 80 46 0 26 218
% 30 37 21 0 12
alpha 0 0 0 144 1 145
% 0 0 0 99 1

alpha typage cds[modifier | modifier le wikicode]

  • Lien tableur: alpha typage cds
  • Légende:
    - date NCBI, c'est la date relevée sur le NCBI au moment du prélèvement de l'adresse lors de la publication de ce tableau, c.a.d le 26.1.20. Seuls alf015 043 203 ont fait défaut. Les exceptions (*): Pour alf043 j’avais prélevé le 1.9.19 juste la séquence de cds, avant la date de NCBI du 5.1.20. Pour alf203 j'ai repris les adresses de oan opérons du 27.12.19 avant la date de NCBI du 5.1.20. Pour alf015 j'ai pu récupérer l’adresse du 1.9.19 comme pour alf043.
    - génome, code du tableau des noms alpha
    - cds, le nom du cds dans le bloc à rRNAs, c12 pour 2ème cds du 1er bloc situé sur le chromosome circulaire (c) ou bien l12, l pour chromosome linéaire.
    - après RNA, gca cp, c'est le cds qui se trouve juste après le tRNA gca et cp pour dire que le sens du cds est différent de celui du bloc. Dans la plupart des cas les RNAs du bloc ont le même sens (complement ou direct). En gras et souligné sont les exceptions de ce tableau où tous les cds après un tRNA (gca atc) changent de sens et tous les cds apès un rRNA (16s 23s) ne changent pas de sens. Il y a aussi le cas de 2 cds successifs, le 2ème a, dans la colonne "après RNA", cds qui n'est pas un RNA. C'est le cas de al012. Alf020 21 25, les cds se trouvent après 16s. Comme le bloc est divisé en 16s et 23s5s, j'ai supposé que les 2 tRNAs atc-gca, hypothétiques, ont disparus. Ces cds ne sont pas hypothétiques mais ont des tailles comparables aux hp, hypothetical protéine, de la colonne "séquence aas".
    - séquence en aas: La longueur des séquences des hp ne permet pas de les afficher ici. On les trouve dans le tableur, voir le lien ci-dessus.
    - P-hp pour pseudo hp, NCBI ne donne pas leur traduction.
  • Notes du 20.7.20, disparitions
    - alf12: il y a les séquences du 30.01.2014 dans [1] AE007869.2 qui contiennent les adresses du tableau ci-dessous et celles du [2] 10.03.2020 où ces adresses ont disparues.
    - alf14: 12.04.2020 rien, ancien du 30.01.2014 [3] a les cds mais avec des adresses décalées recherche sur " trna ".
    - alf15 disparus à maj 18.6.20 comme alf62 à maj 2.2.20 comme alf307 à maj 4.4.20.
    - Puis ok pour ceux de 2019 ayant gardé la même mise à jour. alf44 ok avec maj du 20.5.20, alf57 ok du 4.4.20, alf71 ok du 18.6.20
    - aua disparu même si maj de 2019 (le chromosome. Le plasmide ok voir et pau20rrn [2].
Alpha typage cds. Les cds intra blocs.
date NCBI génome sens adresse cds après RNA aas égale en aas séquence aas
03/08/16 alf12 comp 59238..59627 c11 gca cp 129 c11=c22 hp
62235..62492 c12 23s 85 c12=c23 hp
2516197..2516583 c21 gca cp 128 hp
2515743..2516132 c22 cds cp 129 hp
comp 2512878..2513135 c23 23s 85 hp
comp 1044310..1044699 l11 gca cp 129 c11=l11 hp
1047307..1047564 l12 23s 85 c12=l12 hp
comp 1306725..1307114 l21 gca cp 129 hp
1309700..1309999 l22 23s 99 hp
26/08/19 alf14 agr comp <59429..59626 c11 gca cp 66 P-hp
2496166..>2496363 c21 gca cp 67 P-hp
comp <1429429..1429626 l11 gca cp 68 P-hp
comp <1690307..1690504 l21 gca cp 69 P-hp
comp <2105696..2105893 l31 gca cp 70 P-hp
07/01/20 alf15 comp <59347..59592 c11 gca cp 82 P-hp
2508109..2508427 c21 gca cp 106 P-hp
comp <1122642..1122887 l11 gca cp 82 P-hp
*01/09/2019 avant ? 2044048..2044367 l21 gca - P-hp
25/08/19 alf020 comp 1001462..1001845 c11 16s 127 sdhC hp
comp 1001115..1001450 c12 cds 111 sdhD hp
27/08/19 alf021 249441..249824 c11 16s 127 sdhC hp
249836..250165 c12 cds 109 sdhD hp
29/11/19 alf025 comp 1055653..1056036 c11 16s 127 sdhC hp
comp 1055320..1055649 c12 cds 109 sdhD hp
25/08/19 alf038 1751403..1751597 c11 gca cp 64 c11=c21 hp
1896294..1896488 c21 gca cp 64 hp
*01/09/2019 alf043 - c11 gca 72 c11=c21 hp
05/01/20 néant - c21 gca 72 hp
08/08/19 alf044 comp 1854849..1855037 c11 gca 62 c11=c21 hp
comp 2061198..2061386 c21 gca 62 hp
26/08/19 alf046 1353691..1353915 c11 gca cp 74 c11=c21 hp
1496257..1496481 c21 gca cp 74 hp
24/12/19 alf057 1602851..1603093 c11 gca cp 80 c11=c21 hp
1806931..1807173 c21 gca cp 80 c11=c31 hp
1057289..1057531 c31 gca cp 80 hp
alf057=alf071
30/03/17 alf071 1586714..1586956 c11 gca cp 80 c11=c21 hp
1791119..1791361 c21 gca cp 80 c11=c31 hp
1106853..1107095 c31 gca cp 80 hp
18/12/14 alf162 1548251..1548361 c11 atc cp 36 hp
*27/12/2019 alf203 oan comp 1085980..>1086168 c11 gca cp 63 P-hp
05/01/20 néant comp 1348203..>1348391 c21 gca cp 63 P-hp
comp 458785..>458973 c31 gca cp 63 P-hp
<1601419..1601607 c41 gca cp 63 P-hp
27/07/17 alf307 comp 3626306..3626473 c11 23s cp 55 hp
28/08/19 aua 4501..4851 c11 gca cp 76 hp

alpha typage absence de cds[modifier | modifier le wikicode]

  • Lien tableur: alpha typage absence de cds
  • Légende:
  • alf014 agr 28/08/19: Les 4 comp sont identiques (exact()), commencent par atg et se terminent par ttt qui n’est pas un stop. Le c21 est de même longueur, 198 pbs, mais je ne l'ai pas retourné pour comparer.
comp	<59429..59626			c11			
	2496166..>2496363		c21			
comp	<1429429..1429626		l11			
comp	<1690307..1690504		l21			
comp	<2105696..2105893		l31			
l11						
1429381	gcctgtgtgg	gtggattgat	cggtaagttg	aatatccttt	tgaagaaa*aa	aaacgtttgc
1429441	atcgttcgca	aggactgatg	cctgttctga	atacattgtg	aagagaagat	atgtctggaa
1429501	gcgtccaggt	gttttgggtt	tatgcctgaa	acgtccgaga	ccaatccttg	tgaaaccatg
1429561	tgatggctta	gtcggccgga	attggtggag	gggttggagg	taggaaggat	cgcttgtccg
1429621	aggcat*tttt	gttgttggag	catttgctcc	tctgatggga	atgctggatt	gatgttgcct
l21						
1690261	ctgtgtgggt	ggattgatcg	gtaagttgaa	tatccttttg	aagaaa*aaaa	acgtttgcat
1690321	cgttcgcaag	gactgatgcc	tgttctgaat	acattgtgaa	gagaagatat	gtctggaagc
1690381	gtccaggtgt	tttgggttta	tgcctgaaac	gtccgagacc	aatccttgtg	aaaccatgtg
1690441	atggcttagt	cggccggaat	tggtggaggg	gttggaggta	ggaaggatcg	cttgtccgag
1690501	gcat*ttttgt	tgttggagca	tttgctcctc	tgatgggaat	gctggattga	tgttgcctga
l31						
2105641	cctatcggcc	tgtgtgggtg	gattgatcgg	taagttgaat	atccttttga	agaaa*aaaaa
2105701	cgtttgcatc	gttcgcaagg	actgatgcct	gttctgaata	cattgtgaag	agaagatatg
2105761	tctggaagcg	tccaggtgtt	ttgggtttat	gcctgaaacg	tccgagacca	atccttgtga
2105821	aaccatgtga	tggcttagtc	ggccggaatt	ggtggagggg	ttggaggtag	gaaggatcgc
2105881	ttgtccgagg	cat*ttttgtt	gttggagcat	ttgctcctct	gatgggaatg	ctggattgat
c11						
59401	cggtaagttg	aatatccttt	tgaagaaa*aa	aaacgtttgc	atcgttcgca	aggactgatg
59461	cctgttctga	atacattgtg	aagagaagat	atgtctggaa	gcgtccaggt	gttttgggtt
59521	tatgcctgaa	acgtccgaga	ccaatccttg	tgaaaccatg	tgatggctta	gtcggccgga
59581	attggtggag	gggttggagg	taggaaggat	cgcttgtccg	aggcat*tttt	gttgttggag
c21						
2496121	caatccagca	ttcccatcag	aggagcaaat	gctccaacaa	caaaa*atgcc	tcggacaagc
2496181	gatccttcct	acctccaacc	cctccaccaa	ttccggccga	ctaagccatc	acatggtttc
2496241	acaaggattg	gtctcggacg	tttcaggcat	aaacccaaaa	cacctggacg	cttccagaca
2496301	tatcttctct	tcacaatgta	ttcagaacag	gcatcagtcc	ttgcgaacga	tgcaaacgtt
2496361	ttt*tttcttc	aaaaggatat	tcaacttacc	gatcaatcca	cccacacagg	ccgataggcc
  • alf203 oan 05/01/20: Les 3 comp sont identiques (exact()), commencent par tat qui n'est pas Met et se terminent par tga qui est un stop. Le c41 est de même longueur, 189 pbs, mais je ne l'ai pas retourné pour comparer.
comp	1085980..>1086168		c11			
comp	1348203..>1348391		c21			
comp	458785..>458973			c31			
	<1601419..1601607		c41			
c11						
1085881	tgggagagca	cctgctttgc	aagcaggggg	tcgtcggttc	gatcccgtct	ggctccacca
1085941	tcactttttt	ggtgtcgagt	aggacggata	gacagtcag*t	caacaagaga	aagaaccaag
1086001	tttgcggact	ttacgaagtc	tgcgtgttct	gtatgaaatc	gtgaagagaa	gatgtaatcg
1086061	gatcaactat	ccagttgatg	tcgcaatggt	ttgctcaaac	cttgcattat	gattggacgc
1086121	taaccgcgcc	accgattgta	tctcgagaag	ctggtctttc	tgctgata*tg	atcagagctt
c21						
1348141	ttcgatcccg	tctggctcca	ccatcacttt	tttggtgtcg	agtaggacgg	atagacagtc
1348201	ag*tcaacaag	agaaagaacc	aagtttgcgg	actttacgaa	gtctgcgtgt	tctgtatgaa
1348261	atcgtgaaga	gaagatgtaa	tcggatcaac	tatccagttg	atgtcgcaat	ggtttgctca
1348321	aaccttgcat	tatgattgga	cgctaaccgc	gccaccgatt	gtatctcgag	aagctggtct
1348381	ttctgctgat	a*tgatcagag	cttaatgctt	tgatggatat	tggcaatgag	agtgatcaag
c31						
458701	tttgcaagca	gggggtcgtc	ggttcgatcc	cgtctggctc	caccatcact	tttttggtgt
458761	cgagtaggac	ggatagacag	tcag*tcaaca	agagaaagaa	ccaagtttgc	ggactttacg
458821	aagtctgcgt	gttctgtatg	aaatcgtgaa	gagaagatgt	aatcggatca	actatccagt
458881	tgatgtcgca	atggtttgct	caaaccttgc	attatgattg	gacgctaacc	gcgccaccga
458941	ttgtatctcg	agaagctggt	ctttctgctg	ata*tgatcag	agcttaatgc	tttgatggat
c41						
1601341	caaggcatcc	accaaatgcc	cttaagacac	ttgatcactc	tcattgccaa	tatccatcaa
1601401	agcattaagc	tctgatca*ta	tcagcagaaa	gaccagcttc	tcgagataca	atcggtggcg
1601461	cggttagcgt	ccaatcataa	tgcaaggttt	gagcaaacca	ttgcgacatc	aactggatag
1601521	ttgatccgat	tacatcttct	cttcacgatt	tcatacagaa	cacgcagact	tcgtaaagtc
1601581	cgcaaacttg	gttctttctc	ttgttga*ctg	actgtctatc	cgtcctactc	gacaccaaaa
  • alf036 oan 28/11/19: Le 1.9.19 j'avais relevé les adresses et les séquences de 2 cds particuliers par leurs séquences. NCBI ne les montrent plus le 28/11/19. Je les ai retrouvées mais la Met du début est remplacée par att.Voici les séquences en 1.9.19:

cds1  adresse 257745..257999, intercalaire avec atgf d'adresse 257437..257513: 231 pbs
MVACIPKSKRSTLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSNWRFTD
cds2  comp 1107699..1107995, intercalaire avec atgf d'adresse 1108279..1108355: 283 pbs
MLYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLIGASLIKHW

  • -- Les intercalaires du 28/11/19
alf036. Les intercalaires de NCBI du 28/11/19.
sens adresse gène intercal aas protéines
comp <250713..250865 cds 1022 51 transcriptional repressor
251888..253381 16s 315 1494
253697..253773 atc 122
253896..253971 gca 305
254277..257097 23s 96 2821
257194..257308 5s 128 115
257437..257513 atgf 1208
258722..259111 cds 130 hp
comp 1106662..1107051 cds 1227 130 hp
comp 1108279..1108355 atgf 128
comp 1108484..1108598 5s 96 115
comp 1108695..1111515 23s 305 2821
comp 1111821..1111896 gca 122
comp 1112019..1112095 atc 315
comp 1112411..1113904 16s 1022 1494
1114927..1115313 cds 129 transcriptional repressor
  • -- Les séquences NCBI du 28/11/19
Après verification le M (atg) d’avant est devenu att le 28/11/19. Et taa est stop.						
257745..257999						
257701	tttctcattg	tataaatact	gagtataaat	actgatttcc	agaa*attgtt	gcttgcatac
257761	ctaaaagcaa	aagaagcacc	ttattctcta	ttctctattc	tctattctct	attctctatt
257821	ctctattctc	tattctctat	tctctattct	ctattctcta	ttctctattc	tctattctct
257881	attctctatt	ctctattctc	tattctctat	tctctattct	ctattctcta	ttctctattc
257941	tctattctct	attctctatt	ctctattctc	tattctctaa	ttggcgcttc	actgattaa*a
258001	cactggtaac	cgaaaaatta	aattttatat	tttatactag	ggacgtagct	taccttgagc
comp 1107699..1107995						
1107661	tacgtcccta	gtataaaata	taaaatttaa	tttttcggtt	accagtgt*tt	a atcagtgaa
1107721	gcgccaatta	gagaatagag	aatagagaat	agagaataga	gaatagagaa	tagagaatag
1107781	agaatagaga	atagagaata	gagaatagag	aatagagaat	agagaataga	gaatagagaa
1107841	tagagaatag	agaatagaga	atagagaata	gagaatagag	aatagagaat	agagaataga
1107901	gaatagagaa	tagagaatag	agaatagaga	atagagaata	gagaatagag	aatagagaat
1107961	agagaataga	gaatagagaa	tagagaatag	agaat*agaga	atagagaata	aggtgcttct
1108021	tttgctttta	ggtatgcaag	caacaatttc	tggaaatcag	tatttatact	cagtatttat
1108081	acaatgagaa	agtaccccac	aagctgagat	gttgatgaaa	gagagctgca	cacacccttg
1108141	tagggacttg	gttttggtgt	aggggcttgg	ttttggggag	cagaacgcca	atgttaaaca

alpha typage cds et intercalaires[modifier | modifier le wikicode]

Rb. typage cds et intercalaires, alpha gamma firmicutes
génome 16s-aa1 aa2-23s 16s-23s n blocs type lien notes
alpha typage, cds et intercalaires
alf036 315 305 _ 2 atc-gca alf036 *
alf254 rru 184 362 _ 4 atc-gca rru *
alf031 abq 94-110 254-266 _ 8 atc-gca abq *
_ _ 262 1 16s-23s
alf032 abs 107-110 269-272 _ 4 atc-gca abs *
alf253 rpm 112 212-216 _ 6 atc rpm *
182 196 _ 1 gca *
alf203 oan 268 266 _ 4 atc-gca cds oan 0 cds
alf014 agr 337 585 _ 5 atc-gca cds agr 0 cds
aua 236 478 _ 1 atc-gca cds aua ok
*
gamma typage, cds et intercalaires
spl _ _ 338-374 8 atc-gca spl *
71 329-364 _ 3 atc-gca *
vpb 80 257 _ 1 gaa, gta vpb *
80 253-312 _ 3 gaa, gta cds 0 cds
80 258 _ 1 gaa *
88 258 _ 1 gcc-gaa *
56 257 _ 2 atc-gca *
_ _ 261 3 16s-23s *
eal 85 198 _ 4 gaa eal *
68-70 186 _ 3 atc-gca *
eco 68 174-183 _ 3 atc-gca eco *
85 193 _ 2 gaa *
171 184-193 _ 2 gaa *
vha 97 265-290 _ 4 atc-gca cds vha 0/3 cds
56 290 _ 1 atc-gca *
82 310 _ 1 gaa, gta *
114-122 253-310 _ 3 gaa, gta cds *
129 257 _ 1 gcc-gaa cds *
amed 66 231 _ 3 atc-gca amed *
192-268 229-245 _ 6 gaa *
*
bacilli typage, cds et intercalaires
bsu _ _ 164-167 13 16s-23s bsu *
99 81 _ 2 atc-gca *
lmo _ _ 244 6 16s-23s lmo *
127 172 _ 2 atc-gca *
lam _ _ 192 2 16s-23s cds lam 0 cds
125 115 _ 2 atc-gca *
ppm _ _ 207-221 6 16s-23s ppm *
_ _ 280-400 4 16s-23s *
93-108 128 _ 2 5s-atc-gca *
89 185 _ 1 gca *
pmq _ _ 248-269 14 16s-23s pmq *
lbu _ _ 208 4 16s-23s lbu *
105 126 _ 5 atc-gca *
ban _ _ 141 7 16s-23s ban *
_ _ 153-173 2 16s-23s *
130 77 _ 2 atc-gca *
clostridia typage, cds et intercalaires
psor _ _ 196 9 16s-23s psor *
_ _ 137 1 16s-23s *
54 114 _ 4 gca *
109-123 95-152 _ 3 gca *
cdc _ _ 279-320 5 16s-23s cdc *
_ _ 184-217 2 16s-23s *
52-68 249-373 _ 3 gca *
cdc8 _ _ 261-321 5 16s-23s cdc8 *
_ _ 184-217 2 16s-23s *
cbc _ _ 228 4 16s-23s cbc *
cbn _ _ 233 8 16s-23s cbn *
74-121 96 _ 2 gca-atc *
cle 196* 262-282 _ 4 5s-gca* cle *
262* 258 _ 1 5s-atc* *
196* 261 _ 2 5s-atc-gca* *
hmo 508* 233 _ 3 5s-gcc* hmo *
433* 233 _ 2 5s-gcc* *
432* 141-194 _ 2 5s-atc* *
433* 229 _ 1 5s-atc-gca* *
508* 236 _ 1 5s-atc-gca* *
_ _ 569 1 5s-16s-23s *
cbei _ _ 339 7 16s-23s cbei *
_ _ 502-578 3 16s-23s *
_ _ 214 3 16s-23s *
140 111 _ 1 gca-atc *
132 84 _ 1 atc *
137 118 _ 1 gca *

Tableau des noms alpha[modifier | modifier le wikicode]

  • Lien tableur: Tableau des noms alpha
  • Légende:
    - rupture, un seul génome est choisi parmi ceux portant le même nom défini par ses 2 1ers qualificatifs. Le total de ces génomes est de 189 indiqué au bas du tableau.
    - fait, les génomes que j'ai étudié ici pour les blocs à rRNAs. J'en ai fait ici 70 sur les 189 définis par leur nom de rupture.
    - notes, concerne des remarques souvent sur le nombre de tRNAs par génome qui, suivant la méthode de prélèvement que j'ai utilisée, est quelques fois le total de plusieurs échantillons du même génome. Il suffit de le verifier dans la base gtRNAdb.
    - rRNAs: c'est la présentation de NCBI, x y z, pour x 5s y 16s et z 23s.
    - code: utilisé dans alpha blocs.
  • Notes: 348 génomes alphaproteobacteria avec 17165 tRNAs, prélèvement fait vers le 20.8.19 à partir de la base de données gtRNAdb [3]
A. Noms des alpha
ruptures notes rRNAs fait code tRNAs génomes
1 555 1 alf001 60 Acetobacter pasteurianus 386B
alf002 60 Acetobacter pasteurianus IFO 3283-01 IFO 3283 substr. IFO 3283-01
alf003 57 Acetobacter pasteurianus IFO 3283-01-42C IFO 3283 substr. IFO 3283-01-42C
alf004 60 Acetobacter pasteurianus IFO 3283-03 IFO 3283 substr. IFO 3283-03
alf005 60 Acetobacter pasteurianus IFO 3283-07 IFO 3283 substr. IFO 3283-07
alf006 60 Acetobacter pasteurianus IFO 3283-12 IFO 3283 substr. IFO 3283-12
alf007 60 Acetobacter pasteurianus IFO 3283-22 IFO 3283 substr. IFO 3283-22
alf008 60 Acetobacter pasteurianus IFO 3283-26 IFO 3283 substr. IFO 3283-26
alf009 60 Acetobacter pasteurianus IFO 3283-32 IFO 3283 substr. IFO 3283-32
1 222 1 alf010 48 Acidiphilium cryptum JF-5
1 222 1 alf011 48 Acidiphilium multivorum AIU301
1 444 1 alf012 55 Agrobacterium fabrum str. C58
1 333 1 alf013 56 Agrobacterium radiobacter K84
1 agr 555 1 alf014 58 Agrobacterium sp. H13-3
1 555 1 alf015 57 Agrobacterium tumefaciens Ach5
alf016 57 Agrobacterium tumefaciens LBA4213 Ach5
1 444 1 alf017 56 Agrobacterium vitis S4
1 - alf018 32 alpha proteobacterium HIMB5
1 - alf019 35 alpha proteobacterium HIMB59
1 111 1 alf020 37 Anaplasma centrale str. Israel
1 111 1 alf021 35 Anaplasma marginale str. Dawn
alf022 37 Anaplasma marginale str. Florida
alf023 37 Anaplasma marginale str. Gypsy Plains
alf024 37 Anaplasma marginale str. St. Maries
1 111 1 alf025 37 Anaplasma phagocytophilum str. Dog2
alf026 37 Anaplasma phagocytophilum str. HZ
alf027 37 Anaplasma phagocytophilum str. HZ2
alf028 37 Anaplasma phagocytophilum str. JM
1 333 1 alf029 51 Asticcacaulis excentricus CB 48
1 333 1 alf030 54 Azorhizobium caulinodans ORS 571
1 abq 899 1 alf031 88 Azospirillum brasilense Az39
abs alf032 85 Azospirillum brasilense Sp245
1 899 1 alf033 83 Azospirillum lipoferum 4B
1 899 1 alf034 84 Azospirillum sp. B510
1 222 1 alf035 43 Bartonella australis Aust/NH1
1 222 1 alf036 45 Bartonella bacilliformis KC583 ATCC 35685
1 222 1 alf037 42 Bartonella clarridgeiae 73
1 222 1 alf038 43 Bartonella grahamii as4aup
1 222 1 alf039 43 Bartonella henselae BM1374163
alf040 45 Bartonella henselae BM1374165
alf041 44 Bartonella henselae str. Houston-1
1 alf042 43 Bartonella quintana RM-11
222 1 alf043 43 Bartonella quintana str. Toulouse
1 222 1 alf044 43 Bartonella tribocorum BM1374166
alf045 43 Bartonella tribocorum CIP 105476
1 222 1 alf046 43 Bartonella vinsonii subsp. berkhoffii str. Winnie
1 333 1 alf047 54 Beijerinckia indica subsp. indica ATCC 9039
1 111 1 alf048 60 Bradyrhizobium diazoefficiens USDA 110 USDA110
1 222 1 alf049 64 Bradyrhizobium japonicum E109
alf050 59 Bradyrhizobium japonicum SEMIA 5079
alf051 66 Bradyrhizobium japonicum USDA 6
1 222 1 alf052 57 Bradyrhizobium oligotrophicum S58
1 222 1 alf053 56 Bradyrhizobium sp. BTAi1
1 222 1 alf054 52 Bradyrhizobium sp. ORS 278 ORS278
1 111 1 alf055 50 Bradyrhizobium sp. S23321
1 222 1 alf056 49 Brevundimonas subvibrioides ATCC 15264
1 333 1 alf057 55 Brucella abortus 2308
alf058 55 Brucella abortus 3196
alf059 55 Brucella abortus 63 75
alf060 55 Brucella abortus A13334
alf061 55 Brucella abortus BDW
alf062 54 Brucella abortus BER
alf063 54 Brucella abortus BFY
alf064 55 Brucella abortus bv. 1 str. 9-941
alf065 55 Brucella abortus bv. 2 str. 86/8/59
alf066 55 Brucella abortus bv. 6 str. 870
alf067 55 Brucella abortus bv. 9 str. C68
alf068 55 Brucella abortus NCTC 10505
alf069 55 Brucella abortus S19
alf070 47 Brucella abortus ZW053
1 333 1 alf071 55 Brucella canis ATCC 23365
alf072 55 Brucella canis HSK A52141
alf073 55 Brucella canis RM6/66
alf074 49 Brucella canis str. Oliveri
alf075 55 Brucella canis SVA13
1 alf076 54 Brucella ceti TE10759-12
alf077 54 Brucella ceti TE28753-12
1 alf078 55 Brucella melitensis ATCC 23457
alf079 108 Brucella melitensis bv. 1 str. 16M
alf080 55 Brucella melitensis bv. 2 str. 63/9
alf081 55 Brucella melitensis bv. 3 str. Ether ether
alf082 55 Brucella melitensis M28
alf083 55 Brucella melitensis M5-90
alf084 54 Brucella melitensis NI
1 alf085 55 Brucella microti CCM 4915
1 alf086 53 Brucella ovis ATCC 25840
1 alf087 55 Brucella pinnipedialis 6/566
alf088 55 Brucella pinnipedialis B2/94
1 alf089 110 Brucella suis 1330
alf090 55 Brucella suis 513UK
alf091 54 Brucella suis ATCC 23445
alf092 55 Brucella suis BSP
alf093 55 Brucella suis bv. 1 str. S2
alf094 54 Brucella suis bv. 2 Bs143CITA
alf095 54 Brucella suis bv. 2 Bs364CITA
alf096 54 Brucella suis bv. 2 Bs396CITA
alf097 54 Brucella suis bv. 2 PT09143
alf098 54 Brucella suis bv. 2 PT09172
alf099 55 Brucella suis bv. 3 str. 686
alf100 55 Brucella suis Human/AR/US/1981
alf101 55 Brucella suis VBI22
alf102 58 Brucella suis ZW043
alf103 55 Brucella suis ZW046
1 - alf104 44 Candidatus Caedibacter acanthamoebae
1 111 1 alf105 42 Candidatus Endolissoclinum faulkneri L2
alf106 42 Candidatus Endolissoclinum faulkneri L5
1 - alf107 19 Candidatus Hodgkinia cicadicola
- alf108 14 Candidatus Hodgkinia cicadicola Dsem
- alf109 13 Candidatus Hodgkinia cicadicola TETUND1
- alf110 17 Candidatus Hodgkinia cicadicola TETUND2
1 333 1 alf111 46 Candidatus Liberibacter americanus str. Sao Paulo
alf112 45 Candidatus Liberibacter asiaticus str. gxpsy
alf113 45 Candidatus Liberibacter asiaticus str. Ishi-1
alf114 45 Candidatus Liberibacter asiaticus str. psy62
alf115 46 Candidatus Liberibacter solanacearum CLso-ZC1
1 alf116 35 Candidatus Midichloria mitochondrii IricVA
1 222 1 alf117 43 Candidatus Paracaedibacter acanthamoebae
1 alf118 32 Candidatus Pelagibacter sp. IMCC9063
alf119 32 Candidatus Pelagibacter ubique HTCC1062
1 alf120 44 Candidatus Phaeomarinobacter ectocarpi Ec32
1 alf121 38 Candidatus Puniceispirillum marinum IMCC1322
1 alf122 33 Candidatus Rickettsia amblyommii str. GAT-30V
1 222 1 alf123 52 Caulobacter crescentus CB15
alf124 52 Caulobacter crescentus NA1000
1 alf125 53 Caulobacter segnis ATCC 21756
1 alf126 51 Caulobacter sp. K31
1 alf127 50 Celeribacter indicus P73
1 alf128 54 Chelativorans sp. BNC1
1 alf129 47 Dinoroseobacter shibae DFL 12 DSM 16493
1 111 1 alf130 36 Ehrlichia canis str. Jake
1 111 1 alf131 37 Ehrlichia chaffeensis str. Arkansas
alf132 37 Ehrlichia chaffeensis str. Heartland
alf133 37 Ehrlichia chaffeensis str. Jax
alf134 37 Ehrlichia chaffeensis str. Liberty
alf135 37 Ehrlichia chaffeensis str. Osceola
alf136 37 Ehrlichia chaffeensis str. Saint Vincent
alf137 37 Ehrlichia chaffeensis str. Wakulla
alf138 37 Ehrlichia chaffeensis str. West Paces
1 alf139 37 Ehrlichia muris AS145
1 alf140 36 Ehrlichia ruminantium str. Gardel
alf141 72 Ehrlichia ruminantium str. Welgevonden
1 alf142 36 Ehrlichia sp. HF
1 alf143 38 endosymbiont of Acanthamoeba sp. UWC8
1 alf144 63 Ensifer adhaerens OV14
1 alf145 43 Erythrobacter litoralis HTCC2594
1 444 1 alf146 60 Gluconacetobacter diazotrophicus PA1 5
alf147 58 Gluconacetobacter diazotrophicus PA1 5 PAl 5
1 alf148 57 Gluconobacter oxydans 621H
alf149 57 Gluconobacter oxydans DSM 3504
alf150 60 Gluconobacter oxydans H24
1 alf151 52 Granulibacter bethesdensis CGDNIH1
alf152 53 Granulibacter bethesdensis CGDNIH2
alf153 52 Granulibacter bethesdensis CGDNIH3
alf154 52 Granulibacter bethesdensis CGDNIH4
1 alf155 39 Hirschia baltica ATCC 49814
1 alf156 48 Hyphomicrobium denitrificans 1NES1
alf157 47 Hyphomicrobium denitrificans ATCC 51888
1 alf158 49 Hyphomicrobium nitrativorans NL23
1 111 1 alf159 53 Hyphomicrobium sp. MC1
1 alf160 43 Hyphomonas neptunium ATCC 15444
1 alf161 43 Jannaschia sp. CCS1
1 555 1 alf162 58 Ketogulonicigenium vulgare WSH-001
alf163 60 Ketogulonicigenium vulgare Y25
1 alf164 59 Komagataeibacter medellinensis NBRC 3288
1 alf165 60 Komagataeibacter xylinus E25
1 555 1 alf166 66 Leisingera methylohalidivorans DSM 14336 MB2
1 alf167 47 Liberibacter crescens BT-1
1 alf168 45 Magnetococcus marinus MC-1
1 alf169 48 Magnetospira sp. QH-2
1 alf170 54 Magnetospirillum gryphiswaldense MSR-1 v2
1 alf171 53 Magnetospirillum magneticum AMB-1
1 alf172 45 Maricaulis maris MCS10
1 alf173 57 Martelella endophytica YC6887
1 222 1 alf174 55 Mesorhizobium australicum WSM2073
1 alf175 54 Mesorhizobium ciceri biovar biserrulae WSM1271
1 alf176 55 Mesorhizobium huakuii 7653R
1 alf177 55 Mesorhizobium loti MAFF303099
1 alf178 55 Mesorhizobium opportunistum WSM2075
1 alf179 68 Methylobacterium extorquens AM1
alf180 67 Methylobacterium extorquens CM4
alf181 62 Methylobacterium extorquens DM4
alf182 63 Methylobacterium extorquens PA1
1 alf183 83 Methylobacterium nodulans ORS 2060
1 alf184 62 Methylobacterium oryzae CBMB20
1 alf185 61 Methylobacterium populi BJ001
1 alf186 63 Methylobacterium radiotolerans JCM 2831
1 666 1 alf187 72 Methylobacterium sp. 4-46
1 alf188 50 Methyloceanibacter caenitepidi Gela4
1 alf189 51 Methylocella silvestris BL2
1 alf190 48 Methylocystis sp. SC2
1 alf191 44 Micavibrio aeruginosavorus ARL-13
alf192 40 Micavibrio aeruginosavorus EPB
1 alf193 52 Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141
alf194 52 Neorhizobium galegae bv. orientalis str. HAMBI 540
1 alf195 33 Neorickettsia helminthoeca str. Oregon
1 alf196 33 Neorickettsia risticii str. Illinois
1 alf197 33 Neorickettsia sennetsu str. Miyayama
1 111 1 alf198 58 Nitrobacter hamburgensis X14
1 alf199 50 Nitrobacter winogradskyi Nb-255
1 alf200 59 Novosphingobium aromaticivorans DSM 12444
1 alf201 57 Novosphingobium pentaromativorans US6-1
1 333 1 alf202 59 Novosphingobium sp. PP1Y
1 oan 444 1 alf203 61 Ochrobactrum anthropi ATCC 49188
alf204 59 Ochrobactrum anthropi OAB
1 alf205 51 Octadecabacter antarcticus 307
1 alf206 49 Octadecabacter arcticus 238
1 alf207 54 Oligotropha carboxidovorans OM4
alf208 54 Oligotropha carboxidovorans OM5
alf209 54 Oligotropha carboxidovorans OM5 ATCC 49405
1 alf210 34 Orientia tsutsugamushi str. Boryong
alf211 34 Orientia tsutsugamushi str. Ikeda
1 444 1 alf212 62 Paracoccus aminophilus JCM 7686
1 alf213 55 Paracoccus denitrificans PD1222
1 alf214 46 Parvibaculum lavamentivorans DS-1
1 alf215 44 Parvularcula bermudensis HTCC2503
1 alf216 50 Pelagibacterium halotolerans B2
1 alf217 58 Phaeobacter gallaeciensis 2.10
444 1 alf218 61 Phaeobacter gallaeciensis DSM 26640
1 alf219 59 Phaeobacter inhibens DSM 17395
1 alf220 43 Phenylobacterium zucineum HLK1
1 alf221 45 Planktomarina temperata RCA23
1 alf222 53 Polymorphum gilvum SL003B-26A1
1 666 1 alf223 70 Pseudovibrio sp. FO-BEG1
1 333 1 alf224 54 Rhizobium etli bv. mimosae str. IE4771
alf225 51 Rhizobium etli bv. mimosae str. Mim1
alf226 55 Rhizobium etli bv. phaseoli str. IE4803
alf227 50 Rhizobium etli CFN 42
alf228 54 Rhizobium etli CIAT 652
1 alf229 52 Rhizobium gallicum bv. gallicum R602
1 alf230 51 Rhizobium leguminosarum bv. trifolii CB782
alf231 54 Rhizobium leguminosarum bv. trifolii WSM1325
alf232 51 Rhizobium leguminosarum bv. trifolii WSM1689
alf233 52 Rhizobium leguminosarum bv. trifolii WSM2304
alf234 52 Rhizobium leguminosarum bv. viciae 3841
1 alf235 57 Rhizobium sp. IRBG74
1 alf236 55 Rhizobium sp. LPU83
1 alf237 51 Rhizobium sp. NT-26
1 alf238 54 Rhizobium tropici CIAT 899
1 alf239 54 Rhodobacter capsulatus SB 1003
1 2*56 alf240 112 Rhodobacter sphaeroides 2.4.1
alf241 57 Rhodobacter sphaeroides ATCC 17025
alf242 58 Rhodobacter sphaeroides ATCC 17029
alf243 58 Rhodobacter sphaeroides KD131 KCTC 12085
alf244 55 Rhodobacter sphaeroides WS8N
1 alf245 52 Rhodomicrobium vannielii ATCC 17100
1 alf246 50 Rhodopseudomonas palustris BisA53
alf247 52 Rhodopseudomonas palustris BisB18
alf248 51 Rhodopseudomonas palustris BisB5
alf249 51 Rhodopseudomonas palustris DX-1
alf250 51 Rhodopseudomonas palustris HaA2
alf251 55 Rhodopseudomonas palustris TIE-1
1 alf252 53 Rhodospirillum centenum SW ATCC 51521
1 rpm alf253 95 Rhodospirillum photometricum DSM 122
1 rru alf254 55 Rhodospirillum rubrum ATCC 11170
alf255 55 Rhodospirillum rubrum F11
1 alf256 33 Rickettsia africae ESF-5
1 alf257 33 Rickettsia akari str. Hartford
1 alf258 33 Rickettsia australis str. Cutlack
1 alf259 35 Rickettsia bellii OSU 85-389
alf260 35 Rickettsia bellii RML369-C
1 alf261 33 Rickettsia canadensis str. CA410
alf262 33 Rickettsia canadensis str. McKiel
1 alf263 33 Rickettsia conorii str. Malish 7
1 alf264 33 Rickettsia felis URRWXCal2 California 2
1 alf265 33 Rickettsia heilongjiangensis 054
1 alf266 33 Rickettsia helvetica C9P9
1 alf267 33 Rickettsia japonica YH
1 alf268 33 Rickettsia massiliae MTU5
alf269 33 Rickettsia massiliae str. AZT80
1 alf270 32 Rickettsia monacensis IrR/Munich
alf271 34 Rickettsia montanensis str. OSU 85-930
1 alf272 34 Rickettsia parkeri str. Portsmouth
1 alf273 34 Rickettsia peacockii str. Rustic
1 alf274 33 Rickettsia philipii str. 364D
1 rpl alf275 33 Rickettsia prowazekii str. Breinl
1 alf276 33 Rickettsia prowazekii str. BuV67-CWPP
alf277 33 Rickettsia prowazekii str. Chernikova
alf278 33 Rickettsia prowazekii str. Dachau
alf279 33 Rickettsia prowazekii str. GvV257
alf280 33 Rickettsia prowazekii str. Katsinyian
alf281 33 Rickettsia prowazekii str. NMRC Madrid E
alf282 33 Rickettsia prowazekii str. Rp22
alf283 33 Rickettsia prowazekii str. RpGvF24
1 alf284 33 Rickettsia rhipicephali str. 3-7-female6-CWPP
1 alf285 34 Rickettsia rickettsii str. Arizona
alf286 34 Rickettsia rickettsii str. Brazil
alf287 34 Rickettsia rickettsii str. Colombia
alf288 34 Rickettsia rickettsii str. Hauke
alf289 34 Rickettsia rickettsii str. Hino
alf290 34 Rickettsia rickettsii str. Hlp#2
alf291 34 Rickettsia rickettsii str. Iowa
alf292 35 Rickettsia rickettsii str. Morgan
alf293 34 Rickettsia rickettsii str. R
alf294 34 Rickettsia rickettsii str. Sheila Smith
1 alf295 33 Rickettsia sibirica 246
1 alf296 33 Rickettsia slovaca 13-B
alf297 33 Rickettsia slovaca str. D-CWPP
1 rtb 111 1 alf298 33 Rickettsia typhi str. B9991CWPP
alf299 33 Rickettsia typhi str. TH1527
alf300 33 Rickettsia typhi str. Wilmington
1 111 1 alf301 39 Rickettsiales bacterium Ac37b
1 alf302 48 Roseibacterium elongatum DSM 19469 DFL-43
1 111 1 alf303 38 Roseobacter denitrificans OCh 114
1 111 1 alf304 38 Roseobacter litoralis Och 149
1 333 1 alf305 54 Ruegeria pomeroyi DSS-3
1 555 1 alf306 64 Ruegeria sp. TM1040
1 333 1 alf307 56 Sinorhizobium fredii NGR234
1 333 1 alf308 56 Sinorhizobium medicae WSM419
1 333 1 alf309 56 Sinorhizobium meliloti 1021
alf310 56 Sinorhizobium meliloti 2011
alf311 59 Sinorhizobium meliloti AK83
alf312 56 Sinorhizobium meliloti BL225C
alf313 57 Sinorhizobium meliloti GR4
alf314 58 Sinorhizobium meliloti Rm41
alf315 56 Sinorhizobium meliloti RMO17
alf316 61 Sinorhizobium meliloti SM11
1 333 1 alf317 62 Sphingobium chlorophenolicum L-1
1 alf318 58 Sphingobium japonicum UT26S
1 alf319 53 Sphingobium sp. SYK-6
1 alf320 57 Sphingobium sp. YBL2
1 333 1 alf321 63 Sphingomonas sanxanigenens DSM 19645 NX02
1 alf322 55 Sphingomonas sp. MM-1
1 alf323 53 Sphingomonas sp. WHSC-8
1 alf324 53 Sphingomonas taxi ATCC 55669
1 alf325 53 Sphingomonas wittichii RW1
1 111 1 alf326 47 Sphingopyxis alaskensis RB2256
1 alf327 50 Sphingopyxis sp. Kp5.2
1 alf328 47 Starkeya novella DSM 506
1 444 1 alf329 61 Thalassospira xiamenensis M-5 DSM 17429
1 444 1 alf330 58 Tistrella mobilis KA081020-065
1 111 1 alf331 34 Wolbachia endosymbiont of Cimex lectularius wCle
alf332 34 Wolbachia endosymbiont of Culex quinquefasciatus Pel wPip
alf333 34 Wolbachia endosymbiont of Drosophila melanogaster wMel
alf334 34 Wolbachia endosymbiont of Drosophila simulans wAu
alf335 35 Wolbachia endosymbiont of Drosophila simulans wHa
alf336 34 Wolbachia endosymbiont of Drosophila simulans wNo
alf337 34 Wolbachia endosymbiont of Onchocerca ochengi wOo
alf338 34 Wolbachia endosymbiont of Onchocerca volvulus str. Cameroon
alf339 34 Wolbachia endosymbiont strain TRS of Brugia malayi
1 alf340 35 Wolbachia sp. wRi
1 222 1 alf341 55 Xanthobacter autotrophicus Py2
1 alf342 49 Zymomonas mobilis subsp. mobilis ATCC 10988
333 1 alf343 52 Zymomonas mobilis subsp. mobilis ATCC 29191
alf344 52 Zymomonas mobilis subsp. mobilis NCIMB 11163
alf345 52 Zymomonas mobilis subsp. mobilis NRRL B-12526
49+52 alf346 101 Zymomonas mobilis subsp. mobilis str. CP4 NRRL B-14023
alf347 52 Zymomonas mobilis subsp. mobilis ZM4 ATCC 31821
alf348 52 Zymomonas mobilis subsp. pomaceae ATCC 29192
189 70

Beta[modifier | modifier le wikicode]

beta blocs[modifier | modifier le wikicode]

  • Lien tableur: beta blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
Beta blocs
lien blocs 16s total aas avec sans total page bet001-31 Notes
bet001 2*16atcgca235 3 60 6 54 16s23s5s 6-atcgca-35 avant
16atcgca2355 sans 2 61 3aas
3aas 2 2*16atcgca235-tac-gga-acc
bet004 2*16atcgca235 3 55 9 46 cds
16atcgca235-tac-gga-acc cds-3aas 5s de trop
65 total 2 63 0 16atcgca2355
bet005 2*16atcgca235 3 57 9 48
16atcgca235-tac-gga-acc
bet006 3*16atcgca235 3 53 6 47
bet007 3*16atcgca235 3 56 6 50
bet008 3*16atcgca235 3 54 6 48
bet009 2*16atcgca235 2 43 4 39
bet010 2*16atcgca235 2 42 4 38
bet011 3*16atcgca235 3 57 6 51
bet013 4*16atcgca235 4 63 8 55
bet014 4*16atcgca235 4 56 8 48
bet015 5*16atcgca235 5 67 10 57
bet016 2*16atcgca235 3 40 4 36
16s23s5s
bet018 3*16atcgca235 3 64 6 58
bet019 3*16atcgca235 3 57 6 51
bet022 3*16atcgca235 3 57 6 51
bet024 3*16atcgca235 3 56 6 50
bet025 3*16atcgca235 3 53 6 47
bet029 3*16atcgca235 3 53 6 47
bet031 5*16atcgca235 6 69 10 59
16s23s5s 65
lien blocs 16s total aas avec sans total page bet032-167 Notes
bet032 4*16atcgca235 6 72 13 59 16s23s5s 6-atcgca-35 avant
16s-cds-235 sans 33 3aas
16atcgca235-tac-gga-acc 3aas 2 2*16atcgca235-tac-gga-acc
cds 3 26
bet039 16atcgca235 6 70 13 57 cds-3aas 6 cds-3aas
16atcgca-cds-235-tac-gga-acc 70 total 3 67 0 6*16atcgca-cds-235-tac-gga-acc
3*16atcgca-cds-235
16s-cds-235
incomplets
bet042 4*16atcgca235 5 70 13 57 16atcgca-cds-23s°
16atcgca-cds-235-tac-gga-acc
bet043 5*16atcgca235 6 65 15 50
16atcgca235-tac-gga-acc
bet044 4*16atcgca-cds-235 5 71 13 58
16atcgca-cds-235-tac-gga-acc
bet046 4*16atcgca-cds-235 5 71 13 58
16atcgca-cds-235-tac-gga-acc
bet049 4*16atcgca-cds-235 6 71 13 58
16-cds-235
16atcgca-cds-235-tac-gga-acc
bet050 3*16atcgca-cds-23-cds-5 4 59 8 51
16atcgca-cds-23s°
bet067 4*16atcgca-cds-235 5 70 13 57
16atcgca-cds-235-tac-gga-acc
bet080 4*16atcgca-cds-23-cds-5 4 66 8 58
bet160 2*16atcgca235 2 46 4 42
bet161 8*16atcgca235 8 101 16 85
bet167 9*16atcgca235 9 105 18 87
71
lien blocs 16s total aas avec sans total page Bet173-262 Notes
bet173 4*16atcgca235 5 85 11 74 16s23s5s 6-atcgca-35 avant
agc-16atcgca235 sans 26 3 avant
3aas agc-16atcgca235
bet182 16atcgca235 1 72 2 70 cds 2*atgf-16atcgca235
cds-3aas
bet183 16atcgca235 2 47 5 42 29 total 0 26 3
atgf-16atcgca235
bet188 4*16atcgca235 4 66 8 58
bet214 16atcgca235 1 42 2 40
bet219 3*16atcgca235 3 66 6 60
bet224 4*16atcgca235 4 82 8 74
bet228 2*16atcgca235 2 53 4 49
bet236 3*16atcgca235 3 58 6 52
bet257 16atcgca235 2 47 5 42
atgf-16atcgca235
bet262 2*16atcgca235 2 65 4 61
29
lien blocs 16s total aas avec sans total page Total Notes
44 16s23s5s 6-atcgca-35 avant
sans 2 120 3 3aas
Moyenne 62 8 54 3aas 0 4 4*16atcgca235-tac-gga-acc
ecartype 14 4 11 cds 3 26
max 105 18 87 cds-3aas 0 6 cds-3aas
min 40 2 36 164 total 5 156 3 6*16atcgca-cds-235-tac-gga-acc
165 blocs 44 génomes 36 cds / 9
avant
agc-16atcgca235
2*atgf-16atcgca235
incomplets
16atcgca-cds-23s°
5s de trop
16atcgca2355

beta notes[modifier | modifier le wikicode]

  • Les cds dans 16s-atcgca-cds-23s5s ont disparus au 10.2.20 du NCBI. De même pour 16s-cds-23s5s.
  • La grande homogénéité de ces échantillons est due au grand nombre de génomes Burkholderia, 11 sur 44 beta décomptés.

beta typage[modifier | modifier le wikicode]

beta type 16-y-235 après 16s[modifier | modifier le wikicode]

  • Typpe
Type		total	%
16s23s5s	2	1,2
atcgca		127	77
atcgca-cds	32	20
cds		3	1,8
total		164	

beta type 16235-z après 5s[modifier | modifier le wikicode]

  • Type
Type		total	%
sans		153	93
tac-gga-acc	10	6
5s		1	1
total		164	

beta type x-16235 avant 16s[modifier | modifier le wikicode]

  • Type
Type	total
agc	1
atgf	2

Tableau des noms beta[modifier | modifier le wikicode]

  • Lien tableur: Tableau des noms beta
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
  • Légende
    - notes:2*70, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes beta
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs           total           16071
génomes		ruptures	faits	total
total		130		44	263
F. Noms des beta
ruptures notes rRNAs fait code tRNAs génomes
1 433 1 bet001 60 Achromobacter xylosoxidans A8
bet002 58 Achromobacter xylosoxidans C54
bet003 54 Achromobacter xylosoxidans NH44784-1996
1 333 1 bet004 55 Acidovorax avenae subsp. avenae ATCC 19860
1 333 1 bet005 57 Acidovorax citrulli AAC00-1
1 333 1 bet006 53 Acidovorax ebreus TPSY
1 333 1 bet007 56 Acidovorax sp. JS42
1 333 1 bet008 54 Acidovorax sp. KKS102
1 222 1 bet009 43 Advenella kashmirensis WT001
1 222 1 bet010 42 Advenella mimigardefordensis DPN7
1 333 1 bet011 57 Alicycliphilus denitrificans BC
bet012 58 Alicycliphilus denitrificans K601
1 444 1 bet013 63 Aromatoleum aromaticum EbN1
1 444 1 bet014 56 Azoarcus sp. BH72
1 555 1 bet015 67 Azoarcus sp. KH32C
1 333 1 bet016 40 Basilea psittacipulmonis DSM 24701
1 - bet017 43 beta proteobacterium CB
1 333 1 bet018 64 Bordetella avium 197N
1 333 1 bet019 57 Bordetella bronchiseptica 253
bet020 56 Bordetella bronchiseptica MO149
bet021 56 Bordetella bronchiseptica S798
1 333 1 bet022 57 Bordetella holmesii 44057
bet023 56 Bordetella holmesii ATCC 51541
1 333 1 bet024 56 Bordetella parapertussis Bpp5
1 333 1 bet025 53 Bordetella pertussis 137
bet026 53 Bordetella pertussis 18323
bet027 53 Bordetella pertussis B1917
bet028 53 Bordetella pertussis CS
1 333 1 bet029 53 Bordetella petrii DSM 12804
1 2*70 bet030 140 Burkholderia ambifaria AMMD
666 1 bet031 69 Burkholderia ambifaria MC40-6
1 666 1 bet032 72 Burkholderia cenocepacia AU 1054
bet033 73 Burkholderia cenocepacia DDS 22E-1
bet034 69 Burkholderia cenocepacia DWS 37E-2
bet035 67 Burkholderia cenocepacia H111
bet036 73 Burkholderia cenocepacia HI2424
bet037 77 Burkholderia cenocepacia J2315
bet038 75 Burkholderia cenocepacia MC0-3
1 666 1 bet039 70 Burkholderia cepacia DDS 7H-2
bet040 60 Burkholderia cepacia GG4
bet041 70 Burkholderia cepacia LO6
1 555 1 bet042 70 Burkholderia dolosa AU0158
1 666 1 bet043 65 Burkholderia fungorum ATCC BAA-463
1 555 1 bet044 71 Burkholderia gladioli ATCC 10248
bet045 72 Burkholderia gladioli BSR3
1 555 1 bet046 71 Burkholderia glumae BGR1
bet047 67 Burkholderia glumae LMG 2196 ATCC 33617
bet048 68 Burkholderia glumae PG1
1 666 1 bet049 71 Burkholderia lata 383
1 343 1 bet050 59 Burkholderia mallei 11
bet051 59 Burkholderia mallei 2000031063
bet052 59 Burkholderia mallei 2002721276
bet053 59 Burkholderia mallei 2002734299
bet054 56 Burkholderia mallei 2002734306
bet055 57 Burkholderia mallei 23344
bet056 59 Burkholderia mallei 6
bet057 59 Burkholderia mallei ATCC 23344
bet058 57 Burkholderia mallei BMQ
bet059 59 Burkholderia mallei FMH 23344
bet060 56 Burkholderia mallei India86-567-2
bet061 57 Burkholderia mallei KC 1092
bet062 59 Burkholderia mallei NCTC 10229
2*58 bet063 116 Burkholderia mallei NCTC 10247
bet064 57 Burkholderia mallei SAVP1
1 2*67 bet065 134 Burkholderia multivorans ATCC 17616
bet066 69 Burkholderia multivorans ATCC BAA-247
555 1 bet067 70 Burkholderia multivorans DDS 15A-1
1 bet068 62 Burkholderia oklahomensis C6786
bet069 62 Burkholderia oklahomensis EO147
1 bet070 64 Burkholderia phenoliruptrix BR3459a
1 bet071 67 Burkholderia phymatum STM815
1 bet072 66 Burkholderia phytofirmans PsJN
1 2*65 bet073 130 Burkholderia pseudomallei 1026b
2*62 bet074 124 Burkholderia pseudomallei 1106a
bet075 64 Burkholderia pseudomallei 1710b
bet076 64 Burkholderia pseudomallei 3921
bet077 63 Burkholderia pseudomallei 406e
bet078 63 Burkholderia pseudomallei 576
bet079 64 Burkholderia pseudomallei 668
444 1 bet080 66 Burkholderia pseudomallei 7894
bet081 64 Burkholderia pseudomallei A79A
bet082 64 Burkholderia pseudomallei B03
bet083 64 Burkholderia pseudomallei BDP
bet084 64 Burkholderia pseudomallei BEJ
bet085 65 Burkholderia pseudomallei BGR
bet086 63 Burkholderia pseudomallei BPC006
bet087 63 Burkholderia pseudomallei BSR
bet088 62 Burkholderia pseudomallei HBPUB10134a
bet089 64 Burkholderia pseudomallei HBPUB10303a
bet090 64 Burkholderia pseudomallei K42
2*66 bet091 132 Burkholderia pseudomallei K96243
bet092 62 Burkholderia pseudomallei Mahidol-1106a
bet093 63 Burkholderia pseudomallei MSHR1153
bet094 65 Burkholderia pseudomallei MSHR146
bet095 62 Burkholderia pseudomallei MSHR1655
bet096 62 Burkholderia pseudomallei MSHR2243
bet097 64 Burkholderia pseudomallei MSHR2543
bet098 64 Burkholderia pseudomallei MSHR305
bet099 63 Burkholderia pseudomallei MSHR346
bet100 65 Burkholderia pseudomallei MSHR3965
bet101 66 Burkholderia pseudomallei MSHR491
bet102 65 Burkholderia pseudomallei MSHR511
bet103 64 Burkholderia pseudomallei MSHR520
bet104 64 Burkholderia pseudomallei MSHR5848
bet105 64 Burkholderia pseudomallei MSHR5855
bet106 63 Burkholderia pseudomallei MSHR5858
bet107 62 Burkholderia pseudomallei MSHR62
bet108 64 Burkholderia pseudomallei MSHR668
bet109 62 Burkholderia pseudomallei MSHR840
bet110 65 Burkholderia pseudomallei NAU20B-16
bet111 65 Burkholderia pseudomallei NAU35A-3
bet112 63 Burkholderia pseudomallei NCTC 13178
bet113 64 Burkholderia pseudomallei NCTC 13179
bet114 70 Burkholderia pseudomallei Pasteur 52237
bet115 63 Burkholderia pseudomallei PB08298010
bet116 63 Burkholderia pseudomallei TSV 48
bet117 67 Burkholderia pseudomallei vgh07
1 bet118 51 Burkholderia rhizoxinica HKI 454
1 bet119 64 Burkholderia sp. 2002721687
1 bet120 64 Burkholderia sp. BGK
1 bet121 65 Burkholderia sp. CCGE1001
1 bet122 75 Burkholderia sp. CCGE1002
1 bet123 65 Burkholderia sp. CCGE1003
1 bet124 70 Burkholderia sp. KJ006
1 bet125 63 Burkholderia sp. RPE64
1 bet126 67 Burkholderia sp. RPE67
1 bet127 63 Burkholderia sp. TSV202
1 bet128 67 Burkholderia sp. YI23
1 bet129 63 Burkholderia thailandensis 2002721643
bet130 63 Burkholderia thailandensis 2002721723
bet131 63 Burkholderia thailandensis 2003015869
bet132 65 Burkholderia thailandensis 34
bet133 62 Burkholderia thailandensis E254
bet134 63 Burkholderia thailandensis E264 ATCC 700388
bet135 63 Burkholderia thailandensis E444
bet136 61 Burkholderia thailandensis H0587
bet137 60 Burkholderia thailandensis MSMB121
bet138 60 Burkholderia thailandensis MSMB59
bet139 62 Burkholderia thailandensis USAMRU Malaysia #20
1 bet140 75 Burkholderia ubonensis MSMB22
1 bet141 71 Burkholderia vietnamiensis G4
bet142 75 Burkholderia vietnamiensis LMG 10929
1 2*68 bet143 136 Burkholderia xenovorans LB400
1 bet144 48 Burkholderiales bacterium GJ-E10
1 bet145 50 Candidatus Accumulibacter phosphatis clade IIA str. UW-1
1 bet146 44 Candidatus Kinetoplastibacterium blastocrithidii ex Strigomonas culicis
bet147 44 Candidatus Kinetoplastibacterium blastocrithidii TCC012E
1 bet148 45 Candidatus Kinetoplastibacterium crithidii ex Angomonas deanei ATCC 30255
bet149 45 Candidatus Kinetoplastibacterium crithidii TCC036E
1 bet150 44 Candidatus Kinetoplastibacterium desouzaii TCC079E
1 bet151 44 Candidatus Kinetoplastibacterium galatii TCC219
1 bet152 44 Candidatus Kinetoplastibacterium oncopeltii TCC290E
1 bet153 29 Candidatus Nasuia deltocephalinicola str. NAS-ALF
1 bet154 34 Candidatus Profftella armatura DC
1 bet155 45 Candidatus Symbiobacter mobilis CR
1 bet156 31 Candidatus Tremblaya phenacola PAVE
1 bet157 16 Candidatus Tremblaya princeps PCIT
bet158 16 Candidatus Tremblaya princeps PCVAL
1 bet159 25 Candidatus Zinderia insecticola CARI
1 222 1 bet160 46 Castellaniella defragrans 65Phen
1 888 1 bet161 101 Chromobacterium violaceum ATCC 12472
1 bet162 60 Collimonas arenae Cal35
1 bet163 59 Collimonas fungivorans Ter331
1 bet164 45 Comamonadaceae bacterium A1
bet165 45 Comamonadaceae bacterium B1
1 bet166 85 Comamonas testosteroni CNB-2 CNB-1 substr. CNB-2
1 999 1 bet167 105 Comamonas testosteroni TK102
1 bet168 73 Cupriavidus basilensis 4G11
1 bet169 67 Cupriavidus metallidurans CH34
1 bet170 73 Cupriavidus necator N-1
1 bet171 66 Cupriavidus taiwanensis LMG 19424 LMG19424
1 bet172 65 Dechloromonas aromatica RCB
1 555 1 bet173 85 Delftia acidovorans SPH-1
1 bet174 83 Delftia sp. Cs1-4
1 bet175 53 Gallionella capsiferriformans ES-2
1 bet176 59 Herbaspirillum seropedicae SmR1
1 bet177 47 Herminiimonas arsenicoxydans
1 bet178 76 Janthinobacterium agaricidamnosum NBRC 102515 DSM 9628
1 bet179 49 Janthinobacterium sp. Marseille
1 bet180 80 Laribacter hongkongensis HLHK9
1 bet181 51 Leptothrix cholodnii SP-6
1 111 1 bet182 72 Methylibium petroleiphilum PM1
1 222 1 bet183 47 Methylobacillus flagellatus KT
1 bet184 47 Methylotenera mobilis JLW8
1 bet185 48 Methylotenera versatilis 301
1 bet186 50 Methylovorus glucosetrophus SIP3-4
1 bet187 48 Methylovorus sp. MP688
1 444 1 bet188 66 Neisseria elongata subsp. glycolytica ATCC 29315
1 bet189 56 Neisseria gonorrhoeae FA 1090
bet190 56 Neisseria gonorrhoeae MS11
bet191 56 Neisseria gonorrhoeae NCCP11945
1 bet192 60 Neisseria lactamica 020-06
1 bet193 61 Neisseria meningitidis 053442
bet194 61 Neisseria meningitidis 510612
bet195 61 Neisseria meningitidis 8013
bet196 60 Neisseria meningitidis alpha14
bet197 58 Neisseria meningitidis alpha710
bet198 60 Neisseria meningitidis FAM18
bet199 61 Neisseria meningitidis G2136
bet200 60 Neisseria meningitidis H44/76
bet201 60 Neisseria meningitidis LNP21362
bet202 61 Neisseria meningitidis M01-240149
bet203 61 Neisseria meningitidis M01-240355
bet204 60 Neisseria meningitidis M04-240196
bet205 60 Neisseria meningitidis M10208
bet206 62 Neisseria meningitidis M7124
bet207 60 Neisseria meningitidis MC58
bet208 60 Neisseria meningitidis NM3682
bet209 62 Neisseria meningitidis NM3683
bet210 60 Neisseria meningitidis NM3686
bet211 61 Neisseria meningitidis NZ-05/33
bet212 57 Neisseria meningitidis WUE 2594
bet213 60 Neisseria meningitidis Z2491
1 111 1 bet214 42 Nitrosomonas europaea ATCC 19718
1 bet215 42 Nitrosomonas eutropha C91
1 bet216 43 Nitrosomonas sp. AL212
1 bet217 44 Nitrosomonas sp. Is79A3
1 bet218 43 Nitrosospira multiformis ATCC 25196
1 333 1 bet219 66 Pandoraea apista TF81F4
1 bet220 69 Pandoraea oxalativorans DSM 23570
1 bet221 70 Pandoraea pnomenusa 3kgm
bet222 69 Pandoraea pnomenusa DSM 16536
bet223 71 Pandoraea pnomenusa RB38
1 444 1 bet224 82 Pandoraea pulmonicola DSM 16583
1 bet225 68 Pandoraea sp. RB-44
1 bet226 67 Pandoraea sputorum DSM 21091
1 bet227 68 Pandoraea vervacti NS15
1 222 1 bet228 53 Polaromonas naphthalenivorans CJ2
1 bet229 46 Polaromonas sp. JS666
1 bet230 40 Polynucleobacter necessarius subsp. asymbioticus MWH-MoK4
bet231 42 Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
bet232 37 Polynucleobacter necessarius subsp. necessarius STIR1
1 bet233 90 Pseudogulbenkiania sp. NH8B
1 bet234 49 Pusillimonas sp. T7-7
1 bet235 52 Ralstonia mannitolilytica SN82F48
1 333 1 bet236 58 Ralstonia pickettii 12D
bet237 58 Ralstonia pickettii 12J
bet238 70 Ralstonia pickettii DTP0602
1 bet239 54 Ralstonia solanacearum CFBP2957
bet240 62 Ralstonia solanacearum CMR15
bet241 55 Ralstonia solanacearum FQY 4
bet242 60 Ralstonia solanacearum GMI1000
bet243 55 Ralstonia solanacearum Po82
bet244 58 Ralstonia solanacearum PSI07
1 bet245 46 Ramlibacter tataouinensis TTB310
1 bet246 49 Rhodocyclaceae bacterium PG1-Ca6
1 bet247 48 Rhodoferax ferrireducens T118 DSM 15236
1 bet248 51 Rubrivivax gelatinosus IL144
1 bet249 46 Sideroxydans lithotrophicus ES-1
1 bet250 61 Snodgrassella alvi wkB2
1 bet251 46 Sulfuricella denitrificans skB26
1 bet252 48 Sulfuritalea hydrogenivorans sk43H DSM22779
1 bet253 39 Taylorella asinigenitalis MCE3
1 bet254 38 Taylorella equigenitalis ATCC 35865
bet255 38 Taylorella equigenitalis MCE9
1 bet256 58 Thauera sp. MZ1T
1 222 1 bet257 47 Thiobacillus denitrificans ATCC 25259
1 bet258 49 Thiomonas arsenitoxydans 3As
1 bet259 49 Thiomonas intermedia K12
1 bet260 50 Variovorax paradoxus B4
bet261 60 Variovorax paradoxus EPS
222 1 bet262 65 Variovorax paradoxus S110
1 bet263 49 Verminephrobacter eiseniae EF01-2
130 44

Delta[modifier | modifier le wikicode]

delta blocs[modifier | modifier le wikicode]

delta blocs
lien blocs 16s total aas avec sans total page del001-62 Notes
del01 2*16atcgca235 2 49 4 45 16s23s5s 16-atcgca-35 16-gca-235 16-atc-235
del03 2*16atcgca235 2 53 4 49 sans 17 40 1 2 1-3
1-3 1 16atcgca235-atgj
del05 16s23s5s 2 36 2 34 61 total 17 41 1 2
gca-16-atc-235 avant
gca-16-atc-235
del11 3*16atcgca235 3 61 6 55
del13 2*16atcgca235 2 62 4 58 incomplets
16s-23s
del15 4*16s23s5s 6 55 0 55 16-atc
16s23s5s-5s 16atcgca-23-23-5s
16atccga235
5s 5s de trop
16atcgca2355
del19 16s23s5s 1 54 0 54 16s23s5s-5s
16atcgca235-5s-5s
del23 5*16s23s5s 7 68 4 64 3*5s
2*16atcgca235
5s
del26 4*16s23s5s 4 72 0 72
del30 5*16atcgca235 5 79 10 69
del33 5*16atcgca235 5 92 10 82
del34 4*16atcgca235 5 72 8 64
16atcgca2355 2 -2
del41 4*16atcgca235 4 61 8 53
del46 4*16atcgca235 4 65 8 57
del52 16-atc-235 2 49 2 47
16-gca-235
del53 16atcgca235 2 49 5 44
16atcgca235-atgj
del56 16atcgca235 3 87 5 82
16-atc-235
16atcgca-23-23-5s
del59 2*16atcgca235 2 56 4 52
del62 16atcgca235-5s-5s 4 66 3 63
16s23s5s
16s-23s
16-atc
5s 65
lien blocs 16s total aas avec sans total page Total Notes
19 16s23s5s 16-atcgca-35 16-gca-235 16-atc-235
sans 17 40 1 2 1-3
Moyenne 62 5 58 1-3 1 16atcgca235-atgj
ecartype 14 3 12 61 total 17 41 1 2
max 92 10 82 avant
min 36 0 34 gca-16-atc-235
incomplets
16s-23s
16-atc
16atcgca-23-23-5s
65 blocs 19 génomes 0 cds
5s de trop
16atcgca2355
16s23s5s-5s
16atcgca235-5s-5s
3*5s

delta notes[modifier | modifier le wikicode]

delta typage[modifier | modifier le wikicode]

delta type 16-y-235 après 16s[modifier | modifier le wikicode]

  • Type
Type		tableau		avant 16s	incomplet	total	%
16s23s5s	17				1		18	28
atcgca		41				1		42	66
gca		1						1	2
atc		2		1				3	5

total		61		1		2		64	

delta type 16235-z après 5s[modifier | modifier le wikicode]

  • Type
sans	63
atgj	1
5s	4
total	68

delta type x-16235 avant 16s[modifier | modifier le wikicode]

  • Type: gca.

Tableau des noms delta[modifier | modifier le wikicode]

  • Lien tableur: Tableau des noms delta
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
  • Légende
    - notes:45+41, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes delta
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs           total           3635
génomes		ruptures	faits	total
total		55		19	65
F. Noms des delta
ruptures notes rRNAs fait code tRNAs génomes
1 222 1 del01 49 Anaeromyxobacter dehalogenans 2CP-1
del02 49 Anaeromyxobacter dehalogenans 2CP-C
1 222 1 del03 53 Anaeromyxobacter sp. Fw109-5
1 del04 51 Anaeromyxobacter sp. K
1 222 1 del05 36 Bacteriovorax marinus SJ
1 del06 37 Bdellovibrio bacteriovorus 109J
del07 37 Bdellovibrio bacteriovorus str. Tiberius
del08 35 Bdellovibrio bacteriovorus W
1 del09 34 Bdellovibrio exovorus JSS
1 del10 38 Candidatus Babela massiliensis 673862
1 333 1 del11 61 Corallococcus coralloides DSM 2259
1 del12 48 Desulfarculus baarsii DSM 2075
1 222 1 del13 62 Desulfatibacillum alkenivorans AK-01
1 del14 49 Desulfobacca acetoxidans DSM 11109
1 866 1 del15 55 Desulfobacterium autotrophicum HRM2
1 del16 52 Desulfobacula toluolica Tol2
1 del17 54 Desulfobulbus propionicus DSM 2032
1 del18 47 Desulfocapsa sulfexigens DSM 10523
1 111 1 del19 54 Desulfococcus oleovorans Hxd3
1 del20 50 Desulfohalobium retbaense DSM 5692
1 del21 66 Desulfomicrobium baculatum DSM 4028
1 del22 61 Desulfomonile tiedjei DSM 6799
1 877 1 del23 68 Desulfotalea psychrophila LSv54
1 del24 56 Desulfovibrio aespoeensis Aspo-2
1 del25 62 Desulfovibrio africanus str. Walvis Bay
1 444 1 del26 72 Desulfovibrio alaskensis G20
1 del27 58 Desulfovibrio desulfuricans ND132
1 del28 54 Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
1 del29 49 Desulfovibrio gigas DSM 1382 ATCC 19364
1 555 1 del30 79 Desulfovibrio hydrothermalis AM13 DSM 14728
1 del31 61 Desulfovibrio magneticus RS-1
1 del32 64 Desulfovibrio piezophilus C1TLV30
1 555 1 del33 92 Desulfovibrio salexigens DSM 2638
1 655 1 del34 72 Desulfovibrio vulgaris DP4
del35 71 Desulfovibrio vulgaris RCH1
del36 72 Desulfovibrio vulgaris str. Hildenborough
del37 66 Desulfovibrio vulgaris str. Miyazaki F
1 del38 49 Desulfurella acetivorans A63
1 del39 49 Desulfurivibrio alkaliphilus AHT2
1 del40 55 Geoalkalibacter subterraneus Red1
1 444 1 del41 61 Geobacter bemidjiensis Bem
1 del42 50 Geobacter daltonii FRC-32
1 del43 45 Geobacter lovleyi SZ
1 del44 51 Geobacter metallireducens GS-15
1 del45 53 Geobacter pickeringii G13
1 444 1 del46 65 Geobacter sp. M18
1 del47 60 Geobacter sp. M21
1 del48 56 Geobacter sulfurreducens AM-1
del49 49 Geobacter sulfurreducens KN400
del50 51 Geobacter sulfurreducens PCA
1 del51 50 Geobacter uraniireducens Rf4
1 222 1 del52 49 Haliangium ochraceum DSM 14365
1 222 1 del53 49 Hippea maritima DSM 10411
1 del54 46 Lawsonia intracellularis N343
del55 46 Lawsonia intracellularis PHE/MN1-00
1 334 1 del56 70 Myxococcus fulvus HW-1
1 - del57 87 Myxococcus stipitatus DSM 14675
1 del58 69 Myxococcus xanthus DK 1622
1 222 1 del59 56 Pelobacter carbinolicus DSM 2380
1 del60 55 Pelobacter propionicus DSM 2379
1 del61 66 Sorangium cellulosum So ce56 So ce 56
543 1 del62 66 Sorangium cellulosum So0157-2
1 del63 54 Stigmatella aurantiaca DW4/3-1
1 del64 54 Syntrophobacter fumaroxidans MPOB
1 del65 50 Syntrophus aciditrophicus SB
55 19

Epsilon[modifier | modifier le wikicode]

epsilon blocs[modifier | modifier le wikicode]

  • Lien tableur: epsilon blocs
  • Légende:
    - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 23s°: 23S ribosomal RNA rRNA prediction is too short
    - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
    - 16s°: 16S ribosomal RNA rRNA prediction is too short
  • notes:
    - 11 blocs cassés, (16s,235), pour 6 génomes
    - zéro blocs 16235
    - Les s° sont considérés comme des intercalaires
Epsilon blocs
lien blocs 16s total aas avec sans total page ep001-23 Notes
ep001 4*16atcgca235 5 54 11 43 16-atcgca-35 16-gcaatc-35 16-gca-35 16-atc-35 avant
aac-16atcgca235 sans 12 9 8 4 3 1-3
1-3 3 3*16atcgca235-acc
ep004 2*16atcgca235 4 56 9 47
2*16atcgca235-acc 39 total 15 9 8 4 3 avant
aac-16atcgca235
ep005 3*16atcgca235 5 56 13 43 aac-aac-16atcgca235
aac-aac-16atcgca235 aag-caa-atgf-16s-cds-235
16atcgca235-acc
incomplets
ep006 3*16-gca-atc-235 3 45 6 39 2*16s-gca-atc-cds
ep007 2*16-gca-atc-235 3 41 6 35 autres incomplets
16-gca-atc-2355 2*235
3*16-16s°-gca-atc-235
ep013 3*16atcgca235 3 47 6 41 4*16-gca-23-23s°-5s
2*16-atc-23-23s°-5s
ep014 3*16-16s°-gca-atc-235 3 47 6 41
5s de trop
ep015 2*16-gca-23-23s°-5s 3 45 3 42 16-gca-atc-2355
16-atc-23-23s°-5s
ep018 2*16-gca-235 3 44 3 41
16-atc-235
ep019 2*16-gca-23-23s°-5s 3 44 3 41
16-atc-23-23s°-5s
ep022 aag-caa-atgf-16s-cds-235 3 44 7 37
2*16s-gca-atc-cds
2*235
ep023 2*16-gca-235 3 44 3 41
16-atc-235 41
lien blocs 16s total aas avec sans total page ep024-151 Notes
ep024 3*16-gca-atc-235 3 43 6 37 16-atcgca-35 16-gcaatc-35 16-gca-35 16-atc-35 avant
ep025 3*16-gca-atc-235 3 45 6 39 sans 17 20 1 avant
1-3 8aas-16-gca-atc-235-cds
ep057 2*16-gca-atc-235 3 47 14 33
8aas-16-gca-atc-235-cds 38 total 17 20 0 0 1 exception
16-gca-atc-235-cds
ep063 3*16-gca-atc-235 3 47 6 41
ep064 3*16-gca-atc-235 3 46 6 40 incomplets
ep065 3*16-gca-atc-235 3 47 6 41 9*16s, 235
2*16s, 235, 5
ep067 2*16-gca-atc-235 3 44 6 38 16s
16-gca-atc-235-cds
autres incomplets
ep068 2*16s, 235 2 37 0 37 23s-23s’-23s°-5s
ep069 2*16s, 235 2 37 0 37 23s°-23s’-5s
ep070 2*16s, 235 2 39 0 39 23s5s
ep072 2*16atcgca235 2 40 2 38 5s de trop
2*16s, 235, 5s
ep074 2*16s, 235, 5s 2 37 0 37
ep057
ep075 16s 1 42 0 42 aaa
23s-23s’-23s°-5s gta
23s°-23s’-5s gac
aaa
ep076 16atcgca235 1 38 2 36 gta
ep077 2*16atcgca235 2 39 4 35 gac
aaa
ep078 16s, 235 1 36 0 36 gag
16s
ep146 2*16s, 235 2 37 0 37
ep148 4*16atcgca235 4 49 8 41
ep149 2*16atcgca235 2 45 4 41
ep150 3*16atcgca235 3 45 6 39
ep151 3*16atcgca235 3 51 6 45
50
lien blocs 16s total aas avec sans total page ep152-158 Notes
ep152 2*16-gca-235 4 44 4 40 16-atcgca-35 16-gcaatc-35 16-gca-35 16-atc-35 avant
2*16-atc-235 sans 6 10 5 1-3
1-3 1 16atcgca235-cgc
ep153 3*16-gca-235 4 46 4 42
16-atc-235 22 total 7 0 10 5 0
ep154 3*16-gca-235 4 50 4 46
16-atc-235
Total Notes
ep155 2*16atcgca235 2 42 4 38 1-3
16atcgca235-cgc
ep156 2*16atcgca235 3 44 7 37 3*16atcgca235-acc
16atcgca235-cgc
avant
ep157 2*16atcgca235 2 47 4 43 aac-16atcgca235
aac-aac-16atcgca235
ep158 2*16-gca-235 3 45 3 42 aag-caa-atgf-16s-cds-235
16-atc-235 22 8aas-16-gca-atc-235-cds
lien blocs 16s total aas avec sans total page Total
40 16-atcgca-35 16-gcaatc-35 16-gca-35 16-atc-35 avant incomplets
sans 35 29 18 9 4 9*16s, 235
Moyenne 44 5 40 1-3 4 0 0 0 0 2*16s, 235, 5
ecartype 5 3 3 16s
max 56 14 47 99 total 39 29 18 9 4 2*16s-gca-atc-cds
min 36 0 33
autres incomplets
3*16-16s°-gca-atc-235
4*16-gca-23-23s°-5s
2*16-atc-23-23s°-5s
23s-23s’-23s°-5s
23s°-23s’-5s
3*235
exception
16-gca-atc-235-cds
113 blocs 40 génomes
5s de trop
1 cds zéro blocs 16235 16-gca-atc-2355
2*16s, 235, 5

epsilon notes[modifier | modifier le wikicode]

  • Le cds de ep057 8aas-16-gca-atc-235-cds. Les 8 tRNAs sont aaa gta gac aaa gta gac aaa gag. J'ai noté le 20.8.19 ce cds parce qu'il présentait une répétition de 19 FLL. A la date du 8.1.20 de NCBI la traduction n'est plus la même (adresse 494395..494628), mais il y a toujours une répétition de 19, mais KEI. Je reproduis ici les différences. Apparemment ils ont corrigé une erreur sur Met (CAT), lors de mon prélèvement du 20.8.19 c'était CAT et le 8.1.20 c'est devenu CAA (voitr ici " erreur sur CAT ".
  • Mon prélèvement à la date du 20.8.19 qui n'est pas NCBI et j'avais copié la séquence d'aas

MFYNLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLVRS

à l'envers
A
TGATCGCAC						SRV
TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA	LLF LLF LLF LLF LLF LLF
TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA	LLF LLF LLF LLF LLF LLF
TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA	LLF LLF LLF LLF LLF LLF
TAAAAGAAA						LLF 
TAAATTATAAAA						LNYF
CAA							erreur sur CAT
TAAAAACTATCTCTAAAGAAAAACAAATAATAAACTAA			reste du 8.1.20
  • Prélèvement à la date NCBI du 8.1.20 la séquence d'aas est

MIALKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEINYKTIKTISKEKQIIN

à l'endroit
ATGATCGCACTA						MIAL
AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA	KEI KEI KEI KEI KEI KEI 
AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA	KEI KEI KEI KEI KEI KEI 
AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA	KEI KEI KEI KEI KEI KEI 
AAAGAAATA						KEI
AATTATAAAACAATAAAAACTATCTCTAAAGAAAAACAAATAATAAACTAA	NYKTIKTISKEKQIIN

epsilon typage[modifier | modifier le wikicode]

epsilon type 16-y-235 après 16s[modifier | modifier le wikicode]

Epsilon typage, après 16s
types tableau décompte avant 16s incomplets total %
atcgca 39 39 2 41 37
gcaatc 29 26 1 27 24
gca 18 14 14 13
atc 9 7 7 6
16s-16s°-gcaatc-235 3 3 3
16s-gca-23-23s°-5s 4 4 4
16s-atc-23-23s°-5s 2 2 2
16s-cds-235 1 1 1
16s, 235 9 9 8
16s, 235, 5s 2 2 2
16s, - 1 1 1
23s°-23s’-5s
23s-23s’-23s°-5s
total 111 100
atc, gca 95 95 3 98 88
tRNA total %
atc 74 40
gca 89 48
cds 12 6
16s 11 6
total 186 100

epsilon type 16235-z après 5s[modifier | modifier le wikicode]

cgc	1
acc	3
5s	3
	
sans	104
total	111

epsilon type x-16235 avant 16s[modifier | modifier le wikicode]

aag-caa-atgf			1
aac				1
aac-aac				1
2*(aaa-gta-gac)-aaa-gag		1
		
sans				107
total				111

Tableau des noms epsilon[modifier | modifier le wikicode]

  • Lien tableur: Tableau des noms epsilon
  • Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
  • Légende
    - notes:45+41, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
    - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
    - rupture, sélection des génomes sur les 2 premiers attributs
    - fait, dans génomes epsilon
    - code, utilisé dans les génomes "fait"
    - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs           total           6638
génomes		ruptures	faits	total
total		36		38	158
F. Noms des epsilon
ruptures notes rRNAs fait code tRNAs génomes
1 555 1 ep001 54 Arcobacter butzleri 7h1h
ep002 54 Arcobacter butzleri ED-1
ep003 54 Arcobacter butzleri RM4018
1 444 1 ep004 56 Arcobacter nitrofigilis DSM 7299
1 555 1 ep005 56 Arcobacter sp. L
1 333 1 ep006 45 Campylobacter coli 15-537360
433 1 ep007 41 Campylobacter coli 76339
ep008 45 Campylobacter coli CVM N29710
ep009 45 Campylobacter coli FB1
ep010 45 Campylobacter coli RM1875
ep011 41 Campylobacter coli RM4661
ep012 45 Campylobacter coli RM5611
1 333 1 ep013 47 Campylobacter concisus 13826
1 333 1 ep014 47 Campylobacter curvus 525.92
1 333 1 ep015 45 Campylobacter fetus subsp. fetus 04/554
ep016 44 Campylobacter fetus subsp. fetus 82-40
ep017 44 Campylobacter fetus subsp. testudinum 03-427
333 1 ep018 44 Campylobacter fetus subsp. testudinum pet-3
333 1 ep019 44 Campylobacter fetus subsp. venerealis 97/608
ep020 44 Campylobacter fetus subsp. venerealis cfvi03/293
ep021 44 Campylobacter fetus subsp. venerealis str. 84-112
1 333 1 ep022 44 Campylobacter hominis ATCC BAA-381
1 333 1 ep023 44 Campylobacter iguaniorum 1485E
1 333 1 ep024 43 Campylobacter insulaenigrae NCTC 12927
1 333 1 ep025 45 Campylobacter jejuni 32488
ep026 45 Campylobacter jejuni 4031
ep027 45 Campylobacter jejuni RM1221
ep028 45 Campylobacter jejuni subsp. doylei 269.97
ep029 45 Campylobacter jejuni subsp. jejuni 00-0949
ep030 45 Campylobacter jejuni subsp. jejuni 00-1597
ep031 41 Campylobacter jejuni subsp. jejuni 00-2425
ep032 45 Campylobacter jejuni subsp. jejuni 00-2426
ep033 45 Campylobacter jejuni subsp. jejuni 00-2538
ep034 45 Campylobacter jejuni subsp. jejuni 00-2544
ep035 45 Campylobacter jejuni subsp. jejuni 00-6200
ep036 45 Campylobacter jejuni subsp. jejuni 01-1512
ep037 45 Campylobacter jejuni subsp. jejuni 35925B2
45+41 ep038 86 Campylobacter jejuni subsp. jejuni 81-176
ep039 45 Campylobacter jejuni subsp. jejuni 81116 NCTC 11828
ep040 45 Campylobacter jejuni subsp. jejuni CG8421
ep041 47 Campylobacter jejuni subsp. jejuni F38011
ep042 45 Campylobacter jejuni subsp. jejuni IA3902
ep043 45 Campylobacter jejuni subsp. jejuni ICDCCJ07001
ep044 45 Campylobacter jejuni subsp. jejuni M1
ep045 45 Campylobacter jejuni subsp. jejuni MTVDSCj20
ep046 45 Campylobacter jejuni subsp. jejuni NCTC 11168 ATCC 700819
ep047 45 Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
ep048 45 Campylobacter jejuni subsp. jejuni NCTC 11168-GSv NCTC 11168-rNRC
ep049 45 Campylobacter jejuni subsp. jejuni NCTC 11168-K12E5
ep050 45 Campylobacter jejuni subsp. jejuni NCTC 11168-Kf1
ep051 45 Campylobacter jejuni subsp. jejuni NCTC 11168-mcK12E5
ep052 45 Campylobacter jejuni subsp. jejuni NCTC 11168-mfK12E5
ep053 42 Campylobacter jejuni subsp. jejuni PT14
ep054 45 Campylobacter jejuni subsp. jejuni R14
ep055 45 Campylobacter jejuni subsp. jejuni S3
ep056 45 Campylobacter jejuni subsp. jejuni YH001
1 333 1 ep057 47 Campylobacter lari CCUG 22395
ep058 47 Campylobacter lari NCTC 11845
ep059 44 Campylobacter lari RM16701
ep060 44 Campylobacter lari RM16712
ep061 47 Campylobacter lari RM2100 ATCC BAA-1060D
ep062 44 Campylobacter lari subsp. concheus LMG 11760
1 333 1 ep063 47 Campylobacter peloridis LMG 23910
1 333 1 ep064 46 Campylobacter sp. RM16704
1 333 1 ep065 47 Campylobacter subantarcticus LMG 24374
ep066 48 Campylobacter subantarcticus LMG 24377
1 333 1 ep067 44 Campylobacter volucris LMG 24379
1 222 1 ep068 37 Helicobacter acinonychis str. Sheeba
1 222 1 ep069 37 Helicobacter bizzozeronii CIII-1
1 222 1 ep070 39 Helicobacter cetorum MIT 00-7128
ep071 38 Helicobacter cetorum MIT 99-5656
1 222 1 ep072 40 Helicobacter cinaedi ATCC BAA-847
ep073 40 Helicobacter cinaedi PAGU611
1 221 1 ep074 37 Helicobacter felis ATCC 49179
1 213 1 ep075 42 Helicobacter heilmannii ASB1.4
1 111 1 ep076 38 Helicobacter hepaticus ATCC 51449
1 222 ep077 39 Helicobacter mustelae 12198
1 111 ep078 36 Helicobacter pylori 2017
ep079 36 Helicobacter pylori 2018
ep080 74 Helicobacter pylori 26695
ep081 74 Helicobacter pylori 26695-1
ep082 37 Helicobacter pylori 26695-1CH
ep083 37 Helicobacter pylori 26695-1CL
ep084 37 Helicobacter pylori 26695-1MET
ep085 37 Helicobacter pylori 35A
ep086 37 Helicobacter pylori 51
ep087 37 Helicobacter pylori 52
ep088 36 Helicobacter pylori 83
ep089 36 Helicobacter pylori 908
ep090 37 Helicobacter pylori Aklavik117
ep091 37 Helicobacter pylori Aklavik86
ep092 37 Helicobacter pylori B38
ep093 37 Helicobacter pylori B8
ep094 37 Helicobacter pylori BM012A
ep095 37 Helicobacter pylori BM012B
ep096 37 Helicobacter pylori BM012S
ep097 36 Helicobacter pylori BM013A
ep098 36 Helicobacter pylori BM013B
ep099 38 Helicobacter pylori Cuz20
ep100 37 Helicobacter pylori ELS37
ep101 37 Helicobacter pylori F16
ep102 37 Helicobacter pylori F30
ep103 37 Helicobacter pylori F32
ep104 36 Helicobacter pylori F57
ep105 36 Helicobacter pylori G27
ep106 36 Helicobacter pylori Gambia94/24
ep107 36 Helicobacter pylori Hp238
ep108 36 Helicobacter pylori HPAG1
ep109 36 Helicobacter pylori HUP-B14
ep110 37 Helicobacter pylori India7
ep111 37 Helicobacter pylori J166
ep112 36 Helicobacter pylori J99
ep113 37 Helicobacter pylori Lithuania75
ep114 37 Helicobacter pylori NY40
ep115 37 Helicobacter pylori OK113
ep116 36 Helicobacter pylori OK310
ep117 37 Helicobacter pylori oki102
ep118 37 Helicobacter pylori oki112
ep119 36 Helicobacter pylori oki128
ep120 37 Helicobacter pylori oki154
ep121 37 Helicobacter pylori oki422
ep122 37 Helicobacter pylori oki673
ep123 37 Helicobacter pylori oki828
ep124 37 Helicobacter pylori oki898
ep125 36 Helicobacter pylori P12
ep126 37 Helicobacter pylori PeCan18
ep127 37 Helicobacter pylori PeCan4
ep128 37 Helicobacter pylori Puno120
ep129 37 Helicobacter pylori Puno135
ep130 37 Helicobacter pylori Rif1
ep131 37 Helicobacter pylori Rif2
ep132 37 Helicobacter pylori Sat464
ep133 38 Helicobacter pylori Shi112
ep134 37 Helicobacter pylori Shi169
ep135 37 Helicobacter pylori Shi417
ep136 37 Helicobacter pylori Shi470
ep137 36 Helicobacter pylori SJM180
ep138 36 Helicobacter pylori SNT49 Santal49
ep139 36 Helicobacter pylori SouthAfrica20
ep140 37 Helicobacter pylori SouthAfrica7
ep141 37 Helicobacter pylori UM032
ep142 37 Helicobacter pylori UM037
ep143 37 Helicobacter pylori UM066
ep144 37 Helicobacter pylori UM298
ep145 37 Helicobacter pylori UM299
222 1 ep146 37 Helicobacter pylori v225d
ep147 37 Helicobacter pylori XZ274
1 444 1 ep148 49 Nautilia profundicola AmH
1 222 1 ep149 45 Nitratifractor salsuginis DSM 16511
1 333 1 ep150 45 Nitratiruptor sp. SB155-2
1 333 1 ep151 51 Sulfuricurvum kujiense DSM 16994
1 444 1 ep152 44 Sulfurimonas autotrophica DSM 16294
1 444 1 ep153 46 Sulfurimonas denitrificans DSM 1251
1 444 1 ep154 50 Sulfurimonas gotlandica GD1
1 222 1 ep155 42 Sulfurospirillum barnesii SES-3
1 333 1 ep156 44 Sulfurospirillum deleyianum DSM 6946
1 222 1 ep157 47 Sulfurospirillum multivorans DSM 12446
1 333 1 ep158 45 Sulfurovum sp. NBC37-1
36 38
  1. https://www.ncbi.nlm.nih.gov/nuccore/AE007869.2
  2. https://www.ncbi.nlm.nih.gov/nuccore/NC_003062.2
  3. https://www.ncbi.nlm.nih.gov/nuccore/CP002249.1