Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Proteobacteria
Fiche mémoire sur Proteobacteria
- Fiche en préparation
Paris le 12.12.19
Gamma[modifier | modifier le wikicode]
gamma blocs[modifier | modifier le wikicode]
- Lien tableur: gamma blocs
- Légende:
- - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 23s°: 23S ribosomal RNA rRNA prediction is too short
- - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 16s°: 16S ribosomal RNA rRNA prediction is too short
| lien | blocs | 16s | total aas | avec | sans | total page | Gm001-47 | Notes | |||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| gm0001 | atgf-16atcgca235 | 2 | 54 | 3 | 51 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| 16atcgca235 | sans | 27 | 11 | 1 | 4 | avant | |||||||||
| gac-tgg | 1 | 0 | 3 | 3*atgf-16atcgca235 | |||||||||||
| gm0003 | atgf-16atcgca235 | 2 | 51 | 3 | 48 | gac | 1 | 3 | cgg-cac-cca-16atcgca2355-gac-tgg | ||||||
| 16atcgca235 | acc-5s | cgg-cac-cca-16atcgca235 | |||||||||||||
| tgg | 2*cgg-cac-cca-16gaa2355-gac-tgg | ||||||||||||||
| gm0005 | atgf-16atcgca235 | 2 | 50 | 3 | 47 | 51 | total | 0 | 29 | 0 | 14 | 1 | 0 | 7 | |
| 16atcgca235 | incomplets | ||||||||||||||
| 16gaa23? | |||||||||||||||
| gm0017 | 16atcgca235 +5s | 1 | 63 | 2 | 61 | ||||||||||
| différents | |||||||||||||||
| gm0036 | 6*16atcgca235 | 6 | 70 | 12 | 58 | 16gaa235-acc | |||||||||
| 16atcgca235-acc | |||||||||||||||
| gm0037 | 6*16atcgca235 | 6 | 72 | 12 | 60 | ||||||||||
| 5s en trop | |||||||||||||||
| gm0039 | 2*16atcgca235 | 6 | 64 | 14 | 50 | 16atcgca2355-gac-tgg | |||||||||
| 3*16gaa235 | cgg-cac-cca-16atcgca2355-gac-tgg | ||||||||||||||
| cgg-cac-cca-16atcgca2355-gac-tgg | 2*cgg-cac-cca-16gaa2355-gac-tgg | ||||||||||||||
| 5s | |||||||||||||||
| gm0040 | 16atcgaa235 | 6 | 64 | 16 | 48 | ||||||||||
| cgg-cac-cca-16gaa2355-gac-tgg | |||||||||||||||
| 4*16atcgca235 | |||||||||||||||
| gm0043 | 16atcgca235 | 6 | 61 | 14 | 47 | ||||||||||
| cgg-cac-cca-16atcgca235 | |||||||||||||||
| 16atcgca2355-gac-tgg | |||||||||||||||
| 3*16gaa235 | |||||||||||||||
| gm0045 | 2*16gaa235 | 6 | 60 | 14 | 46 | ||||||||||
| cgg-cac-cca-16gaa2355-gac-tgg | |||||||||||||||
| 3*16atcgca235 | |||||||||||||||
| gm0047 | 3*16gaa235+16gaa23? | 11 | 129 | 20 | 109 | ||||||||||
| 3*16gaa235-gac | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16atcgca235-acc | |||||||||||||||
| 16gaa235-acc | 54 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm055-64 | Notes | |||||||
| gm0055 | 3*16gaa235 | 131 | 17 | 114 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235 | sans | 4 | 10 | 11 | 1 | avant | |||||||||
| 2*16atcgca235-gac | gac-tgg | 1 | 0 | 1 | cgg-cac-cca-16atcgca235-x-tgg | ||||||||||
| 16gaa235-acc | gac | 2 | 6 | 2 | cgg-cac-cca-16atcgca235 | ||||||||||
| 16gaa235-acc-5s | acc-5s | 2 | 1 | ||||||||||||
| 16gaa235-gac | 9 | tgg | différents | ||||||||||||
| 41 | total | 4 | 15 | 0 | 18 | 2 | 0 | 2 | 2*16gaa235-acc | ||||||
| gm0056 | 3*16gaa235 | 111 | 17 | 94 | 16atcgca235-acc | ||||||||||
| 3*16gaa235-gac | 16gaa235-tca | ||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-acc-5s | 5s en trop | ||||||||||||||
| 16atcgca235-acc | 9 | 16atcgca2355-gac-tgg | |||||||||||||
| gm0057 | 3*16gaa235 | 103 | 18 | 85 | |||||||||||
| 2*16gaa235-gac | |||||||||||||||
| 2*16atcgaa235-gac | |||||||||||||||
| 16gaa235-tca | |||||||||||||||
| 16atcgaa235-acc-5s | |||||||||||||||
| 16gaa235-acc | 10 | ||||||||||||||
| gm0058 | 2*16atcgca235 | 52 | 13 | 39 | |||||||||||
| 2*16gaa235 | |||||||||||||||
| cgg-cac-cca-16atcgca235-x-tgg | |||||||||||||||
| 16s23s5s | 6 | ||||||||||||||
| gm0062 | 4*16atcgca235 | 60 | 17 | 43 | |||||||||||
| cgg-cac-cca-16atcgca235 | |||||||||||||||
| 16atcgca2355-gac-tgg | 6 | ||||||||||||||
| gm0063 | 2*16s23s5s | 43 | 2 | 41 | |||||||||||
| 16atcgca235 | 3 | ||||||||||||||
| gm0064 | 16atcgca235 | 2 | 45 | 2 | 43 | ||||||||||
| 16s23s5s | 45 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm065-73 | Notes | |||||||
| gm0065 | 2*16atcgca235 | 2 | 48 | 4 | 44 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| sans | 11 | 8 | 2 | 6 | autres | ||||||||||
| gm0066 | 2*16s23s5s | 104 | 26 | 78 | gac-tgg | 1 | 1 | 16gcc235-gac-tgg | |||||||
| 2*16s23s5s-gac | gac | 4 | 1 | 1 | 2 | 16 atc-gcc 235-gac | |||||||||
| 16s23s5s-acc-5s | acc-5s | 2 | 16-gaa-aaa-gta-235 | ||||||||||||
| 16atcgca235 | tgg | 1 | 16-gaa-aaa-gta-235-gac | ||||||||||||
| 16atcgca235-gac | 40 | total | 17 | 9 | 2 | 2 | 0 | 10 | 0 | 16-gaa-aaa-gta-235-tgg | |||||
| 16gcc235-gac-tgg | 16-gaa-aaa-gca-gta-235 | ||||||||||||||
| 16-gaa-aaa-gta-235 | 4*16-gca-cca-235 | ||||||||||||||
| 16-gaa-aaa-gta-235-gac | |||||||||||||||
| 16-gaa-aaa-gta-235-tgg | incomplets | ||||||||||||||
| 16-gaa-aaa-gca-gta-235 | 12 | 16s-gaa-aaa-gta-5s | |||||||||||||
| gm0067 | 2*16235-gac | 91 | 14 | 77 | à l’envers | ||||||||||
| 16 atc-gcc 235-gac | 2*5s-23s-16s | ||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 16235-acc-5s | |||||||||||||||
| 16s-gaa-aaa-gta-5s | 7 | ||||||||||||||
| gm0068 | 2*16atcgca235 | 2 | 49 | 4 | 45 | ||||||||||
| gm0069 | 3*16atcgca235 | 3 | 54 | 6 | 48 | ||||||||||
| gm0070 | 2*16s23s5s | 68 | 6 | 62 | |||||||||||
| 3*16-gca-cca-235 | 5 | ||||||||||||||
| gm0071 | 16-gca-cca-235 | 5 | 57 | 2 | 55 | ||||||||||
| 4*16s23s5s | |||||||||||||||
| gm0073 | 2*16-gca-atc-235 | 5 | 54 | 4 | 50 | ||||||||||
| 2*5s-23s-16s | |||||||||||||||
| 16s23s5s5s | 41 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm079-129 | Notes | |||||||
| gm0079 | 2*16-gca-atc-235 | 5 | 77 | 10 | 67 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| 16-gca-atc-2355 | sans | 2 | 13 | 3 | 3 | 1 | avant | ||||||||
| 2*5s-23s-cp(atc-gca)-16s | gac-tgg | 2 | 1 | cgg-cac-cca-16atcgca235 | |||||||||||
| gac | 1 | 1 | |||||||||||||
| gm0086 | 6*16atcgca235 | 12 | 70 | 12 | 58 | acc-5s | incomplets | ||||||||
| gm0087 | 6*16atcgca235 | 66 | 12 | 54 | tgg | 1 | 2 | 16gaa23 | |||||||
| 30 | total | 2 | 17 | 3 | 7 | 0 | 0 | 1 | 2*16atcgca23 | ||||||
| gm0090 | 2*16gaa235 | 6 | 58 | 15 | 43 | 2*16s23s | |||||||||
| 16gaa235-gac-5s | |||||||||||||||
| cgg-cac-cca-16atcgca235 | à l’envers | ||||||||||||||
| 16atcgca235-gac-tgg | 2*5s-23s-cp(atc-gca)-16s | ||||||||||||||
| 16atcgca235 | |||||||||||||||
| autres incomplets | |||||||||||||||
| gm0094 | 16gaa23+5s | 1 | 38 | 1 | 37 | gaa-23s5s-gac | |||||||||
| gm0098 | 16atcgca23+gaa-5s | 1 | 32 | 3 | 29 | 5s en trop | |||||||||
| 16-gca-atc-2355 | |||||||||||||||
| gm0114 | 16gaa235 | 2 | 40 | 4 | 36 | 16gaa235-gac-5s | |||||||||
| 16gaa235-gac-tgg | 2*5s | ||||||||||||||
| gaa-5s | |||||||||||||||
| gm0115 | 16atcgca23+5s | 1 | 41 | 2 | 39 | atc-5s-aaa | |||||||||
| gm0119 | 16s23s | 1 | 27 | 0 | 27 | ||||||||||
| gm0126 | 16s23s + atc-5s-aaa | 1 | 33 | 2 | 31 | ||||||||||
| gm0127 | 2*16gaa235-tgg | 3 | 45 | 7 | 38 | ||||||||||
| 16atcgca235-tgg | |||||||||||||||
| gm0128 | 2*16s23s5s | 3 | 37 | 4 | 33 | ||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| gm0129 | 16atcgca235-gac | 1 | 42 | 5 | 37 | ||||||||||
| gaa-23s5s-gac | 37 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm131-150 | Notes | |||||||
| gm0131 | 16gaa235 | 40 | 3 | 37 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16s23s5s | sans | 2 | 16 | 9 | 1 | autres | |||||||||
| 16gaa23-tgg | 3 | gac-tgg | 1 | 3 | 16-atc-235 | ||||||||||
| gac | 3 | ||||||||||||||
| gm0137 | 16-atc-235 | 1 | 33 | 1 | 32 | acc-5s | 2 | 1 | incomplets | ||||||
| tgg | 16gaa23-tgg | ||||||||||||||
| gm0140 | 16atcgca235 | 2 | 33 | 3 | 30 | 38 | total | 2 | 19 | 0 | 16 | 0 | 1 | 0 | 16atcgca |
| 16gaa235 | 2*16s | ||||||||||||||
| gm0141 | 16atcgca235 | 1 | 37 | 2 | 35 | ||||||||||
| gm0142 | 16atcgca235+16atcgca | 5 | 57 | 7 | 50 | ||||||||||
| 16gaa235-gac-tgg+2*16s | |||||||||||||||
| gm0143 | 2*16atcgca235 | 83 | 14 | 69 | |||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 2*16gaa235 | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235-gac | 7 | ||||||||||||||
| gm0147 | 3*16atcgca235 | 3 | 49 | 6 | 43 | ||||||||||
| gm0148 | 5*16atcgca235 | 5 | 70 | 10 | 60 | ||||||||||
| gm0149 | 3*16gaa235 | 84 | 14 | 70 | |||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16s23s5s | |||||||||||||||
| 16gaa235-gac | 8 | ||||||||||||||
| gm0150 | 2*16gaa235 | 84 | 13 | 71 | |||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 2*16atcgca235 | 7 | ||||||||||||||
| 16gaa235-acc-5s | 42 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm151-169 | Notes | |||||||
| gm0151 | 2*16gaa235 | 87 | 14 | 73 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16gaa235-gac | sans | 13 | 5 | 9 | autres | ||||||||||
| 2*16atcgca235 | gac-tgg | 2 | 1 | 7*16-gca-cds-235 | |||||||||||
| 16gaa235-gac-tgg | gac | 1 | 2 | 16-atc-235 | |||||||||||
| 16atcgca235-acc-5s | 7 | acc-5s | 2 | 1 | 16-atc-235 | ||||||||||
| tgg | |||||||||||||||
| gm0152 | 7*16-gca-cds-235 | 89 | 10 | 79 | 36 | total | 0 | 18 | 0 | 9 | 0 | 9 | 0 | différents | |
| 16-atc-2355-tac | 16-atc-2355-tac | ||||||||||||||
| 16-atc-235 | 9 | ||||||||||||||
| incomplets | |||||||||||||||
| gm0155 | 16atcgca235 | 44 | 2 | 42 | 16atcgca23 | ||||||||||
| gm0158 | 16atcgca23+5s | 43 | 2 | 41 | |||||||||||
| gm0161 | 16atcgca235 | 3 | 39 | 2 | 37 | cds | |||||||||
| 7*16-gca-cds-235 | |||||||||||||||
| gm0162 | 2*16gaa235 | 85 | 14 | 71 | |||||||||||
| 16gaa235-gac | 5s en trop | ||||||||||||||
| 16gaa235-acc-5s | 5s | ||||||||||||||
| 16atcgca235-gac-tgg | 16-atc-2355-tac | ||||||||||||||
| 2*16atcgca235 | 7 | ||||||||||||||
| gm0166 | 2*16atcgca235 | 86 | 16 | 70 | |||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16-atc-235 | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235 | 7 | ||||||||||||||
| gm0167 | 16atcgca235 | 1 | 36 | 2 | 34 | ||||||||||
| gm0168 | 16atcgca235 | 1 | 36 | 2 | 34 | ||||||||||
| gm0169 | 3*16atcgca235 | 3 | 47 | 6 | 41 | ||||||||||
| 38 | |||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm170-182 | Notes | |||||||
| gm0170 | 3*16gaa235 | 76 | 13 | 63 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235 | sans | 8 | 18 | différents | |||||||||||
| 16gaa235-gac | gac-tgg | 3 | 2 | 2*16gaa235-gac-gac | |||||||||||
| 16atcgca235-gac-tgg | gac | 3 | |||||||||||||
| 16gaa235-acc-5s | 7 | acc-5s | 3 | 2 | |||||||||||
| tgg | |||||||||||||||
| gm0173 | 3*16gaa235 | 91 | 14 | 77 | 39 | total | 0 | 14 | 0 | 25 | 0 | 0 | 0 | ||
| 16atcgca235 | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235-gac-tgg | 7 | ||||||||||||||
| gm0175 | 2*16atcgca235 | 2 | 53 | 4 | 49 | ||||||||||
| gm0177 | 3*16gaa235 | 95 | 15 | 80 | |||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16atcgca235-acc-5s | 8 | ||||||||||||||
| gm0178 | 5*16gaa235 | 96 | 15 | 81 | |||||||||||
| 16gaa235-gac-gac | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235-acc-5s | 8 | ||||||||||||||
| gm0180 | 4*16gaa235 | 96 | 14 | 82 | |||||||||||
| 16gaa235-gac-gac | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235-acc-5s | 8 | ||||||||||||||
| 1 | |||||||||||||||
| gm0182 | 16atcgca235 | 41 | 43 | 2 | 41 | ||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm183-202 | Notes | |||||||
| gm0183 | 4*16gaa235 | 90 | 15 | 75 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235-gac | sans | 3 | 6 | 14 | différents | ||||||||||
| 16atcgca235 | gac-tgg | 5 | 16s23s5s-acc-5s-acc-5s | ||||||||||||
| 16atcgca235-gac-tgg | gac | 5 | 16gaa235-ttc | ||||||||||||
| 16s23s5s-acc-5s-acc-5s | 8 | acc-5s | 4 | ||||||||||||
| tgg | 5s en trop | ||||||||||||||
| gm0185 | 2*16gaa235 | 85 | 15 | 70 | 37 | total | 3 | 16 | 0 | 18 | 0 | 0 | 0 | 16s23s5s-acc-5s-acc-5s | |
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-ttc | |||||||||||||||
| 16s23s5s | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16gaa235-acc-5s | 8 | ||||||||||||||
| gm0190 | 3*16gaa235 | 90 | 14 | 76 | |||||||||||
| 16s23s5s | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | 8 | ||||||||||||||
| gm0198 | 2*16atcgca235 | 89 | 15 | 74 | |||||||||||
| 16atcgca235-gac | |||||||||||||||
| 2*16gaa235 | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16s23s5s | 8 | ||||||||||||||
| gm0202 | 3*16gaa235 | 83 | 14 | 69 | |||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16atcgca235 | 7 | ||||||||||||||
| 16atcgca235-gac-tgg | 39 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm203-211 | Notes | |||||||
| gm0203 | 3*16gaa235 | 87 | 14 | 73 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235-gac | sans | 2 | 6 | 15 | différents | ||||||||||
| 16gaa235-acc-5s | gac-tgg | 4 | 1 | 16gaa235-ttc | |||||||||||
| 16atcgca235 | gac | 4 | 1 | ||||||||||||
| 16atcgca235-gac-tgg | 7 | acc-5s | 1 | 3 | incomplets | ||||||||||
| tgg | 16s-atc-gca-tgg | ||||||||||||||
| gm0204 | 3*16gaa235 | 89 | 18 | 71 | 37 | total | 2 | 15 | 0 | 20 | 0 | 0 | 0 | 16s-23s°-5s-gac | |
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16s-atc-gca-tgg | |||||||||||||||
| 16s23s5s | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 16s-23s°-5s-gac | 10 | ||||||||||||||
| gm0205 | 4*16gaa235 | 88 | 15 | 73 | |||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-ttc | |||||||||||||||
| 16s23s5s | |||||||||||||||
| 16atcgca235-gac-tgg | 9 | ||||||||||||||
| gm0206 | 3*16atcgca235 | 79 | 15 | 64 | |||||||||||
| 16gaa235 | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-acc-5s | 7 | ||||||||||||||
| gm0211 | 4*16gaa235 | 78 | 13 | 65 | |||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235-gac | 7 | ||||||||||||||
| 16atcgca235 | 40 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm212-319 | Notes | |||||||
| gm0212 | 2*16atcgca235 | 76 | 14 | 62 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16gaa235-gac-tgg | sans | 9 | 16 | ||||||||||||
| 2*16gaa235 | gac-tgg | 2 | 4 | ||||||||||||
| 16atcgca235-acc-5s | 7 | gac | 4 | 1 | |||||||||||
| 16gaa235-gac | acc-5s | 4 | 2 | ||||||||||||
| tgg | |||||||||||||||
| gm0214 | 3*16gaa235 | 78 | 14 | 64 | 42 | total | 0 | 19 | 0 | 23 | 0 | 0 | 0 | ||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16atcgca235-gac | 7 | ||||||||||||||
| gm0215 | 16atcgca235 | 82 | 15 | 67 | |||||||||||
| 3*16gaa235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235-gac | 7 | ||||||||||||||
| gm0216 | 2*16gaa235 | 89 | 14 | 75 | |||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235-acc-5s | 7 | ||||||||||||||
| gm0309 | 3*16gaa235 | 86 | 13 | 73 | |||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16gaa235-gac-tgg | 7 | ||||||||||||||
| gm0319 | 3*16gaa235 | 89 | 14 | 75 | |||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235 | 7 | ||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 42 | |||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm320-361 | Notes | |||||||
| gm0320 | 16s23s5s-5s | 122 | 11 | 111 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235 | sans | 1 | 27 | 5 | 1 | 4 | avant | ||||||||
| 16s23s5s-gac | gac-tgg | 2 | 3*agc-gta-16atcgca235 | ||||||||||||
| 16atcgca235-acc | gac | 1 | 1 | cgg-cac-cca-16gaa235 | |||||||||||
| 16s23s5s-tgg | acc-5s | ||||||||||||||
| 16atcgca235-gac | tgg | 1 | autres | ||||||||||||
| 16s23s5s-acc | 7 | 43 | total | 3 | 28 | 0 | 7 | 0 | 1 | 4 | 16atcgca-cds-2355 | ||||
| gm0321 | 3*16atcgca235+5s | 39 | 6 | 33 | différents | ||||||||||
| gm0322 | 3*16atcgca235+5s | 39 | 6 | 33 | 16atcgca235-acc | ||||||||||
| gm0323 | 3*16atcgca235+5s | 9 | 39 | 6 | 33 | 16s23s5s-acc | |||||||||
| gm0324 | 2*16atcgca235+5s | 40 | 8 | 32 | |||||||||||
| agc-gta-16atcgca235 | 3 | ||||||||||||||
| gm0326 | 2*16atcgca235+5s | 41 | 8 | 33 | cds | ||||||||||
| agc-gta-16atcgca235 | 3 | 16atcgca-cds-2355 | |||||||||||||
| gm0333 | 3*16atcgca235+5s | 3 | 39 | 6 | 33 | 5s en trop | |||||||||
| 16gaa2355-gac-tgg | |||||||||||||||
| gm0334 | 2*16atcgca235+5s | 40 | 8 | 32 | 16atcgca-cds-2355 | ||||||||||
| agc-gta-16atcgca235 | 3 | 16s23s5s-5s | |||||||||||||
| 8*5s | |||||||||||||||
| gm0335 | 3*16atcgca235+5s | 3 | 39 | 6 | 33 | ||||||||||
| gm0359 | 4*16atcgca235 | 4 | 76 | 8 | 68 | ||||||||||
| gm0360 | 16atcgca235 | 54 | 8 | 46 | |||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16gaa235 | |||||||||||||||
| 16atcgca-cds-2355 | 4 | ||||||||||||||
| gm0361 | 4*16gaa235 | 59 | 11 | 48 | |||||||||||
| 16gaa235-5s-gac-tgg | 6 | ||||||||||||||
| cgg-cac-cca-16gaa235 | 45 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm363-392 | Notes | |||||||
| gm0363 | 3*16atcgca235 | 53 | 9 | 44 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16gaa235-gac-tgg | 4 | sans | 8 | 30 | 2 | 10 | 1 | 1 | avant | ||||||
| gac-tgg | 2 | 2 | 1 | cgg-cac-cca-16-gaa-cds-235 | |||||||||||
| gm0364 | 4*16atcgca235 | 4 | 55 | 8 | 47 | gac | 1 | ||||||||
| gm0365 | 6*16atcgca235 | 6 | 60 | 12 | 48 | acc-5s | 1 | autres | |||||||
| tgg | 16-gaa-cds-23555-gac-tgg | ||||||||||||||
| gm0366 | 3*16atcgca235 | 5 | 62 | 10 | 52 | 59 | total | 8 | 32 | 2 | 14 | 0 | 2 | 1 | 16-gaa-cds-235 |
| 2*16-gca-atc-235 | |||||||||||||||
| gm0367 | 4*16s23s5s | 4 | 50 | 0 | 50 | différents | |||||||||
| 16gaa23-cds-5s-5s | |||||||||||||||
| gm0368 | 2*16atcgca235 | 6 | 50 | 11 | 39 | ||||||||||
| 16atcgca235-5s-gac-tgg | cds | ||||||||||||||
| 3*16gaa235 | cgg-cac-cca-16-gaa-cds-235 | ||||||||||||||
| 16-gaa-cds-23555-gac-tgg | |||||||||||||||
| gm0369 | 3*16atcgca235 | 6 | 59 | 14 | 45 | 16-gaa-cds-235 | |||||||||
| cgg-cac-cca-16-gaa-cds-235 | 16gaa23-cds-5s-5s | ||||||||||||||
| 16-gaa-cds-23555-gac-tgg | |||||||||||||||
| 16-gaa-cds-235 | 5s en trop | ||||||||||||||
| 16atcgca2355-gac-tgg | |||||||||||||||
| gm0386 | 4*16gaa235 | 6 | 57 | 8 | 49 | 16gaa2355-gac-tgg | |||||||||
| 16gaa23-cds-5s-5s | 16-gaa-cds-23555-gac-tgg | ||||||||||||||
| 16gaa235-5s-gac-tgg | 16gaa23-cds-5s-5s | ||||||||||||||
| gm0390 | 3*16gaa235 | 8 | 94 | 15 | 79 | ||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16gaa235-gac | |||||||||||||||
| gm0391 | 5*16atcgca235 | 5 | 69 | 10 | 59 | ||||||||||
| gm0392 | 4*16s23s5s | 6 | 61 | 4 | 57 | ||||||||||
| 2*16atcgca235 | 60 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm393-409 | Notes | |||||||
| gm0393 | 4*16atcgca235 | 4 | 71 | 8 | 63 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| sans | 6 | 19 | 8 | 1 | avant | ||||||||||
| gm0394 | 4*16s23s5s | 6 | 65 | 4 | 61 | gac-tgg | 1 | 1 | aaa-16atcgca235 | ||||||
| 2*16atcgca235 | gac | 2 | 2 | ||||||||||||
| acc-5s | 1 | 1 | 1 | incomplets | |||||||||||
| gm0396 | 16atcgca235 | 2 | 48 | 2 | 46 | tgg | 16s | ||||||||
| 16235 | 43 | total | 7 | 23 | 0 | 12 | 0 | 0 | 1 | ||||||
| autres incomplets | |||||||||||||||
| gm0397 | 16atcgca235 | 2 | 45 | 5 | 40 | 23s5s | |||||||||
| aaa-16atcgca235 | atc-gca-235-gac-tgg | ||||||||||||||
| gm0398 | 4*16atcgca235 | 4 | 57 | 8 | 49 | ||||||||||
| gm0400 | 2*16atcgca235 | 2 | 42 | 4 | 38 | ||||||||||
| gm0401 | 2*16atcgca235 | 7 | 85 | 15 | 70 | ||||||||||
| 16gaa235 + 23s5s | |||||||||||||||
| 2*16gaa235-gac | |||||||||||||||
| 16gaa235-gac-tgg | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| gm0402 | 3*16gaa235 | 8 | 87 | 14 | 73 | ||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| 16s23s5s | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| gm0409 | 4*16gaa235 + 16s | 9 | 92 | 16 | 76 | ||||||||||
| 16s235-acc-5s | |||||||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| atc-gca-235-gac-tgg | 44 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm413-487 | Notes | |||||||
| gm0413 | 4*16gaa235 | 8 | 87 | 14 | 73 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| 16s235-acc-5s | sans | 4 | 16 | 14 | 2 | avant | |||||||||
| 16atcgca235-gac-tgg | gac-tgg | 3 | 1 | ttc-16atcgca235 | |||||||||||
| 16atcgca235 | gac | 3 | 1 | cgg-cac-cca-16atcgca235 | |||||||||||
| 16atcgca235-gac | acc-5s | 2 | 1 | ||||||||||||
| tgg | 5s en trop | ||||||||||||||
| gm0420 | 4*16gaa235 + 5s | 7 | 70 | 12 | 58 | 47 | total | 6 | 22 | 0 | 17 | 0 | 0 | 2 | 16atcgca235-5s-gac |
| 16atcgca235-gac-tgg | 5s | ||||||||||||||
| 16gaa235-gac | |||||||||||||||
| 16gaa235-acc-5s | |||||||||||||||
| gm0441 | 4*16gaa235 | 8 | 86 | 14 | 72 | ||||||||||
| 16s235-acc-5s | |||||||||||||||
| 16atcgca235-gac | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| gm0470 | 2*16-gaa-235 | 6 | 66 | 15 | 51 | ||||||||||
| 16atcgca235 | |||||||||||||||
| cgg-cac-cca-16atcgca235 | |||||||||||||||
| 16-gaa-235-gac-tgg | |||||||||||||||
| 16atcgca235-5s-gac | |||||||||||||||
| gm0476 | 3*16atcgca235 | 3 | 57 | 6 | 51 | ||||||||||
| gm0478 | 3*16atcgca235 | 3 | 52 | 6 | 46 | ||||||||||
| gm0483 | 4*16s23s5s | 7 | 81 | 6 | 75 | ||||||||||
| 3*16atcgca235 | |||||||||||||||
| gm0486 | 2*16atcgca235 | 2 | 47 | 4 | 43 | ||||||||||
| gm0487 | 2*16atcgca235 | 3 | 47 | 7 | 40 | ||||||||||
| ttc-16atcgca235 | 47 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm488-538 | Notes | |||||||
| gm0488 | 2*16atcgca235 | 3 | 47 | 7 | 40 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| 16atcgca235-tta | sans | 7 | 20 | 2 | 2 | avant | |||||||||
| gac-tgg | 1 | 1 | 1 | 1 | aaa-16atcgca235 | ||||||||||
| gm0489 | 2*16atcgca235 | 3 | 44 | 7 | 37 | gac | 1 | 5 | 2 | 2 | ttg-16-gaa-aaa-gta-235-gac-tgg | ||||
| aaa-16atcgca235 | acc-5s | 1 | 0 | atgj-16atcgca235 | |||||||||||
| tgg | |||||||||||||||
| gm0491 | 3*16atcgca235 | 4 | 50 | 9 | 41 | 46 | total | 10 | 26 | 0 | 5 | 0 | 2 | 3 | autres |
| atgj-16atcgca235 | 2*16-gaa-aaa-gta-235-gac | ||||||||||||||
| gm0494 | 2*16-gaa-235 + 16atcgca-23s°-5s-gac | 82 | 14 | 68 | |||||||||||
| 2*16atcgca235 | 7 | incomplets | |||||||||||||
| 16-gaa-235-gac-tgg | 16atcgca-23s°-5s-gac | ||||||||||||||
| 16-gaa-23-acc-5s | |||||||||||||||
| différents | |||||||||||||||
| gm0495 | 3*16atcgca235 | 11 | 132 | 25 | 107 | 16atcgca235-tta | |||||||||
| 5*16atcgca235-gac | 16atcgca235-tgg-tgg | ||||||||||||||
| 2*16atcgca235-5s | 16-gaa-23-acc-5s | ||||||||||||||
| 16atcgca235-tgg-tgg | |||||||||||||||
| 5s en trop | |||||||||||||||
| gm0526 | 2*16-gaa-235-gac | 9 | 137 | 25 | 112 | 2*16atcgca235-5s | |||||||||
| 2*16-gaa-aaa-gta-235-gac | 16s23s5s-5s-gac-tgg | ||||||||||||||
| ttg-16-gaa-aaa-gta-235-gac-tgg | 16s23s5s-5s | ||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16s23s5s-acc-5s | |||||||||||||||
| 16s23s5s-gac | |||||||||||||||
| 16s23s5s-5s-gac-tgg | |||||||||||||||
| gm0535 | 6*16s23s5s | 9 | 108 | 4 | 104 | ||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16s23s5s-5s | |||||||||||||||
| gm0538 | 4*16atcgca235 | 4 | 66 | 8 | 58 | ||||||||||
| 50 | |||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm666-1048 | Notes | |||||||
| gm0666 | 3*16-gaa-235 | 83 | 14 | 69 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||
| 16atcgca235-gac | sans | 8 | 5 | 2 | 8 | 1 | autres | ||||||||
| 16atcgca235 | gac-tgg | 1 | 3 | 2 | 16-gcc-gaa-235-gac-tgg | ||||||||||
| 16-gaa-235-gac-tgg | gac | 2 | 3 | 1 | 1 | 16-gaa-aaa-gca-gta-235-gac-tgg | |||||||||
| 16atcgca235-acc-5s | 7 | acc-5s | 1 | 2 | 1 | 16-gaa-aaa-gta-cds-235 | |||||||||
| tgg | 16-gaa-aaa-gta-cds-235-gac | ||||||||||||||
| gm0942 | 2*16-gaa-235 | 87 | 15 | 72 | 41 | total | 11 | 11 | 2 | 13 | 0 | 4 | 0 | ||
| 16-gaa-235-gac | 7 | ||||||||||||||
| 16atcgca235 | différents | ||||||||||||||
| 16-gaa-235-acc-5s | 16atcgca-235-acc-5s-gac | ||||||||||||||
| 16atcgca235-gac-tgg | 16atcgca-235-tca | ||||||||||||||
| 16atcgca-23s° | 16-gaa-aaa-gta-cds-235-tca | ||||||||||||||
| 16s°-gaa-235 | |||||||||||||||
| incomplets | |||||||||||||||
| gm0973 | 6*16s23s5s | 11 | 149 | 9 | 140 | 16atcgca-23s° | |||||||||
| 16atcgca235-gac | |||||||||||||||
| 16s23s5s-acc-5s | autres incomplets | ||||||||||||||
| 2*16atcgca235 | 16s°-gaa-235 | ||||||||||||||
| 16s23s5s-gac | |||||||||||||||
| cds | |||||||||||||||
| gm0984 | 3*16-gaa-235 | 7 | 103 | 14 | 89 | 16-gaa-aaa-gta-cds-235 | |||||||||
| 16atcgca235-gac | 16-gaa-aaa-gta-cds-235-gac | ||||||||||||||
| 16atcgca235-acc-5s | 16-gaa-aaa-gta-cds-235-tca | ||||||||||||||
| 16-gaa-235-gac-tgg | |||||||||||||||
| 16atcgca235 | 5s en trop | ||||||||||||||
| 16-gca-atc-235-5s | |||||||||||||||
| gm1003 | 16-gca-atc-235 | 2 | 71 | 4 | 67 | 16atcgca-235-acc-5s-gac | |||||||||
| 16-gca-atc-235-5s | |||||||||||||||
| gm1048 | 16-gcc-gaa-235-gac-tgg | 126 | 32 | 94 | |||||||||||
| 16atcgca-235-acc-5s-gac | |||||||||||||||
| 16-gaa-235-gac-tgg | |||||||||||||||
| 16-gaa-aaa-gca-gta-235-gac-tgg | |||||||||||||||
| 2*16s23s5s | |||||||||||||||
| 16s23s5s-gac | |||||||||||||||
| 16atcgca-235-tca | 11 | ||||||||||||||
| 16-gaa-aaa-gta-cds-235 | |||||||||||||||
| 16-gaa-aaa-gta-cds-235-gac | |||||||||||||||
| 16-gaa-aaa-gta-cds-235-tca | 45 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Gm1066-1149 | Notes | |||||||
| gm1066 | 2*16-gca-atc-235 | 2 | 55 | 4 | 51 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | |||
| sans | 5 | 5 | 11 | 1 | avant | ||||||||||
| gm1072 | 2*16-gca-atc-235 | 2 | 55 | 4 | 51 | gac-tgg | 2 | 2 | cgg-16-gca-atc-235 | ||||||
| gac | 1 | 3 | |||||||||||||
| gm1100 | 3*16-gaa-235 | 7 | 82 | 13 | 69 | acc-5s | 2 | 2 | |||||||
| 16-gaa-235-gac | tgg | ||||||||||||||
| 16atcgca235 | 34 | total | 0 | 10 | 5 | 18 | 0 | 0 | 1 | ||||||
| 16-gaa-235-gac-tgg | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| gm1106 | 16-gca-atc-235 | 2 | 53 | 5 | 48 | ||||||||||
| cgg-16-gca-atc-235 | |||||||||||||||
| gm1115 | 3*16-gaa-235 | 7 | 85 | 14 | 71 | ||||||||||
| 16-gaa-235-gac | |||||||||||||||
| 16atcgca235-acc-5s | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| gm1128 | 3*16-gaa-235 | 7 | 73 | 12 | 61 | ||||||||||
| 16-gaa-235-acc-5s | |||||||||||||||
| 16-gaa-235-gac-tgg | |||||||||||||||
| 16-gaa-235-gac | |||||||||||||||
| 16atcgca235 | |||||||||||||||
| gm1149 | 2*16-gaa-235 | 7 | 82 | 15 | 67 | ||||||||||
| 2*16atcgca235 | |||||||||||||||
| 16atcgca235-gac-tgg | |||||||||||||||
| 16-gaa-235-acc-5s | |||||||||||||||
| 16atcgca235-gac | 34 | ||||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Total | ||||||||
| 144 | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | ||||||||
| sans | 58 | 238 | 14 | 160 | 1 | 19 | 17 | ||||||||
| Total | 9736 | 1401 | 8335 | gac-tgg | 1 | 31 | 0 | 25 | 0 | 4 | 5 | ||||
| Moyenne | 68 | 10 | 58 | gac | 8 | 34 | 0 | 31 | 2 | 5 | 0 | ||||
| ecartype | 25 | 6 | 20 | acc-5s | 7 | 19 | 0 | 20 | 0 | 0 | 0 | ||||
| max | 149 | 32 | 140 | tgg | 1 | 1 | 0 | 2 | 0 | 1 | 0 | ||||
| min | 27 | 0 | 27 | 704 | total | 75 | 323 | 14 | 238 | 3 | 29 | 22 |
gamma notes[modifier | modifier le wikicode]
- Lien tableur: gamma notes
- Légende:
- - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 23s°: 23S ribosomal RNA rRNA prediction is too short
- - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 16s°: 16S ribosomal RNA rRNA prediction is too short
| avant | autres | 5s en trop |
| 3*agc-gta-16atcgca235 | 3*16-atc-235 | 2*16s23s5s-5s |
| 3*atgf-16atcgca235 | 16gcc235-gac-tgg | 16s23s5s-5s-gac-tgg |
| 4*cgg-cac-cca-16atcgca235 | 16 atc-gcc 235-gac | 16s23s5s-acc-5s-acc-5s |
| cgg-cac-cca-16atcgca2355-gac-tgg | 16-gcc-gaa-235-gac-tgg | |
| cgg-cac-cca-16atcgca235-x-tgg | 4*16-gca-cca-235 | 2*16atcgca235-5s |
| 2*aaa-16atcgca235 | 16atcgca235-5s-gac | |
| ttc-16atcgca235 | 16-gaa-aaa-gta-235 | 3*16atcgca2355-gac-tgg |
| atgj-16atcgca235 | 3*16-gaa-aaa-gta-235-gac | 16atcgca-235-acc-5s-gac |
| 16-gaa-aaa-gta-235-tgg | cgg-cac-cca-16atcgca2355-gac-tgg | |
| 2*cgg-cac-cca-16gaa2355-gac-tgg | 16atcgca-cds-2355 | |
| cgg-cac-cca-16gaa235 | 16-gaa-aaa-gca-gta-235 | |
| 16-gaa-aaa-gca-gta-235-gac-tgg | 2*cgg-cac-cca-16gaa2355-gac-tgg | |
| cgg-16-gca-atc-235 | 16gaa23-cds-5s-5s | |
| 16atcgca-cds-2355 | 16gaa235-gac-5s | |
| cgg-cac-cca-16-gaa-cds-235 | 16-gaa-cds-23555-gac-tgg | 2*16gaa2355-gac-tgg |
| ttg-16-gaa-aaa-gta-235-gac-tgg | 16-gaa-cds-235 | 16-gaa-cds-23555-gac-tgg |
| 7*16-gca-cds-235 | ||
| différents | 16-gaa-aaa-gta-cds-235 | 16-atc-2355-tac |
| 16s23s5s-acc | 16-gaa-aaa-gta-cds-235-gac | 2*16-gca-atc-2355 |
| 16s23s5s-acc-5s-acc-5s | ||
| incomplets | gaa-5s | |
| 16gaa235-tca | 3*16atcgca23 | atc-5s-aaa |
| 3*16gaa235-acc | 2*16s23s | 13*5s |
| 2*16gaa235-ttc | 2*16gaa23 | |
| 16gaa23-cds-5s-5s | 16gaa23-tgg | cds |
| 2*16gaa235-gac-gac | 16gaa23-cds-5s-5s | |
| 16-gaa-23-acc-5s | 16s-gaa-aaa-gta-5s | |
| 16atcgca-23s°-5s-gac | 16atcgca-cds-2355 | |
| 3*16atcgca235-acc | 16s-23s°-5s-gac | 16-gaa-cds-23555-gac-tgg |
| 16atcgca-235-tca | 16-gaa-cds-235 | |
| 16atcgca235-tta | 16s-atc-gca-tgg | 7*16-gca-cds-235 |
| 16atcgca235-tgg-tgg | 16atcgca-23s° | 16-gaa-aaa-gta-cds-235 |
| 16atcgca-235-acc-5s-gac | 16atcgca | 16-gaa-aaa-gta-cds-235-gac |
| 3*16s | cgg-cac-cca-16-gaa-cds-235 | |
| 16-atc-2355-tac | 16-gaa-aaa-gta-cds-235-tca | |
| 16-gaa-aaa-gta-cds-235-tca | autres incomplets | |
| 23s5s | à l’envers | |
| 16s°-gaa-235 | 2*5s-23s-16s | |
| gaa-23s5s-gac | 2*5s-23s-cp(atc-gca)-16s | |
| atc-gca-235-gac-tgg |
gamma cds notes[modifier | modifier le wikicode]
- Lien tableur: cds notes
23.7.20 Tanger cds contrôles date NCBI gamma gm0152 Colwellia psychrerythraea 34H 25/08/19 7 cds sens adresse gène intercal aas cds 42409..43659 cds 668 417 DEAD/DEAH box helicase 44328..45874 16s 94 45969..46044 gca 95 46140..46343 cds 130 68 hp (voir tableur) 46474..49391 23s 152 49544..49658 5s 511 50170..51718 16s 94 51813..51888 gca 38 <> 51927..52118 cds 199 64 P-hp 52318..55235 23s 152 55388..55502 5s 886 56389..56775 cds 129 ATP synthase subunit I comp 349644..350126 cds 798 161 RNA-binding protein 350925..352471 16s 94 352566..352641 gca 95 352737..352940 cds 130 68 hp1 (voir tableur) 353071..355988 23s 152 356141..356255 5s 518 356774..358322 16s 94 358417..358492 gca 95 358588..358791 cds 130 68 hp2 (voir tableur) 358922..361839 23s 152 361992..362106 5s 1173 comp 363280..364287 cds 336 tRNA dihydrouridine(20/20a) synthase DusA 552484..553779 cds 855 432 phosphoribosylamine--glycine ligase 554635..556181 16s 94 556276..556351 gca 95 556447..556650 cds 130 68 hp1 (voir tableur) 556781..559698 23s 152 559851..559965 5s 511 560477..562025 16s 94 562120..562195 gca 92 562288..562491 cds 130 68 hp2 (voir tableur) 562622..565539 23s 144 565684..565798 5s 731 comp 566530..568614 cds 695 YjbH domain-containing protein comp 4071788..4073749 cds 983 654 molecular chaperone HtpG comp 4074733..4074847 5s 150 comp 4074998..4077915 23s 130 comp 4078046..4078249 cds 112 68 hp (voir tableur) comp 4078362..4078437 gca 94 comp 4078532..4080078 16s 999 4081078..4084206 cds 1043 S8 family serine peptidase gamma gm0360 Frischella perrara strain PEB0191 08/06/20 1 cds 129653..130189 cds 517 179 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase 130707..132243 16s 57 132301..132377 atc 90 132468..132543 gca 313 132857..134053 cds 433 399 histidinol-phosphate aminotransferase family protein (voir tableur) 134487..137401 23s 60 137462..137577 5s 224 137802..137917 5s 169 138087..138686 cds 200 RNA pyrophosphohydrolase gamma gm0386 21/12/19 1 cds 1509917..1513153 cds 373 1079 Ig-like domain-containing protein 1513527..1515080 16s 132 1515213..1515288 gaa 207 1515496..1518536 23s 129 comp 1518666..1519652 cds 264 329 IS110 family transposase (voir tableur) 1519917..1520032 5s 51 1520084..1520199 5s 211 1520411..1522102 cds 564 D-lactate dehydrogenase gamma gm0369 Haemophilus influenzae 10810 02/06/20 3 cds perdus gamma gm1048 Vibrio parahaemolyticus BB22OP 10/02/20 3 cds perdus
gamma typage[modifier | modifier le wikicode]
gamma type 16235-z après 5s[modifier | modifier le wikicode]
- Lien tableur: gamma type 16235-z après 5s
- Légende:
| Blocs | sans | gac-tgg | gac | acc- 5s | tgg | total |
|---|---|---|---|---|---|---|
| 16s23s5s | 58 | 1 | 8 | 7 | 1 | 75 |
| atcgca | 238 | 31 | 34 | 19 | 1 | 323 |
| gcaatc | 14 | 0 | 0 | 0 | 0 | 14 |
| gaa | 160 | 25 | 31 | 20 | 2 | 238 |
| atcgaa | 1 | 0 | 2 | 0 | 3 | |
| autres | 19 | 4 | 5 | 0 | 1 | 29 |
| av16s | 17 | 5 | 0 | 0 | 0 | 22 |
| total | 507 | 66 | 80 | 46 | 5 | 704 |
| 16s23s5s-z | ||||||
| Type | total | % | tRNA | total | % | |
| blocs | sans | 507 | 599 | |||
| sans | 507 | 699 | gac | 151 | 178 | |
| gac-tgg | 66 | 91 | tgg | 73 | 86 | |
| gac | 80 | 110 | acc | 57 | 67 | |
| acc- 5s | 46 | 63 | 5s | 50 | 59 | |
| tgg | 5 | 7 | tca | 3 | 4 | |
| différents | ttc | 2 | 2 | |||
| acc | 7 | 10 | tta | 1 | 1 | |
| acc-5s-acc-5s | 1 | 1 | tac | 1 | 1 | |
| acc-5s-gac | 1 | 1 | cds | 1 | 1 | |
| 23-acc-5s | 1 | 1 | 846 | 1000 | ||
| 23-cds-5s-5s | 1 | 1 | ||||
| tca | 3 | 4 | ||||
| ttc | 2 | 3 | ||||
| gac-gac | 2 | 3 | ||||
| tta | 1 | 1 | ||||
| tgg-tgg | 1 | 1 | ||||
| tac | 1 | 1 | ||||
| 725 | 1000 |
gamma type 16-y-235 après 16s[modifier | modifier le wikicode]
- Lien tableur: gamma type 16-y-235 après 16s
- Légende:
| 16s-y-23s5s | blocs | autres | avant 16s | incomplets | différents | total |
|---|---|---|---|---|---|---|
| 16s23s5s | 75 | 2 | 2 | 79 | ||
| atc-gca | 323 | 16 | 3 | 7 | 349 | |
| gca-atc | 14 | 1 | 15 | |||
| atc | 3 | 1 | 4 | |||
| gaa | 238 | 3 | 3 | 10 | 254 | |
| atc-gaa | 3 | 3 | ||||
| gcc | 1 | 1 | ||||
| atc-gcc | 1 | 1 | ||||
| gcc-gaa | 1 | 1 | ||||
| gca-cca | 4 | 4 | ||||
| gaa-aaa-gta | 5 | 1 | 6 | |||
| gaa-aaa-gca-gta | 2 | 2 | ||||
| atc-gca-cds | 1 | 1 | ||||
| gaa-cds | 2 | 1 | 3 | |||
| gca-cds | 7 | 7 | ||||
| gaa-aaa-gta-cds | 2 | 1 | 3 | |||
| 653 | 29 | 22 | 8 | 21 | 733 | |
| Type | total | % | tRNA | total | % | |
| atc-gca | 349 | 476 | gca | 378 | 330 | |
| gaa | 254 | 347 | atc | 373 | 326 | |
| 16s23s5s | 79 | 108 | gaa | 272 | 238 | |
| gca-atc | 15 | 20 | 16s | 79 | 69 | |
| gca-cds | 7 | 10 | cds | 14 | 12 | |
| gaa-aaa-gta | 6 | 8 | aaa | 11 | 10 | |
| atc | 4 | 5 | gta | 11 | 10 | |
| gca-cca | 4 | 5 | cca | 4 | 3 | |
| atc-gaa | 3 | 4 | gcc | 3 | 3 | |
| gaa-cds | 3 | 4 | 1145 | 1000 | ||
| gaa-aaa-gta-cds | 3 | 4 | ||||
| gaa-aaa-gca-gta | 2 | 3 | ||||
| gcc | 1 | 1 | ||||
| atc-gcc | 1 | 1 | ||||
| gcc-gaa | 1 | 1 | ||||
| atc-gca-cds | 1 | 1 | ||||
| 733 | 1000 |
gamma type x-16235 avant 16s[modifier | modifier le wikicode]
- Lien tableur: gamma type x-16235 avant 16s
- Légende:
- Catégories des séquences x y z de tRNAs dans les blocs à rRNAs, 16s-23s-5s.
- - 16-y-235-z: tRNAs reportés dans le tableau des blocs avec des z et des y majoritaires.
- - x-16-y-235-z: x, av16s, avant 16s.
- - 16-y-235-z’: z' différents des z
- - 16-y-23-: blocs incomplets sans 5s, avec ou sans y
- - 5-23-y-16 à l’envers: blocs complets mais à l'envers
- Catégories des séquences x y z de tRNAs dans les blocs à rRNAs, 16s-23s-5s.
| Par séquence | Par tRNA | |||
|---|---|---|---|---|
| avant | x-16235 | % | ||
| cgg-cac-cca | 10 | cgg | 11 | 24 |
| agc-gta | 3 | cac | 10 | 22 |
| atgf | 3 | cca | 10 | 22 |
| aaa | 2 | atgf | 3 | 7 |
| ttc | 1 | agc | 3 | 7 |
| atgj | 1 | gta | 3 | 7 |
| cgg | 1 | aaa | 2 | 4 |
| ttg | 1 | ttc | 1 | 2 |
| atgj | 1 | 2 | ||
| ttg | 1 | 2 | ||
| total | 45 | |||
gamma comparaison des types x y z[modifier | modifier le wikicode]
- Lien tableur: gamma comparaison des types x y z
- Légende:
- couleurs
- - type x: 45
- - type y: 1070
- - type z: 1070
- sommes de 2 types, en gras, effectif (pourcentage)
- - cds 14y + z (1.31y + 0.35z) ttc x + 2z (2.22x + 0.69z) gta 3x + 11y (6.67x + 1.03y) cca 10x + 4y (22.22x + 0.37y) aaa 2x + 11y (4.44x + 1.03y)
- - 3+, somme des 3 types majoritaires
- couleurs
- Notices:
- - Le type x, avant 16s, se comporte comme y et z, mais les 3 sont très différents. Le type x a ses propres séquences, ce qui prouve qu'il ne dérive pas des 2 autres. Ceci renforce l'idée qu'il a son propre processus et que ce n'est pas un artefact du aux éléments mobiles.
|
|
gamma. 5s se comporte comme un tRNA[modifier | modifier le wikicode]
- Lien tableur: gamma. 5s se comporte comme un tRNA
- Légende:
- - 23-acc-5s, le tRNA acc prend la place normale du 5s
- - 23-cds-5s-5s, le cds prend la place normale du 5s
- - gac-5s, c'est un type différent pris pour le type z gac, par erreur.
- Notices:
- acc-5s, avec un effectif de 46, autant que les 2 tRNAs, gac-tgg avec 56, le 5s se comporte comme un tRNA. Sert-il de modèle?
- 16gaa23-cds-5s-5s, un cds qui se comporte comme 5s! le 5s sert-il à la création du cds?
- Le 5s se comporte comme un tRNA. Au total il y a 68 type z et z' qui contiennent au moins un 5s en trop et 2 où la place normale du 5s est prise par un tRNA, 23-acc-5s, ou un cds, 23-cds-5s-5s.
- - Sur les 68 à position normale du 1er 5s,
- - 49 ont les 5s en trop après un seul tRNA dont le type le plus fréquent est acc-5s avec 46 cas auquel il faut ajouter un semblable, gac-5s, et 2 commençant par acc-5s, acc-5s-acc-5s et acc-5s-gac, où le 5s se trouve entre 2 tRNAs.
- - 18 ont un seul 5s en trop avant les tRNAs dont 7 sans tRNA, 9 avec gac-tgg, 2 avec 1 seul tRNA, gac tca.
- - 1 seul a 2 5s après le 1er 5s en position normale, 55-gac-tgg. Il ressemble en cela avec l'interverti par un cds, 23-cds-5s-5s.
- - Sur les 68 à position normale du 1er 5s,
- Sur les 725 blocs étudiés ici 723 ont le 1er 5s en position normale et 2 intervertis. 500 blocs n'ont pas de 5s en trop. Les 223 restants contiennent 1 à n tRNA ou 5s au-delà du bloc 23s5s:
n tRNA 5s et/ou tRNA 1 96 7 2 59 49 3 0 10 4 0 2
| Tableau | 16s23s5s | atcgca | gcaatc | gaa | atcgaa | autres | av16s | différents | total 5s+ | total | |
|---|---|---|---|---|---|---|---|---|---|---|---|
| des blocs | sans | 56 | 236 | 12 | 160 | 1 | 18 | 17 | 500 | ||
| 5s | 2 | 2 | 2 | 1 | 7 | 7 | |||||
| gac-tgg | 0 | 28 | 23 | 3 | 2 | 56 | |||||
| 5s-gac-tgg | 1 | 3 | 2 | 3 | 9 | 9 | |||||
| 55-gac-tgg | 1 | 1 | 1 | ||||||||
| gac | 8 | 33 | 30 | 2 | 5 | 78 | |||||
| gac-5s | 1 | 1 | 1 | ||||||||
| 5s-gac | 1 | 1 | 1 | ||||||||
| acc-5s | 7 | 19 | 20 | 46 | |||||||
| tgg | 1 | 1 | 2 | 1 | 5 | ||||||
| Différents | acc | 1 | 3 | 3 | 7 | ||||||
| acc-5s-acc-5s | 1 | 1 | 1 | ||||||||
| acc-5s-gac | 1 | 1 | 1 | ||||||||
| tca | 1 | 1 | 1 | 3 | |||||||
| ttc | 2 | 2 | |||||||||
| 23-cds-5s-5s | 1 | 1 | 1 | ||||||||
| gac-gac | 2 | 2 | |||||||||
| 23-acc-5s | 1 | 1 | |||||||||
| tta | 1 | 1 | |||||||||
| tgg-tgg | 1 | 1 | |||||||||
| 16-atc-2355-tac | 1 | 1 | 1 | ||||||||
| total | 77 | 330 | 14 | 248 | 3 | 30 | 22 | 1 | 23 | 725 | |
| tableau | 75 | 323 | 14 | 238 | 3 | 29 | 22 | 0 | 19 | 704 |
Tableau des noms gamma[modifier | modifier le wikicode]
- Lien tableur: Noms gamma
- Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
- Légende
- - notes
- - NCBI: [1]
- - eco et semblables, code KEGG à partir duquel on peut retrouver le NCBI
- - 2*95, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
- - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
- - rupture, sélection des génomes sur les 2 premiers attributs
- - fait, dans génomes gamma
- - code, utilisé dans les génomes "fait"
- - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
- - notes
tRNAs total 88462 génomes ruptures faits total total 314 144 1161
- Construction de la liste des noms
| ruptures | notes | rRNAs | fait | code | tRNAs | génomes |
|---|---|---|---|---|---|---|
| 1 | 222 | 1 | gm0001 | 54 | Acidithiobacillus caldus ATCC 51756 | |
| gm0002 | 55 | Acidithiobacillus caldus SM-1 | ||||
| 1 | 222 | 1 | gm0003 | 51 | Acidithiobacillus ferrivorans SS3 | |
| 1 | gm0004 | 88 | Acidithiobacillus ferrooxidans ATCC 23270 | |||
| 222 | 1 | gm0005 | 50 | Acidithiobacillus ferrooxidans ATCC 53993 | ||
| 1 | gm0006 | 72 | Acinetobacter baumannii 1656-2 | |||
| gm0007 | 75 | Acinetobacter baumannii 6200 | ||||
| gm0008 | 73 | Acinetobacter baumannii 6411 | ||||
| gm0009 | 74 | Acinetobacter baumannii A1 | ||||
| gm0010 | 74 | Acinetobacter baumannii AB0057 | ||||
| gm0011 | 75 | Acinetobacter baumannii AB030 | ||||
| gm0012 | 74 | Acinetobacter baumannii AB031 | ||||
| gm0013 | 74 | Acinetobacter baumannii AB307-0294 | ||||
| gm0014 | 75 | Acinetobacter baumannii AB5075-UW | ||||
| gm0015 | 73 | Acinetobacter baumannii AbH12O-A2 | ||||
| gm0016 | 39 | Acinetobacter baumannii AC12 | ||||
| 211 | 1 | gm0017 | 63 | Acinetobacter baumannii AC29 | ||
| gm0018 | 48 | Acinetobacter baumannii AC30 | ||||
| gm0019 | 65 | Acinetobacter baumannii ACICU | ||||
| gm0020 | 71 | Acinetobacter baumannii ATCC 17978 | ||||
| gm0021 | 73 | Acinetobacter baumannii AYE | ||||
| gm0022 | 75 | Acinetobacter baumannii BJAB07104 | ||||
| gm0023 | 76 | Acinetobacter baumannii BJAB0715 | ||||
| gm0024 | 76 | Acinetobacter baumannii BJAB0868 | ||||
| gm0025 | 66 | Acinetobacter baumannii D1279779 | ||||
| gm0026 | 75 | Acinetobacter baumannii IOMTU 433 | ||||
| gm0027 | 73 | Acinetobacter baumannii LAC-4 | ||||
| gm0028 | 76 | Acinetobacter baumannii MDR-TJ | ||||
| gm0029 | 70 | Acinetobacter baumannii MDR-ZJ06 | ||||
| gm0030 | 75 | Acinetobacter baumannii NCGM 237 | ||||
| gm0031 | 81 | Acinetobacter baumannii PKAB07 | ||||
| gm0032 | 65 | Acinetobacter baumannii SDF | ||||
| gm0033 | 43 | Acinetobacter baumannii TCDC-AB0715 | ||||
| gm0034 | 76 | Acinetobacter baumannii TYTH-1 | ||||
| gm0035 | 72 | Acinetobacter baumannii ZW85-1 | ||||
| 1 | 666 | 1 | gm0036 | 70 | Acinetobacter calcoaceticus PHEA-2 | |
| 1 | 666 | 1 | gm0037 | 72 | Acinetobacter oleivorans DR1 | |
| gm0038 | 77 | Acinetobacter sp. ADP1 | ||||
| 1 | 766 | 1 | gm0039 | 64 | Actinobacillus equuli subsp. equuli 19392 | |
| 1 | 766 | 1 | gm0040 | 64 | Actinobacillus pleuropneumoniae serovar 3 str. JL03 | |
| gm0041 | 63 | Actinobacillus pleuropneumoniae serovar 5b str. L20 | ||||
| gm0042 | 65 | Actinobacillus pleuropneumoniae serovar 7 str. AP76 | ||||
| 1 | 766 | 1 | gm0043 | 61 | Actinobacillus succinogenes 130Z | |
| 1 | gm0044 | 64 | Actinobacillus suis ATCC 33415 | |||
| 766 | 1 | gm0045 | 60 | Actinobacillus suis H91-0380 | ||
| 1 | gm0046 | 106 | Aeromonas hydrophila 4AK4 | |||
| 11,11,11 | 1 | gm0047 | 129 | Aeromonas hydrophila AH10 | ||
| gm0048 | 115 | Aeromonas hydrophila AL06-06 | ||||
| gm0049 | 114 | Aeromonas hydrophila AL09-71 | ||||
| gm0050 | 113 | Aeromonas hydrophila J-1 | ||||
| gm0051 | 114 | Aeromonas hydrophila ML09-119 | ||||
| gm0052 | 114 | Aeromonas hydrophila pc104A | ||||
| gm0053 | 128 | Aeromonas hydrophila subsp. hydrophila ATCC 7966 | ||||
| gm0054 | 129 | Aeromonas hydrophila YL17 | ||||
| 1 | 10,9,9 | 1 | gm0055 | 131 | Aeromonas media WS | |
| 1 | 10,9,9 | 1 | gm0056 | 111 | Aeromonas salmonicida subsp. salmonicida A449 | |
| 1 | 11,10,10 | 1 | gm0057 | 103 | Aeromonas veronii B565 | |
| 1 | 666 | 1 | gm0058 | 52 | Aggregatibacter actinomycetemcomitans ANH9381 | |
| gm0059 | 57 | Aggregatibacter actinomycetemcomitans D11S-1 | ||||
| gm0060 | 55 | Aggregatibacter actinomycetemcomitans D7S-1 | ||||
| gm0061 | 55 | Aggregatibacter actinomycetemcomitans HK1651 | ||||
| 1 | 766 | 1 | gm0062 | 60 | Aggregatibacter aphrophilus NJ8700 | |
| 1 | 333 | 1 | gm0063 | 43 | Alcanivorax borkumensis SK2 | |
| 1 | 222 | 1 | gm0064 | 45 | Alcanivorax dieselolei B5 | |
| 1 | 222 | 1 | gm0065 | 48 | Alcanivorax pacificus W11-5 | |
| 1 | 13,12,12 | 1 | gm0066 | 104 | Aliivibrio salmonicida LFI1238 | |
| 1 | 876 | 1 | gm0067 | 91 | Aliivibrio wodanis | |
| 1 | 222 | 1 | gm0068 | 49 | Alkalilimnicola ehrlichii MLHE-1 | |
| 1 | 333 | 1 | gm0069 | 54 | Allochromatium vinosum DSM 180 | |
| 1 | 555 | 1 | gm0070 | 68 | Alteromonas australica DE170 | |
| 555 | 1 | gm0071 | 57 | Alteromonas australica H 17 | ||
| 1 | gm0072 | 69 | Alteromonas macleodii AltDE1 | |||
| 655 | 1 | gm0073 | 54 | Alteromonas macleodii ATCC 27126 | ||
| gm0074 | 67 | Alteromonas macleodii str. Aegean Sea MED64 | ||||
| gm0075 | 72 | Alteromonas macleodii str. Balearic Sea AD45 | ||||
| gm0076 | 70 | Alteromonas macleodii str. Black Sea 11 | ||||
| gm0077 | 64 | Alteromonas macleodii str. Deep ecotype | ||||
| gm0078 | 68 | Alteromonas macleodii str. English Channel 615 | ||||
| 655 | 1 | gm0079 | 77 | Alteromonas macleodii str. English Channel 673 | ||
| gm0080 | 63 | Alteromonas macleodii str. Ionian Sea U4 | ||||
| gm0081 | 63 | Alteromonas macleodii str. Ionian Sea U7 | ||||
| gm0082 | 64 | Alteromonas macleodii str. Ionian Sea U8 | ||||
| gm0083 | 59 | Alteromonas macleodii str. Ionian Sea UM4b | ||||
| gm0084 | 65 | Alteromonas macleodii str. Ionian Sea UM7 | ||||
| 1 | gm0085 | 66 | Alteromonas sp. SN2 | |||
| 1 | 666 | 1 | gm0086 | 70 | Azotobacter chroococcum NCIMB 8003 | |
| 1 | 666 | 1 | gm0087 | 66 | Azotobacter vinelandii CA | |
| gm0088 | 66 | Azotobacter vinelandii CA6 | ||||
| gm0089 | 66 | Azotobacter vinelandii DJ ATCC BAA-1303 | ||||
| 1 | 766 | 1 | gm0090 | 58 | Bibersteinia trehalosi USDA-ARS-USMARC-188 | |
| gm0091 | 58 | Bibersteinia trehalosi USDA-ARS-USMARC-189 | ||||
| gm0092 | 59 | Bibersteinia trehalosi USDA-ARS-USMARC-190 | ||||
| gm0093 | 58 | Bibersteinia trehalosi USDA-ARS-USMARC-192 | ||||
| 1 | 111 | 1 | gm0094 | 38 | Blochmannia endosymbiont of Camponotus Colobopsis obliquus 757 | |
| gm0095 | 38 | Blochmannia endosymbiont of Polyrhachis Hedomyrma turneri 675 | ||||
| gm0096 | 31 | Buchnera aphidicola BCc | ||||
| gm0097 | 31 | Buchnera aphidicola Cinara tujafilina | ||||
| 1 | 111 | 1 | gm0098 | 32 | Buchnera aphidicola str. 5A Acyrthosiphon pisum | |
| gm0099 | 32 | Buchnera aphidicola str. Ak Acyrthosiphon kondoi | ||||
| gm0100 | 32 | Buchnera aphidicola str. APS Acyrthosiphon pisum | ||||
| gm0101 | 32 | Buchnera aphidicola str. Bp Baizongia pistaciae | ||||
| gm0102 | 32 | Buchnera aphidicola str. F009 Myzus persicae | ||||
| gm0103 | 32 | Buchnera aphidicola str. G002 Myzus persicae | ||||
| gm0104 | 32 | Buchnera aphidicola str. JF98 Acyrthosiphon pisum | ||||
| gm0105 | 32 | Buchnera aphidicola str. JF99 Acyrthosiphon pisum | ||||
| gm0106 | 32 | Buchnera aphidicola str. LL01 Acyrthosiphon pisum | ||||
| gm0107 | 32 | Buchnera aphidicola str. LSR1 Acyrthosiphon pisum | ||||
| gm0108 | 32 | Buchnera aphidicola str. Sg Schizaphis graminum | ||||
| gm0109 | 32 | Buchnera aphidicola str. TLW03 Acyrthosiphon pisum | ||||
| gm0110 | 32 | Buchnera aphidicola str. Tuc7 Acyrthosiphon pisum | ||||
| gm0111 | 32 | Buchnera aphidicola str. Ua Uroleucon ambrosiae | ||||
| gm0112 | 32 | Buchnera aphidicola str. USDA Myzus persicae | ||||
| gm0113 | 32 | Buchnera aphidicola str. W106 Myzus persicae | ||||
| 1 | 222 | 1 | gm0114 | 40 | Candidatus Baumannia cicadellinicola BGSS | |
| 1 | 111 | 1 | gm0115 | 41 | Candidatus Blochmannia chromaiodes str. 640 | |
| gm0116 | 37 | Candidatus Blochmannia floridanus | ||||
| gm0117 | 41 | Candidatus Blochmannia pennsylvanicus str. BPEN | ||||
| gm0118 | 38 | Candidatus Blochmannia vafer str. BVAF | ||||
| 1 | 011 | 1 | gm0119 | 27 | Candidatus Carsonella ruddii CE isolate Thao2000 | |
| gm0120 | 26 | Candidatus Carsonella ruddii CS isolate Thao2000 | ||||
| gm0121 | 27 | Candidatus Carsonella ruddii DC | ||||
| gm0122 | 24 | Candidatus Carsonella ruddii HC isolate Thao2000 | ||||
| gm0123 | 26 | Candidatus Carsonella ruddii HT isolate Thao2000 | ||||
| gm0124 | 27 | Candidatus Carsonella ruddii PC isolate NHV | ||||
| gm0125 | 26 | Candidatus Carsonella ruddii PV | ||||
| 1 | 111 | 1 | gm0126 | 33 | Candidatus Evansia muelleri | |
| 1 | 333 | 1 | gm0127 | 45 | Candidatus Hamiltonella defensa 5AT Acyrthosiphon pisum T5A | |
| 1 | 333 | 1 | gm0128 | 37 | Candidatus Ishikawaella capsulata Mpkobe | |
| 1 | 212 | 1 | gm0129 | 42 | Candidatus Moranella endobia PCIT | |
| gm0130 | 42 | Candidatus Moranella endobia PCVAL | ||||
| 1 | 233 | 1 | gm0131 | 40 | Candidatus Pantoea carbekii | |
| gm0132 | 39 | Candidatus Pantoea carbekii US | ||||
| gm0133 | 34 | Candidatus Portiera aleyrodidarum AD-CAI | ||||
| gm0134 | 35 | Candidatus Portiera aleyrodidarum AF-CAI | ||||
| 2*33 | gm0135 | 66 | Candidatus Portiera aleyrodidarum BT-B-HRs | |||
| gm0136 | 66 | Candidatus Portiera aleyrodidarum BT-QVLC | ||||
| 1 | 111 | 1 | gm0137 | 33 | Candidatus Portiera aleyrodidarum MED Bemisia tabaci BT-Q | |
| gm0138 | 34 | Candidatus Portiera aleyrodidarum TV | ||||
| gm0139 | 34 | Candidatus Portiera aleyrodidarum TV-BCN | ||||
| 1 | 222 | 1 | gm0140 | 33 | Candidatus Riesia pediculicola USDA | |
| 1 | 111 | 1 | gm0141 | 37 | Candidatus Ruthia magnifica str. Cm Calyptogena magnifica | |
| 1 | 252 | 1 | gm0142 | 57 | Candidatus Sodalis pierantonius str. SOPE | |
| 1 | 877 | 1 | gm0143 | 83 | Cedecea neteri M006 | |
| gm0144 | 84 | Cedecea neteri ND14a | ||||
| gm0145 | 77 | Cedecea neteri ND14b | ||||
| gm0146 | 83 | Cedecea neteri SSMD04 | ||||
| 1 | 333 | 1 | gm0147 | 49 | Cellvibrio japonicus Ueda107 | |
| 1 | 555 | 1 | gm0148 | 70 | Chromohalobacter salexigens DSM 3043 | |
| 1 | 988 | 1 | gm0149 | 84 | Citrobacter freundii CFNIH1 | |
| 1 | 877 | 1 | gm0150 | 84 | Citrobacter koseri ATCC BAA-895 | |
| 1 | 877 | 1 | gm0151 | 87 | Citrobacter rodentium ICC168 | |
| 1 | 10,9,9 | 1 | gm0152 | 89 | Colwellia psychrerythraea 34H BAA-681 | |
| gm0153 | 43 | Coxiella burnetii Cb175 Guyana | ||||
| gm0154 | 43 | Coxiella burnetii CbuG Q212 | ||||
| 1 | 111 | 1 | gm0155 | 44 | Coxiella burnetii CbuK Q154 | |
| gm0156 | 44 | Coxiella burnetii Dugway 5J108-111 | ||||
| gm0157 | 43 | Coxiella burnetii RSA 331 | ||||
| 1 | 111 | 1 | gm0158 | 43 | Coxiella burnetii RSA 493 | |
| gm0159 | 44 | Coxiella burnetii str. Namibia | ||||
| gm0160 | 43 | Coxiella burnetii Z3055 | ||||
| 1 | 111 | 1 | gm0161 | 39 | Coxiella endosymbiont of Amblyomma americanum | |
| 1 | 877 | 1 | gm0162 | 85 | Cronobacter sakazakii ATCC BAA-894 | |
| gm0163 | 85 | Cronobacter sakazakii CMCC 45402 CMCC45402 | ||||
| gm0164 | 81 | Cronobacter sakazakii ES15 | ||||
| gm0165 | 85 | Cronobacter sakazakii SP291 Sp291 | ||||
| 1 | 877 | 1 | gm0166 | 86 | Cronobacter turicensis z3032 | |
| 1 | 111 | 1 | gm0167 | 36 | Cycloclasticus sp. P1 MCCC 1A01040 | |
| 1 | 111 | 1 | gm0168 | 36 | Cycloclasticus zancles 7-ME | |
| 1 | 333 | 1 | gm0169 | 47 | Dichelobacter nodosus VCS1703A | |
| 1 | 877 | 1 | gm0170 | 76 | Dickeya dadantii 3937 | |
| gm0171 | 78 | Dickeya dadantii Ech586 | ||||
| gm0172 | 75 | Dickeya dadantii Ech703 | ||||
| 1 | 877 | 1 | gm0173 | 91 | Dickeya zeae EC1 | |
| gm0174 | 76 | Dickeya zeae Ech1591 | ||||
| 1 | 222 | 1 | gm0175 | 53 | Dyella japonica A8 | |
| 1 | gm0176 | 57 | Dyella jiangningensis SBZ 3-12 | |||
| 1 | 988 | 1 | gm0177 | 95 | Edwardsiella ictaluri 93-146 | |
| 1 | 988 | 1 | gm0178 | 96 | Edwardsiella piscicida C07-087 | |
| 1 | gm0179 | 99 | Edwardsiella tarda 080813 | |||
| 988 | 1 | gm0180 | 96 | Edwardsiella tarda EIB202 | ||
| gm0181 | 96 | Edwardsiella tarda FL6-60 | ||||
| 1 | 111 | 1 | gm0182 | 43 | endosymbiont of unidentified scaly snail isolate Monju | |
| 1 | 10,8,8 | 1 | gm0183 | 90 | Enterobacter aerogenes EA1509E | |
| gm0184 | 85 | Enterobacter aerogenes KCTC 2190 | ||||
| 1 | 988 | 1 | gm0185 | 85 | Enterobacter asburiae L1 | |
| gm0186 | 84 | Enterobacter asburiae LF7a | ||||
| 1 | gm0187 | 87 | Enterobacter cloacae 34399 | |||
| gm0188 | 86 | Enterobacter cloacae 34977 | ||||
| gm0189 | 86 | Enterobacter cloacae 34983 | ||||
| 988 | 1 | gm0190 | 90 | Enterobacter cloacae ECNIH2 | ||
| gm0191 | 84 | Enterobacter cloacae ECNIH3 | ||||
| gm0192 | 85 | Enterobacter cloacae ECNIH4 | ||||
| gm0193 | 84 | Enterobacter cloacae ECNIH5 | ||||
| gm0194 | 84 | Enterobacter cloacae ECR091 | ||||
| gm0195 | 84 | Enterobacter cloacae EcWSU1 | ||||
| gm0196 | 85 | Enterobacter cloacae GGT036 | ||||
| gm0197 | 104 | Enterobacter cloacae P101 | ||||
| 988 | 1 | gm0198 | 89 | Enterobacter cloacae subsp. cloacae ATCC 13047 | ||
| gm0199 | 84 | Enterobacter cloacae subsp. cloacae ENHKU01 | ||||
| gm0200 | 65 | Enterobacter cloacae subsp. cloacae NCTC 9394 | ||||
| gm0201 | 80 | Enterobacter cloacae subsp. dissolvens SDM | ||||
| 1 | 877 | 1 | gm0202 | 83 | Enterobacter lignolyticus SCF1 | |
| 1 | 877 | 1 | gm0203 | 87 | Enterobacter sp. 638 | |
| 1 | 11,10,8 | 1 | gm0204 | 89 | Enterobacter sp. R4-368 | |
| 1 | 10,9,9 | 1 | gm0205 | 88 | Enterobacteriaceae bacterium strain FGI 57 | |
| 1 | 877 | 1 | gm0206 | 79 | Erwinia amylovora ATCC 49946 | |
| gm0207 | 78 | Erwinia amylovora CFBP1430 | ||||
| gm0208 | 60 | Erwinia amylovora LA635 | ||||
| gm0209 | 60 | Erwinia amylovora LA636 | ||||
| gm0210 | 60 | Erwinia amylovora LA637 | ||||
| 1 | 777 | 1 | gm0211 | 78 | Erwinia billingiae Eb661 | |
| 1 | 877 | 1 | gm0212 | 76 | Erwinia pyrifoliae DSM 12163 | |
| gm0213 | 76 | Erwinia pyrifoliae Ep1/96 | ||||
| 1 | 877 | 1 | gm0214 | 78 | Erwinia sp. Ejp617 | |
| 1 | 877 | 1 | gm0215 | 82 | Erwinia tasmaniensis Et1/99 | |
| 1 | 877 | 1 | gm0216 | 89 | Escherichia albertii KF1 | |
| 1 | gm0217 | 93 | Escherichia coli | |||
| gm0218 | 95 | Escherichia coli 042 | ||||
| gm0219 | 91 | Escherichia coli 1303 | ||||
| gm0220 | 81 | Escherichia coli 536 | ||||
| gm0221 | 96 | Escherichia coli 55989 | ||||
| gm0222 | 87 | Escherichia coli 6409 | ||||
| gm0223 | 93 | Escherichia coli 94-3024 | ||||
| gm0224 | 89 | Escherichia coli ABU 83972 | ||||
| gm0225 | 89 | Escherichia coli APEC IMT5155 | ||||
| gm0226 | 98 | Escherichia coli APEC O1 | ||||
| gm0227 | 91 | Escherichia coli APEC O78 | ||||
| gm0228 | 85 | Escherichia coli ATCC 25922 | ||||
| gm0229 | 87 | Escherichia coli ATCC 8739 | ||||
| gm0230 | 87 | Escherichia coli B str. REL606 | ||||
| gm0231 | 87 | Escherichia coli B7A | ||||
| gm0232 | 86 | Escherichia coli BL21 TaKaRa | ||||
| gm0233 | 86 | Escherichia coli BL21-GoldDE3pLysS AG | ||||
| gm0234 | 172 | Escherichia coli BL21DE3 | ||||
| gm0235 | 88 | Escherichia coli BW25113 K-12 substr. BW25113 | ||||
| gm0236 | 89 | Escherichia coli BW2952 K-12 substr. BW2952 | ||||
| gm0237 | 86 | Escherichia coli C41DE3 | ||||
| gm0238 | 89 | Escherichia coli CFT073 | ||||
| gm0239 | 92 | Escherichia coli CI5 | ||||
| 88+89 | gm0240 | 177 | Escherichia coli DH1 | |||
| gm0241 | 91 | Escherichia coli ECC-1470 | ||||
| gm0242 | 94 | Escherichia coli ECONIH1 | ||||
| gm0243 | 92 | Escherichia coli ED1a | ||||
| gm0244 | 89 | Escherichia coli ER2796 | ||||
| gm0245 | 92 | Escherichia coli ETEC H10407 | ||||
| gm0246 | 95 | Escherichia coli FAP1 | ||||
| gm0247 | 90 | Escherichia coli HS | ||||
| gm0248 | 93 | Escherichia coli HUSEC2011 | ||||
| gm0249 | 87 | Escherichia coli IAI1 | ||||
| gm0250 | 89 | Escherichia coli IAI39 | ||||
| gm0251 | 100 | Escherichia coli IHE3034 | ||||
| gm0252 | 91 | Escherichia coli JJ1886 | ||||
| gm0253 | 89 | Escherichia coli K-12 ER3413 | ||||
| gm0254 | 89 | Escherichia coli K-12 ER3435 | ||||
| gm0255 | 89 | Escherichia coli K-12 ER3440 | ||||
| gm0256 | 89 | Escherichia coli K-12 ER3445 | ||||
| gm0257 | 89 | Escherichia coli K-12 ER3446 | ||||
| gm0258 | 89 | Escherichia coli K-12 ER3454 | ||||
| gm0259 | 89 | Escherichia coli K-12 ER3466 | ||||
| gm0260 | 89 | Escherichia coli K-12 ER3475 | ||||
| gm0261 | 89 | Escherichia coli K-12 ER3476 | ||||
| gm0262 | 89 | Escherichia coli K-12 substr. HMS174 | ||||
| gm0263 | 89 | Escherichia coli K-12 substr. RV308 | ||||
| gm0264 | 89 | Escherichia coli KLY | ||||
| 2*86 | gm0265 | 172 | Escherichia coli KO11FL | |||
| gm0266 | 87 | Escherichia coli LF82 | ||||
| gm0267 | 86 | Escherichia coli LY180 | ||||
| gm0268 | 88 | Escherichia coli MNCRE44 | ||||
| gm0269 | 82 | Escherichia coli NA114 | ||||
| NCBI | 11,10,8 | gm0270 | 123 | Escherichia coli Nissle 1917 | ||
| gm0271 | 104 | Escherichia coli O103 H2 str. 12009 | ||||
| gm0272 | 99 | Escherichia coli O104 H4 str. 2009EL-2050 | ||||
| gm0273 | 99 | Escherichia coli O104 H4 str. 2009EL-2071 | ||||
| gm0274 | 94 | Escherichia coli O104 H4 str. 2011C-3493 | ||||
| gm0275 | 116 | Escherichia coli O111 H- str. 11128 | ||||
| gm0276 | 93 | Escherichia coli O127 H6 str. E2348/69 | ||||
| gm0277 | 93 | Escherichia coli O139 H28 str. E24377A | ||||
| gm0278 | 113 | Escherichia coli O145 H28 str. RM12581 | ||||
| gm0279 | 104 | Escherichia coli O145 H28 str. RM12761 | ||||
| gm0280 | 113 | Escherichia coli O145 H28 str. RM13514 | ||||
| gm0281 | 104 | Escherichia coli O145 H28 str. RM13516 | ||||
| gm0282 | 96 | Escherichia coli O157 H16 Santai | ||||
| gm0283 | 113 | Escherichia coli O157 H7 str. EC4115 | ||||
| gm0284 | 210 | Escherichia coli O157 H7 str. EDL933 | ||||
| gm0285 | 108 | Escherichia coli O157 H7 str. Sakai Sakai substr. RIMD 0509952 | ||||
| gm0286 | 112 | Escherichia coli O157 H7 str. SS17 | ||||
| gm0287 | 111 | Escherichia coli O157 H7 str. SS52 | ||||
| gm0288 | 112 | Escherichia coli O157 H7 str. TW14359 | ||||
| gm0289 | 106 | Escherichia coli O26 H11 str. 11368 | ||||
| gm0290 | 105 | Escherichia coli O55 H7 str. CB9615 | ||||
| gm0291 | 108 | Escherichia coli O55 H7 str. RM12579 | ||||
| gm0292 | 94 | Escherichia coli O7 K1 str. CE10 | ||||
| gm0293 | 84 | Escherichia coli O83 H1 str. NRG 857C | ||||
| gm0294 | 88 | Escherichia coli P12b | ||||
| gm0295 | 90 | Escherichia coli PMV-1 | ||||
| gm0296 | 96 | Escherichia coli RM9387 | ||||
| gm0297 | 94 | Escherichia coli S88 | ||||
| gm0298 | 92 | Escherichia coli SE11 | ||||
| gm0299 | 87 | Escherichia coli SE15 | ||||
| gm0300 | 91 | Escherichia coli SMS-3-5 | ||||
| gm0301 | 91 | Escherichia coli ST131 EC958 | ||||
| gm0302 | 284 | Escherichia coli ST2747 | ||||
| gm0303 | 285 | Escherichia coli ST540 | ||||
| gm0304 | 89 | Escherichia coli str. clone D i14 | ||||
| gm0305 | 89 | Escherichia coli str. clone D i2 | ||||
| gm0306 | 90 | Escherichia coli str. K-12 substr. DH10B | ||||
| gm0307 | 89 | Escherichia coli str. K-12 substr. MC4100 | ||||
| gm0308 | 86 | Escherichia coli str. K-12 substr. MDS42 | ||||
| 4*86 | 877 | 1 | gm0309 | 356 | Escherichia coli str. K-12 substr. MG1655 | |
| gm0310 | 89 | Escherichia coli str. K-12 substr. W3110 | ||||
| gm0311 | 86 | Escherichia coli UM146 | ||||
| gm0312 | 89 | Escherichia coli UMN026 | ||||
| gm0313 | 106 | Escherichia coli UMNF18 | ||||
| gm0314 | 99 | Escherichia coli UMNK88 | ||||
| gm0315 | 90 | Escherichia coli UTI89 | ||||
| gm0316 | 94 | Escherichia coli VR50 | ||||
| gm0317 | 176 | Escherichia coli W | ||||
| gm0318 | 97 | Escherichia coli Xuzhou21 | ||||
| 1 | 877 | 1 | gm0319 | 89 | Escherichia fergusonii ATCC 35469 | |
| 1 | 877 | 1 | gm0320 | 122 | Ferrimonas balearica DSM 9799 | |
| 1 | 433 | 1 | gm0321 | 39 | Francisella cf. novicida Fx1 | |
| 1 | 433 | 1 | gm0322 | 39 | Francisella cf. tularensis subsp. novicida 3523 | |
| 1 | 433 | 1 | gm0323 | 39 | Francisella guangzhouensis 08HL01032 | |
| 1 | 433 | 1 | gm0324 | 40 | Francisella noatunensis subsp. orientalis LADL--07-285A | |
| gm0325 | 36 | Francisella noatunensis subsp. orientalis str. Toba 04 | ||||
| 1 | 433 | 1 | gm0326 | 41 | Francisella philomiragia GA01-2794 | |
| gm0327 | 41 | Francisella philomiragia GA01-2801 | ||||
| gm0328 | 40 | Francisella philomiragia O#319-029 | ||||
| gm0329 | 40 | Francisella philomiragia O#319-036 FSC 153 | ||||
| gm0330 | 40 | Francisella philomiragia O#319-067 | ||||
| gm0331 | 40 | Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L | ||||
| gm0332 | 40 | Francisella philomiragia subsp. philomiragia ATCC 25017 | ||||
| 1 | 433 | 1 | gm0333 | 39 | Francisella sp. FSC1006 | |
| 1 | 433 | 1 | gm0334 | 40 | Francisella sp. TX077308 | |
| 1 | 433 | 1 | gm0335 | 39 | Francisella tularensis subsp. holarctica 425 | |
| gm0336 | 39 | Francisella tularensis subsp. holarctica F92 | ||||
| gm0337 | 39 | Francisella tularensis subsp. holarctica FSC200 | ||||
| gm0338 | 39 | Francisella tularensis subsp. holarctica FTNF002-00 | ||||
| gm0339 | 39 | Francisella tularensis subsp. holarctica FTT 1 | ||||
| gm0340 | 78 | Francisella tularensis subsp. holarctica LVS | ||||
| gm0341 | 78 | Francisella tularensis subsp. holarctica OSU18 | ||||
| gm0342 | 39 | Francisella tularensis subsp. holarctica PHIT-FT049 | ||||
| gm0343 | 39 | Francisella tularensis subsp. holarctica VT68 | ||||
| gm0344 | 39 | Francisella tularensis subsp. mediasiatica FSC147 GIEM 543 | ||||
| gm0345 | 39 | Francisella tularensis subsp. novicida D9876 | ||||
| gm0346 | 39 | Francisella tularensis subsp. novicida F6168 | ||||
| gm0347 | 78 | Francisella tularensis subsp. novicida U112 | ||||
| gm0348 | 39 | Francisella tularensis subsp. tularensis FSC198 FSC 198 | ||||
| gm0349 | 39 | Francisella tularensis subsp. tularensis NE061598 | ||||
| gm0350 | 37 | Francisella tularensis subsp. tularensis NIH B-38 | ||||
| gm0351 | 37 | Francisella tularensis subsp. tularensis Scherm | ||||
| gm0352 | 39 | Francisella tularensis subsp. tularensis SCHU S4 | ||||
| gm0353 | 39 | Francisella tularensis subsp. tularensis SCHU S4 SHU-S4 | ||||
| gm0354 | 39 | Francisella tularensis subsp. tularensis str. SCHU S4 substr. NR-28534 | ||||
| gm0355 | 39 | Francisella tularensis subsp. tularensis TI0902 | ||||
| gm0356 | 40 | Francisella tularensis subsp. tularensis TIGB03 | ||||
| gm0357 | 39 | Francisella tularensis subsp. tularensis WY96 | ||||
| gm0358 | 39 | Francisella tularensis subsp. tularensis WY96-3418 | ||||
| 1 | 444 | 1 | gm0359 | 76 | Frateuria aurantia DSM 6220 | |
| 1 | 544 | 1 | gm0360 | 54 | Frischella perrara PEB0191 | |
| 1 | 766 | 1 | gm0361 | 59 | Gallibacterium anatis UMN179 | |
| 1 | gm0362 | 51 | gamma proteobacterium HdN1 | |||
| 1 | 444 | 1 | gm0363 | 53 | Gilliamella apicola wkB1 | |
| 1 | 444 | 1 | gm0364 | 55 | Glaciecola nitratireducens FR1064 | |
| 1 | 666 | 1 | gm0365 | 60 | Glaciecola psychrophila 170 | |
| 1 | 555 | 1 | gm0366 | 62 | Glaciecola sp. 4H-3-7+YE-5 | |
| 1 | 444 | 1 | gm0367 | 50 | Gynuella sunshinyii YC6258 | |
| 1 | 766 | 1 | gm0368 | 50 | Haemophilus ducreyi 35000HP | |
| 1 | 866 | 1 | gm0369 | 59 | Haemophilus influenzae 10810 | |
| gm0370 | 60 | Haemophilus influenzae 2019 | ||||
| gm0371 | 61 | Haemophilus influenzae 477 | ||||
| gm0372 | 60 | Haemophilus influenzae 723 | ||||
| gm0373 | 60 | Haemophilus influenzae 86-028NP | ||||
| gm0374 | 58 | Haemophilus influenzae C486 | ||||
| gm0375 | 60 | Haemophilus influenzae CGSHiCZ412602 | ||||
| gm0376 | 61 | Haemophilus influenzae F3031 | ||||
| gm0377 | 59 | Haemophilus influenzae F3047 | ||||
| gm0378 | 61 | Haemophilus influenzae Hi375 | ||||
| gm0379 | 59 | Haemophilus influenzae KR494 | ||||
| gm0380 | 59 | Haemophilus influenzae PittEE | ||||
| gm0381 | 58 | Haemophilus influenzae PittGG | ||||
| gm0382 | 58 | Haemophilus influenzae R2846 | ||||
| gm0383 | 62 | Haemophilus influenzae R2866 | ||||
| gm0384 | 59 | Haemophilus influenzae Rd KW20 | ||||
| gm0385 | 59 | Haemophilus parainfluenzae T3T1 | ||||
| 1 | 866 | 1 | gm0386 | 57 | Haemophilus parasuis KL0318 | |
| gm0387 | 57 | Haemophilus parasuis SH0165 | ||||
| gm0388 | 60 | Haemophilus parasuis SH03 | ||||
| gm0389 | 64 | Haemophilus parasuis ZJ0906 | ||||
| 1 | 988 | 1 | gm0390 | 94 | Hafnia alvei FB1 | |
| 1 | 555 | 1 | gm0391 | 69 | Hahella chejuensis KCTC 2396 | |
| 1 | 666 | 1 | gm0392 | 61 | Halomonas campaniensis LS21 | |
| 1 | 444 | 1 | gm0393 | 71 | Halomonas elongata DSM 2581 | |
| 1 | 666 | 1 | gm0394 | 65 | Halomonas sp. KO116 | |
| 1 | gm0395 | 48 | Halorhodospira halochloris str. A | |||
| 1 | 222 | 1 | gm0396 | 48 | Halorhodospira halophila SL1 | |
| 1 | 222 | 1 | gm0397 | 45 | Halothiobacillus neapolitanus c2 | |
| 1 | 444 | 1 | gm0398 | 57 | Idiomarina loihiensis GSL 199 | |
| gm0399 | 57 | Idiomarina loihiensis L2TR | ||||
| 1 | 222 | 1 | gm0400 | 42 | Kangiella koreensis DSM 16069 | |
| 1 | 978 | 1 | gm0401 | 85 | Klebsiella michiganensis RC10 | |
| 1 | 988 | 1 | gm0402 | 87 | Klebsiella oxytoca E718 | |
| gm0403 | 87 | Klebsiella oxytoca HKOPL1 | ||||
| gm0404 | 85 | Klebsiella oxytoca KCTC 1686 | ||||
| gm0405 | 88 | Klebsiella oxytoca KONIH1 | ||||
| gm0406 | 83 | Klebsiella oxytoca M1 | ||||
| gm0407 | 80 | Klebsiella pneumoniae 30660/NJST258 1 | ||||
| gm0408 | 88 | Klebsiella pneumoniae 30684/NJST258 2 | ||||
| 1 | 10,9,9 | 1 | gm0409 | 92 | Klebsiella pneumoniae 32192 | |
| gm0410 | 89 | Klebsiella pneumoniae 342 | ||||
| gm0411 | 89 | Klebsiella pneumoniae 34618 | ||||
| gm0412 | 88 | Klebsiella pneumoniae ATCC BAA-2146 | ||||
| 1 | 988 | 1 | gm0413 | 87 | Klebsiella pneumoniae blaNDM-1 | |
| gm0414 | 82 | Klebsiella pneumoniae CG43 | ||||
| gm0415 | 89 | Klebsiella pneumoniae HK787 | ||||
| gm0416 | 86 | Klebsiella pneumoniae JM45 | ||||
| gm0417 | 90 | Klebsiella pneumoniae KCTC 2242 | ||||
| gm0418 | 86 | Klebsiella pneumoniae Kp52.145 | ||||
| gm0419 | 90 | Klebsiella pneumoniae PMK1 | ||||
| 1 | 977 | 1 | gm0420 | 70 | Klebsiella pneumoniae SB3432 | |
| gm0421 | 81 | Klebsiella pneumoniae subsp. pneumoniae 1084 | ||||
| gm0422 | 87 | Klebsiella pneumoniae subsp. pneumoniae 1158 | ||||
| gm0423 | 87 | Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1 | ||||
| gm0424 | 91 | Klebsiella pneumoniae subsp. pneumoniae HS11286 | ||||
| gm0425 | 87 | Klebsiella pneumoniae subsp. pneumoniae Kp13 | ||||
| gm0426 | 79 | Klebsiella pneumoniae subsp. pneumoniae KP5-1 | ||||
| gm0427 | 91 | Klebsiella pneumoniae subsp. pneumoniae KPNIH1 | ||||
| gm0428 | 91 | Klebsiella pneumoniae subsp. pneumoniae KPNIH10 | ||||
| gm0429 | 89 | Klebsiella pneumoniae subsp. pneumoniae KPNIH24 | ||||
| gm0430 | 87 | Klebsiella pneumoniae subsp. pneumoniae KPNIH27 | ||||
| gm0431 | 88 | Klebsiella pneumoniae subsp. pneumoniae KPNIH29 | ||||
| gm0432 | 89 | Klebsiella pneumoniae subsp. pneumoniae KPNIH30 | ||||
| gm0433 | 86 | Klebsiella pneumoniae subsp. pneumoniae KPNIH31 | ||||
| gm0434 | 91 | Klebsiella pneumoniae subsp. pneumoniae KPNIH32 | ||||
| gm0435 | 91 | Klebsiella pneumoniae subsp. pneumoniae KPNIH33 | ||||
| gm0436 | 87 | Klebsiella pneumoniae subsp. pneumoniae KPR0928 | ||||
| gm0437 | 88 | Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ATCC 700721 | ||||
| gm0438 | 88 | Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 | ||||
| gm0439 | 87 | Klebsiella pneumoniae subsp. pneumoniae PittNDM01 | ||||
| gm0440 | 86 | Klebsiella pneumoniae XH209 | ||||
| 1 | 988 | 1 | gm0441 | 86 | Klebsiella variicola At-22 | |
| gm0442 | 87 | Klebsiella variicola DSM 15968 | ||||
| gm0443 | 89 | Klebsiella variicola DX120E | ||||
| 1 | gm0444 | 83 | Kosakonia sacchari SP1 | |||
| 1 | gm0445 | 49 | Legionella fallonii LLAP-10 | |||
| 1 | gm0446 | 45 | Legionella hackeliae ATCC35250 | |||
| 1 | gm0447 | 50 | Legionella longbeachae NSW150 | |||
| 1 | gm0448 | 45 | Legionella oakridgensis ATCC 33761 DSM 21215 OR-10 | |||
| 1 | gm0449 | 48 | Legionella pneumophila 2300/99 Alcoy | |||
| gm0450 | 49 | Legionella pneumophila str. Corby | ||||
| gm0451 | 44 | Legionella pneumophila str. Lens | ||||
| gm0452 | 47 | Legionella pneumophila str. Paris | ||||
| gm0453 | 46 | Legionella pneumophila subsp. pneumophila ATCC 43290 | ||||
| gm0454 | 48 | Legionella pneumophila subsp. pneumophila HL06041035 | ||||
| gm0455 | 46 | Legionella pneumophila subsp. pneumophila Lorraine | ||||
| gm0456 | 46 | Legionella pneumophila subsp. pneumophila LPE509 | ||||
| gm0457 | 43 | Legionella pneumophila subsp. pneumophila str. Hextuple 2q Philadelphia 1 substr. Lp02 | ||||
| gm0458 | 43 | Legionella pneumophila subsp. pneumophila str. Hextuple 3a Philadelphia 1 substr. Lp02 | ||||
| gm0459 | 46 | Legionella pneumophila subsp. pneumophila str. Philadelphia 1 | ||||
| gm0460 | 41 | Legionella pneumophila subsp. pneumophila str. Thunder Bay | ||||
| 1 | gm0461 | 67 | Mannheimia haemolytica 89010807N | |||
| gm0462 | 67 | Mannheimia haemolytica 89010807N lktA- | ||||
| gm0463 | 64 | Mannheimia haemolytica D153 | ||||
| gm0464 | 61 | Mannheimia haemolytica D171 | ||||
| gm0465 | 68 | Mannheimia haemolytica D174 | ||||
| gm0466 | 63 | Mannheimia haemolytica M42548 | ||||
| gm0467 | 67 | Mannheimia haemolytica USDA-ARS-USMARC-183 | ||||
| gm0468 | 64 | Mannheimia haemolytica USDA-ARS-USMARC-184 | ||||
| gm0469 | 63 | Mannheimia haemolytica USDA-ARS-USMARC-185 | ||||
| 766 | 1 | gm0470 | 66 | Mannheimia haemolytica USMARC 2286 | ||
| 1 | gm0471 | 61 | Mannheimia succiniciproducens MBEL55E | |||
| 1 | gm0472 | 64 | Mannheimia varigena USDA-ARS-USMARC-1261 | |||
| gm0473 | 63 | Mannheimia varigena USDA-ARS-USMARC-1296 | ||||
| gm0474 | 62 | Mannheimia varigena USDA-ARS-USMARC-1312 | ||||
| gm0475 | 62 | Mannheimia varigena USDA-ARS-USMARC-1388 | ||||
| 1 | 333 | 1 | gm0476 | 57 | Marichromatium purpuratum 984 987 | |
| 1 | gm0477 | 55 | Marinobacter adhaerens HP15 | |||
| 1 | 333 | 1 | gm0478 | 52 | Marinobacter hydrocarbonoclasticus ATCC 49840 | |
| gm0479 | 54 | Marinobacter hydrocarbonoclasticus VT8 | ||||
| 1 | gm0480 | 44 | Marinobacter salarius R9SW1 | |||
| 1 | gm0481 | 48 | Marinobacter similis A3d10 | |||
| 1 | gm0482 | 54 | Marinobacter sp. BSs20148 | |||
| 1 | 777 | 1 | gm0483 | 81 | Marinomonas mediterranea MMB-1 | |
| 1 | gm0484 | 80 | Marinomonas posidonica IVIA-Po-181 | |||
| 1 | gm0485 | 83 | Marinomonas sp. MWYL1 | |||
| 1 | 222 | 1 | gm0486 | 47 | Methylococcus capsulatus str. Bath | |
| 1 | 333 | 1 | gm0487 | 47 | Methylomicrobium alcaliphilum 20Z | |
| 1 | 333 | 1 | gm0488 | 47 | Methylomonas methanica MC09 | |
| 1 | 333 | 1 | gm0489 | 44 | Methylophaga frappieri JAM7 | |
| 1 | gm0490 | 47 | Methylophaga nitratireducenticrescens JAM1 | |||
| 1 | 444 | 1 | gm0491 | 50 | Moraxella catarrhalis 25239 | |
| gm0492 | 50 | Moraxella catarrhalis 25240 | ||||
| gm0493 | 50 | Moraxella catarrhalis BBH18 | ||||
| 1 | 776 | 1 | gm0494 | 82 | Morganella morganii subsp. morganii KT | |
| 1 | 13,11,11 | 1 | gm0495 | 132 | Moritella viscosa | |
| 1 | gm0496 | 48 | Nitrosococcus halophilus Nc 4 | |||
| 1 | gm0497 | 48 | Nitrosococcus oceani ATCC 19707 | |||
| 1 | gm0498 | 48 | Nitrosococcus watsonii C-113 | |||
| 1 | gm0499 | 92 | Oceanimonas sp. GK1 | |||
| 1 | gm0500 | 52 | Oleispira antarctica RB-8 | |||
| 1 | gm0501 | 79 | Pantoea ananatis AJ13355 | |||
| gm0502 | 73 | Pantoea ananatis LMG 20103 | ||||
| gm0503 | 80 | Pantoea ananatis LMG 5342 | ||||
| gm0504 | 87 | Pantoea ananatis PA13 | ||||
| 1 | gm0505 | 80 | Pantoea rwandensis ND04 | |||
| 1 | gm0506 | 83 | Pantoea sp. At-9b | |||
| 1 | gm0507 | 85 | Pantoea sp. PSNIH1 | |||
| 1 | gm0508 | 87 | Pantoea sp. PSNIH2 | |||
| 1 | gm0509 | 80 | Pantoea vagans C9-1 | |||
| 1 | gm0510 | 56 | Pasteurella multocida 36950 | |||
| gm0511 | 59 | Pasteurella multocida ATCC 43137 | ||||
| gm0512 | 61 | Pasteurella multocida OH1905 | ||||
| gm0513 | 59 | Pasteurella multocida subsp. multocida OH4807 | ||||
| gm0514 | 56 | Pasteurella multocida subsp. multocida str. 3480 | ||||
| gm0515 | 55 | Pasteurella multocida subsp. multocida str. HB03 | ||||
| gm0516 | 57 | Pasteurella multocida subsp. multocida str. HN06 | ||||
| gm0517 | 58 | Pasteurella multocida subsp. multocida str. Pm70 | ||||
| 1 | gm0518 | 79 | Pectobacterium atrosepticum 21A | |||
| gm0519 | 78 | Pectobacterium atrosepticum JG10-08 | ||||
| gm0520 | 78 | Pectobacterium atrosepticum SCRI1043 | ||||
| 1 | gm0521 | 79 | Pectobacterium carotovorum subsp. carotovorum PC1 | |||
| gm0522 | 78 | Pectobacterium carotovorum subsp. carotovorum PCC21 | ||||
| gm0523 | 78 | Pectobacterium carotovorum subsp. odoriferum BC S7 | ||||
| 1 | gm0524 | 78 | Pectobacterium sp. SCC3193 | |||
| 1 | gm0525 | 76 | Pectobacterium wasabiae WPP163 | |||
| 1 | 11,9,9 | 1 | gm0526 | 137 | Photobacterium gaetbulicola Gung47 | |
| 1 | gm0527 | 97 | Photorhabdus asymbiotica | |||
| 1 | gm0528 | 62 | Plautia stali symbiont | |||
| 1 | gm0529 | 86 | Pluralibacter gergoviae FB2 | |||
| 1 | gm0530 | 83 | Proteus mirabilis BB2000 | |||
| gm0531 | 85 | Proteus mirabilis HI4320 | ||||
| 1 | gm0532 | 81 | Providencia stuartii ATCC 33672 | |||
| gm0533 | 78 | Providencia stuartii MRSN 2154 | ||||
| 1 | gm0534 | 63 | Pseudoalteromonas atlantica T6c | |||
| 1 | 10,9,9 | 1 | gm0535 | 108 | Pseudoalteromonas haloplanktis TAC125 | |
| 1 | gm0536 | 97 | Pseudoalteromonas sp. OCN003 | |||
| 1 | gm0537 | 63 | Pseudoalteromonas sp. SM9913 | |||
| 1 | 444 | 1 | gm0538 | 66 | Pseudomonas aeruginosa 19BR | |
| gm0539 | 66 | Pseudomonas aeruginosa 213BR | ||||
| gm0540 | 67 | Pseudomonas aeruginosa B136-33 | ||||
| gm0541 | 64 | Pseudomonas aeruginosa c7447m C7447m | ||||
| gm0542 | 65 | Pseudomonas aeruginosa DK2 | ||||
| gm0543 | 66 | Pseudomonas aeruginosa F22031 | ||||
| gm0544 | 67 | Pseudomonas aeruginosa FRD1 | ||||
| gm0545 | 69 | Pseudomonas aeruginosa LES400 | ||||
| gm0546 | 68 | Pseudomonas aeruginosa LES431 | ||||
| gm0547 | 69 | Pseudomonas aeruginosa LESB58 | ||||
| gm0548 | 65 | Pseudomonas aeruginosa LESB65 | ||||
| gm0549 | 65 | Pseudomonas aeruginosa LESlike1 | ||||
| gm0550 | 65 | Pseudomonas aeruginosa LESlike4 | ||||
| gm0551 | 65 | Pseudomonas aeruginosa LESlike5 | ||||
| gm0552 | 64 | Pseudomonas aeruginosa LESlike7 | ||||
| gm0553 | 66 | Pseudomonas aeruginosa M18 | ||||
| gm0554 | 68 | Pseudomonas aeruginosa MTB-1 | ||||
| gm0555 | 72 | Pseudomonas aeruginosa NCGM 1900 | ||||
| gm0556 | 73 | Pseudomonas aeruginosa NCGM 1984 | ||||
| gm0557 | 70 | Pseudomonas aeruginosa NCGM2.S1 | ||||
| gm0558 | 67 | Pseudomonas aeruginosa PA1 | ||||
| gm0559 | 67 | Pseudomonas aeruginosa PA1R | ||||
| gm0560 | 67 | Pseudomonas aeruginosa PA38182 | ||||
| gm0561 | 67 | Pseudomonas aeruginosa PA7 | ||||
| gm0562 | 66 | Pseudomonas aeruginosa PA96 | ||||
| gm0563 | 65 | Pseudomonas aeruginosa PACS2 | ||||
| gm0564 | 64 | Pseudomonas aeruginosa PAO1 | ||||
| gm0565 | 64 | Pseudomonas aeruginosa PAO1-VE13 | ||||
| gm0566 | 64 | Pseudomonas aeruginosa PAO1-VE2 | ||||
| gm0567 | 64 | Pseudomonas aeruginosa PAO1H2O | ||||
| gm0568 | 64 | Pseudomonas aeruginosa PAO581 | ||||
| gm0569 | 65 | Pseudomonas aeruginosa PSE305 | ||||
| gm0570 | 66 | Pseudomonas aeruginosa RP73 | ||||
| gm0571 | 66 | Pseudomonas aeruginosa SCV20265 | ||||
| gm0572 | 66 | Pseudomonas aeruginosa UCBPP-PA14 | ||||
| gm0573 | 73 | Pseudomonas aeruginosa VRFPA04 | ||||
| gm0574 | 67 | Pseudomonas aeruginosa YL84 | ||||
| 1 | gm0575 | 72 | Pseudomonas alkylphenolia KL28 | |||
| 1 | gm0576 | 62 | Pseudomonas balearica DSM 6083 DSM6083 SP1402 | |||
| 1 | gm0577 | 66 | Pseudomonas brassicacearum DF41 | |||
| gm0578 | 68 | Pseudomonas brassicacearum subsp. brassicacearum NFM421 | ||||
| 1 | gm0579 | 72 | Pseudomonas chlororaphis PA23 | |||
| gm0580 | 81 | Pseudomonas chlororaphis PCL1606 | ||||
| gm0581 | 70 | Pseudomonas chlororaphis subsp. aurantiaca JD37 | ||||
| 1 | gm0582 | 67 | Pseudomonas cichorii JBC1 | |||
| 1 | gm0583 | 76 | Pseudomonas cremoricolorata ND07 | |||
| gm0584 | 64 | Pseudomonas denitrificans ATCC 13867 | ||||
| 1 | gm0585 | 78 | Pseudomonas entomophila L48 | |||
| 1 | gm0586 | 69 | Pseudomonas fluorescens A506 | |||
| gm0587 | 66 | Pseudomonas fluorescens F113 | ||||
| gm0588 | 69 | Pseudomonas fluorescens LBUM223 | ||||
| gm0589 | 71 | Pseudomonas fluorescens PCL1751 | ||||
| gm0590 | 74 | Pseudomonas fluorescens Pf0-1 | ||||
| gm0591 | 69 | Pseudomonas fluorescens PICF7 | ||||
| gm0592 | 67 | Pseudomonas fluorescens SBW25 | ||||
| gm0593 | 70 | Pseudomonas fluorescens UK4 | ||||
| 1 | gm0594 | 67 | Pseudomonas fulva 12-X | |||
| 1 | gm0595 | 62 | Pseudomonas knackmussii B13 | |||
| 1 | gm0596 | 68 | Pseudomonas mandelii JR-1 | |||
| 1 | gm0597 | 67 | Pseudomonas mendocina NK-01 | |||
| gm0598 | 67 | Pseudomonas mendocina ymp | ||||
| 1 | gm0599 | 69 | Pseudomonas monteilii SB3078 | |||
| gm0600 | 67 | Pseudomonas monteilii SB3101 | ||||
| gm0601 | 81 | Pseudomonas mosselii SJ10 | ||||
| 1 | gm0602 | 77 | Pseudomonas parafulva CRS01-1 | |||
| 1 | gm0603 | 73 | Pseudomonas plecoglossicida NyZ12 | |||
| 1 | gm0604 | 65 | Pseudomonas poae RE1-1-14 | |||
| 1 | gm0605 | 72 | Pseudomonas protegens Cab57 | |||
| gm0606 | 73 | Pseudomonas protegens CHA0 | ||||
| gm0607 | 74 | Pseudomonas protegens Pf-5 | ||||
| 1 | gm0608 | 69 | Pseudomonas pseudoalcaligenes | |||
| gm0609 | 69 | Pseudomonas pseudoalcaligenes CECT 5344 CECT5344 | ||||
| 1 | gm0610 | 66 | Pseudomonas putida BIRD-1 | |||
| gm0611 | 74 | Pseudomonas putida DLL-E4 | ||||
| gm0612 | 62 | Pseudomonas putida DOT-T1E | ||||
| gm0613 | 76 | Pseudomonas putida F1 | ||||
| gm0614 | 76 | Pseudomonas putida GB-1 | ||||
| gm0615 | 70 | Pseudomonas putida H8234 | ||||
| gm0616 | 72 | Pseudomonas putida HB3267 PC9 | ||||
| gm0617 | 76 | Pseudomonas putida KT2440 | ||||
| gm0618 | 75 | Pseudomonas putida NBRC 14164 | ||||
| gm0619 | 76 | Pseudomonas putida ND6 | ||||
| gm0620 | 61 | Pseudomonas putida S12 | ||||
| gm0621 | 69 | Pseudomonas putida S16 | ||||
| gm0622 | 77 | Pseudomonas putida W619 | ||||
| 1 | gm0623 | 74 | Pseudomonas resinovorans NBRC 106553 | |||
| 1 | gm0624 | 72 | Pseudomonas rhizosphaerae DSM 16299 | |||
| 1 | gm0625 | 66 | Pseudomonas savastanoi pv. phaseolicola 1448A BAA-978 | |||
| 1 | gm0626 | 65 | Pseudomonas simiae WCS417 | |||
| 1 | gm0627 | 55 | Pseudomonas sp. 20 BN | |||
| 1 | gm0628 | 75 | Pseudomonas sp. FGI182 | |||
| 1 | gm0629 | 77 | Pseudomonas sp. MRSN12121 | |||
| 1 | gm0630 | 59 | Pseudomonas sp. MT-1 | |||
| 1 | gm0631 | 72 | Pseudomonas sp. StFLB209 | |||
| 1 | gm0632 | 68 | Pseudomonas sp. TKP | |||
| 1 | gm0633 | 72 | Pseudomonas sp. UW4 | |||
| 1 | gm0634 | 83 | Pseudomonas sp. VLB120 | |||
| 1 | gm0635 | 76 | Pseudomonas sp. WCS374 | |||
| 1 | gm0636 | 63 | Pseudomonas stutzeri 19SMN4 | |||
| gm0637 | 61 | Pseudomonas stutzeri 28a24 | ||||
| gm0638 | 62 | Pseudomonas stutzeri A1501 | ||||
| gm0639 | 61 | Pseudomonas stutzeri ATCC 17588 LMG 11199 | ||||
| gm0640 | 64 | Pseudomonas stutzeri CCUG 29243 | ||||
| gm0641 | 62 | Pseudomonas stutzeri DSM 10701 | ||||
| gm0642 | 62 | Pseudomonas stutzeri DSM 4166 | ||||
| gm0643 | 63 | Pseudomonas stutzeri RCH2 | ||||
| 1 | gm0644 | 63 | Pseudomonas syringae CC1557 | |||
| gm0645 | 66 | Pseudomonas syringae pv. syringae B728a | ||||
| gm0646 | 69 | Pseudomonas syringae pv. tomato str. DC3000 | ||||
| 1 | gm0647 | 50 | Pseudoxanthomonas spadix BD-a59 | |||
| 1 | gm0648 | 52 | Pseudoxanthomonas suwonensis 11-1 | |||
| gm0649 | 48 | Pseudoxanthomonas suwonensis J1 | ||||
| 1 | gm0650 | 50 | Psychrobacter arcticus 273-4 | |||
| 1 | gm0651 | 49 | Psychrobacter cryohalolentis K5 | |||
| 1 | gm0652 | 49 | Psychrobacter sp. G | |||
| 1 | gm0653 | 61 | Psychrobacter sp. PRwf-1 | |||
| 1 | gm0654 | 86 | Psychromonas ingrahamii 37 | |||
| 1 | gm0655 | 92 | Psychromonas sp. CNPT3 | |||
| 1 | gm0656 | 77 | Rahnella aquatilis CIP 78.65 ATCC 33071 | |||
| gm0657 | 77 | Rahnella aquatilis HX2 | ||||
| 1 | gm0658 | 77 | Rahnella sp. Y9602 | |||
| 1 | gm0659 | 80 | Raoultella ornithinolytica B6 | |||
| gm0660 | 86 | Raoultella ornithinolytica S12 | ||||
| 1 | gm0661 | 51 | Rhodanobacter denitrificans 2APBS1 | |||
| 1 | gm0662 | 41 | Saccharophagus degradans 2-40 | |||
| 1 | gm0663 | 88 | Salmonella bongori N268-08 | |||
| gm0664 | 88 | Salmonella bongori NCTC 12419 | ||||
| gm0665 | 84 | Salmonella bongori serovar 48 z41 -- str. RKS3044 | ||||
| 1 | 877 | 1 | gm0666 | 83 | Salmonella enterica subsp. arizonae serovar 62 z36 str. RKS2983 | |
| gm0667 | 88 | Salmonella enterica subsp. arizonae serovar 62 z4 z23 RSK2980 | ||||
| gm0668 | 91 | Salmonella enterica subsp. enterica serovar 4 5 12 i str. 08-1736 | ||||
| gm0669 | 85 | Salmonella enterica subsp. enterica serovar Abaetetuba str. ATCC 35640 | ||||
| gm0670 | 89 | Salmonella enterica subsp. enterica serovar Abony str. 0014 | ||||
| gm0671 | 87 | Salmonella enterica subsp. enterica serovar Agona str. 24249 | ||||
| gm0672 | 87 | Salmonella enterica subsp. enterica serovar Agona str. 460004 2-1 | ||||
| gm0673 | 87 | Salmonella enterica subsp. enterica serovar Agona str. SL483 | ||||
| gm0674 | 85 | Salmonella enterica subsp. enterica serovar Anatum str. ATCC BAA-1592 | ||||
| gm0675 | 86 | Salmonella enterica subsp. enterica serovar Anatum str. CDC 06-0532 | ||||
| gm0676 | 83 | Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1175 | ||||
| gm0677 | 86 | Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 | ||||
| gm0678 | 77 | Salmonella enterica subsp. enterica serovar Bovismorbificans str. 3114 | ||||
| gm0679 | 87 | Salmonella enterica subsp. enterica serovar Bredeney str. CFSAN001080 | ||||
| gm0680 | 86 | Salmonella enterica subsp. enterica serovar Choleraesuis C500 | ||||
| gm0681 | 89 | Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 | ||||
| gm0682 | 88 | Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 | ||||
| gm0683 | 81 | Salmonella enterica subsp. enterica serovar Dublin | ||||
| gm0684 | 87 | Salmonella enterica subsp. enterica serovar Dublin str. CT 02021853 | ||||
| gm0685 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis Durban | ||||
| gm0686 | 88 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1 | ||||
| gm0687 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE10-10052 | ||||
| gm0688 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE11-10058 | ||||
| gm0689 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE2-98984-6 | ||||
| gm0690 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE3-98983-4 | ||||
| gm0691 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE4-0317-8 | ||||
| gm0692 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE5-1104-2 | ||||
| gm0693 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE6-00219-16 | ||||
| gm0694 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE7-100819 | ||||
| gm0695 | 84 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE8-1021710 | ||||
| gm0696 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE9-10012 | ||||
| gm0697 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis SEJ | ||||
| gm0698 | 90 | Salmonella enterica subsp. enterica serovar Enteritidis str. 77-1427 | ||||
| gm0699 | 89 | Salmonella enterica subsp. enterica serovar Enteritidis str. CDC 2010K 0968 CDC 2010K-0968 | ||||
| gm0700 | 89 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090135 | ||||
| gm0701 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090193 | ||||
| gm0702 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090195 | ||||
| gm0703 | 88 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090332 | ||||
| gm0704 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090530 | ||||
| gm0705 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090531 | ||||
| gm0706 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090641 | ||||
| gm0707 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090698 | ||||
| gm0708 | 84 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090884 | ||||
| gm0709 | 78 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100088 | ||||
| gm0710 | 78 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100089 | ||||
| gm0711 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100100 | ||||
| gm0712 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100101 | ||||
| gm0713 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100103 | ||||
| gm0714 | 84 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100130 | ||||
| gm0715 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100131 | ||||
| gm0716 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100134 | ||||
| gm0717 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100325 | ||||
| gm0718 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110221 | ||||
| gm0719 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110222 | ||||
| gm0720 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110223 | ||||
| gm0721 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110353 | ||||
| gm0722 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110354 | ||||
| gm0723 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110355 | ||||
| gm0724 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110356 | ||||
| gm0725 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110357 | ||||
| gm0726 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110358 | ||||
| gm0727 | 85 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110359 | ||||
| gm0728 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110360 | ||||
| gm0729 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110361 | ||||
| gm0730 | 88 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111095 | ||||
| gm0731 | 89 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111174 | ||||
| gm0732 | 88 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111175 | ||||
| gm0733 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111510 | ||||
| gm0734 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111514 | ||||
| gm0735 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111515 | ||||
| gm0736 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111554 | ||||
| gm0737 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111561 | ||||
| gm0738 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111576 | ||||
| gm0739 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120002 | ||||
| gm0740 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120003 | ||||
| gm0741 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120005 | ||||
| gm0742 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120007 | ||||
| gm0743 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120008 | ||||
| gm0744 | 77 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120009 | ||||
| gm0745 | 79 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120051 | ||||
| gm0746 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120200 | ||||
| gm0747 | 72 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120213 | ||||
| gm0748 | 79 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120219 | ||||
| gm0749 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120229 | ||||
| gm0750 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120240 | ||||
| gm0751 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120356 | ||||
| gm0752 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120469 | ||||
| gm0753 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120496 | ||||
| gm0754 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120497 | ||||
| gm0755 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120498 | ||||
| gm0756 | 76 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120505 | ||||
| gm0757 | 75 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120528 | ||||
| gm0758 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120544 | ||||
| gm0759 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120548 | ||||
| gm0760 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120555 | ||||
| gm0761 | 75 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120580 | ||||
| gm0762 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120581 | ||||
| gm0763 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120590 | ||||
| gm0764 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120597 | ||||
| gm0765 | 63 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120677 | ||||
| gm0766 | 76 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120685 | ||||
| gm0767 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120686 | ||||
| gm0768 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120687 | ||||
| gm0769 | 64 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120697 | ||||
| gm0770 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120722 | ||||
| gm0771 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120734 | ||||
| gm0772 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120738 | ||||
| gm0773 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120765 | ||||
| gm0774 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120773 | ||||
| gm0775 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120774 | ||||
| gm0776 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120775 | ||||
| gm0777 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120776 | ||||
| gm0778 | 89 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120916 | ||||
| gm0779 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120917 | ||||
| gm0780 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120918 | ||||
| gm0781 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120925 | ||||
| gm0782 | 78 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120927 | ||||
| gm0783 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120929 | ||||
| gm0784 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120963 | ||||
| gm0785 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120968 | ||||
| gm0786 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120969 | ||||
| gm0787 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120970 | ||||
| gm0788 | 74 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120994 | ||||
| gm0789 | 43 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121004 | ||||
| gm0790 | 88 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121175 | ||||
| gm0791 | 90 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121176 | ||||
| gm0792 | 92 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121177 | ||||
| gm0793 | 93 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121178 | ||||
| gm0794 | 95 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121179 | ||||
| gm0795 | 93 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121180 | ||||
| gm0796 | 61 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121541 | ||||
| gm0797 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121542 | ||||
| gm0798 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121671 | ||||
| gm0799 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121672 | ||||
| gm0800 | 78 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121689 | ||||
| gm0801 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121744 | ||||
| gm0802 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121746 | ||||
| gm0803 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121747 | ||||
| gm0804 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121748 | ||||
| gm0805 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121750 | ||||
| gm0806 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121751 | ||||
| gm0807 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121753 | ||||
| gm0808 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121765 | ||||
| gm0809 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121812 | ||||
| gm0810 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121825 | ||||
| gm0811 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121826 | ||||
| gm0812 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121969 | ||||
| gm0813 | 79 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121970 | ||||
| gm0814 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121976 | ||||
| gm0815 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121986 | ||||
| gm0816 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121989 | ||||
| gm0817 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121990 | ||||
| gm0818 | 79 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122022 | ||||
| gm0819 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122026 | ||||
| gm0820 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122031 | ||||
| gm0821 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122033 | ||||
| gm0822 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122045 | ||||
| gm0823 | 86 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130345 | ||||
| gm0824 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130346 | ||||
| gm0825 | 64 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130347 | ||||
| gm0826 | 79 | Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130348 | ||||
| gm0827 | 87 | Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 | ||||
| gm0828 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19930684 | ||||
| gm0829 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19940857 | ||||
| gm0830 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19942384 | ||||
| gm0831 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19943269 | ||||
| gm0832 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19960848 | ||||
| gm0833 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19961622 | ||||
| gm0834 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970510 | ||||
| gm0835 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970769 | ||||
| gm0836 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19971331 | ||||
| gm0837 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19980677 | ||||
| gm0838 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981522 | ||||
| gm0839 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981857 | ||||
| gm0840 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19982831 | ||||
| gm0841 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19983126 | ||||
| gm0842 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19992322 | ||||
| gm0843 | 73 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA19994216 | ||||
| gm0844 | 59 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20082034 | ||||
| gm0845 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083456 | ||||
| gm0846 | 82 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083636 | ||||
| gm0847 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084384 | ||||
| gm0848 | 76 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084644 | ||||
| gm0849 | 71 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084824 | ||||
| gm0850 | 48 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20085285 | ||||
| gm0851 | 47 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090419 | ||||
| gm0852 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090435 | ||||
| gm0853 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090877 | ||||
| gm0854 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20091739 | ||||
| gm0855 | 102 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20092320 | ||||
| gm0856 | 102 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093266 | ||||
| gm0857 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093421 | ||||
| gm0858 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093430 | ||||
| gm0859 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093538 | ||||
| gm0860 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093543 | ||||
| gm0861 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093784 | ||||
| gm0862 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093788 | ||||
| gm0863 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093950 | ||||
| gm0864 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093977 | ||||
| gm0865 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094079 | ||||
| gm0866 | 74 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094177 | ||||
| gm0867 | 71 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094301 | ||||
| gm0868 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094350 | ||||
| gm0869 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094352 | ||||
| gm0870 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094383 | ||||
| gm0871 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094389 | ||||
| gm0872 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094521 | ||||
| gm0873 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094642 | ||||
| gm0874 | 81 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094682 | ||||
| gm0875 | 84 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094803 | ||||
| gm0876 | 83 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095309 | ||||
| gm0877 | 68 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095440 | ||||
| gm0878 | 47 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100239 | ||||
| gm0879 | 65 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100349 | ||||
| gm0880 | 77 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20121703 | ||||
| gm0881 | 80 | Salmonella enterica subsp. enterica serovar Enteritidis str. SA20123395 | ||||
| gm0882 | 79 | Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 | ||||
| gm0883 | 78 | Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67 | ||||
| gm0884 | 75 | Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 | ||||
| gm0885 | 89 | Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 | ||||
| gm0886 | 88 | Salmonella enterica subsp. enterica serovar Heidelberg str. B182 | ||||
| gm0887 | 88 | Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 | ||||
| gm0888 | 88 | Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 | ||||
| gm0889 | 89 | Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 | ||||
| gm0890 | 86 | Salmonella enterica subsp. enterica serovar Infantis 1326/28 | ||||
| gm0891 | 88 | Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992 | ||||
| gm0892 | 88 | Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20 | ||||
| gm0893 | 86 | Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1903 | ||||
| gm0894 | 86 | Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1921 | ||||
| gm0895 | 87 | Salmonella enterica subsp. enterica serovar Newport str. CDC 2010K-2159 | ||||
| gm0896 | 89 | Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 | ||||
| gm0897 | 90 | Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 | ||||
| gm0898 | 87 | Salmonella enterica subsp. enterica serovar Newport str. CVM 21554 | ||||
| gm0899 | 91 | Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 | ||||
| gm0900 | 91 | Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 | ||||
| gm0901 | 89 | Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 | ||||
| gm0902 | 89 | Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 | ||||
| gm0903 | 86 | Salmonella enterica subsp. enterica serovar Newport str. CVM N18486 | ||||
| gm0904 | 89 | Salmonella enterica subsp. enterica serovar Newport str. SL254 | ||||
| gm0905 | 88 | Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1927 | ||||
| gm0906 | 92 | Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1 | ||||
| gm0907 | 103 | Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50503 | ||||
| gm0908 | 105 | Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50973 | ||||
| gm0909 | 86 | Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU 12601 AKU12601 | ||||
| gm0910 | 87 | Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 | ||||
| gm0911 | 87 | Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 SGSC4150 | ||||
| gm0912 | 87 | Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594 | ||||
| gm0913 | 72 | Salmonella enterica subsp. enterica serovar Pullorum | ||||
| gm0914 | 81 | Salmonella enterica subsp. enterica serovar Pullorum str. S06004 | ||||
| gm0915 | 87 | Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 | ||||
| gm0916 | 88 | Salmonella enterica subsp. enterica serovar Tennessee str. TXSC TXSC08-19 | ||||
| gm0917 | 82 | Salmonella enterica subsp. enterica serovar Thompson str. RM6836 | ||||
| gm0918 | 83 | Salmonella enterica subsp. enterica serovar Typhi str. CT18 | ||||
| gm0919 | 81 | Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 | ||||
| gm0920 | 81 | Salmonella enterica subsp. enterica serovar Typhi str. Ty2 | ||||
| gm0921 | 81 | Salmonella enterica subsp. enterica serovar Typhi str. Ty21a | ||||
| gm0922 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium 138736 | ||||
| gm0923 | 88 | Salmonella enterica subsp. enterica serovar Typhimurium ATCC 13311 | ||||
| gm0924 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S | ||||
| gm0925 | 87 | Salmonella enterica subsp. enterica serovar Typhimurium str. 798 | ||||
| gm0926 | 87 | Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-0870 | ||||
| gm0927 | 93 | Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 | ||||
| gm0928 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 | ||||
| gm0929 | 87 | Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 | ||||
| gm0930 | 90 | Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 | ||||
| gm0931 | 88 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 | ||||
| gm0932 | 90 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | ||||
| gm0933 | 90 | Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 | ||||
| gm0934 | 88 | Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 | ||||
| gm0935 | 87 | Salmonella enterica subsp. enterica serovar Typhimurium str. U288 | ||||
| gm0936 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 | ||||
| gm0937 | 90 | Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 | ||||
| gm0938 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921 | ||||
| gm0939 | 89 | Salmonella enterica subsp. enterica serovar Typhimurium VNP20009 | ||||
| 1 | gm0940 | 40 | secondary endosymbiont of Ctenarytaina eucalypti | |||
| 1 | gm0941 | 38 | secondary endosymbiont of Heteropsylla cubana | |||
| 1 | 877 | 1 | gm0942 | 87 | Serratia liquefaciens ATCC 27592 | |
| gm0943 | 88 | Serratia liquefaciens HUMV-21 | ||||
| 1 | gm0944 | 85 | Serratia marcescens FGI94 | |||
| gm0945 | 90 | Serratia marcescens SM39 | ||||
| gm0946 | 90 | Serratia marcescens subsp. marcescens Db11 | ||||
| gm0947 | 84 | Serratia marcescens WW4 | ||||
| 1 | gm0948 | 82 | Serratia multitudinisentens RB-25 | |||
| 1 | gm0949 | 83 | Serratia plymuthica 4Rx13 | |||
| gm0950 | 88 | Serratia plymuthica AS9 | ||||
| gm0951 | 85 | Serratia plymuthica RVH1 | ||||
| gm0952 | 87 | Serratia plymuthica S13 | ||||
| gm0953 | 67 | Serratia plymuthica V4 | ||||
| 1 | gm0954 | 87 | Serratia proteamaculans 568 | |||
| 1 | gm0955 | 88 | Serratia sp. AS12 | |||
| 1 | gm0956 | 88 | Serratia sp. AS13 | |||
| 1 | gm0957 | 93 | Serratia sp. FS14 | |||
| 1 | gm0958 | 84 | Serratia sp. SCBI | |||
| 1 | gm0959 | 36 | Serratia symbiotica str. Cinara cedri | |||
| 1 | gm0960 | 102 | Shewanella amazonensis SB2B | |||
| 1 | gm0961 | 110 | Shewanella baltica BA175 | |||
| gm0962 | 100 | Shewanella baltica OS117 | ||||
| gm0963 | 122 | Shewanella baltica OS155 | ||||
| gm0964 | 109 | Shewanella baltica OS185 | ||||
| gm0965 | 109 | Shewanella baltica OS195 | ||||
| gm0966 | 112 | Shewanella baltica OS223 | ||||
| gm0967 | 107 | Shewanella baltica OS678 | ||||
| 1 | gm0968 | 97 | Shewanella denitrificans OS217 | |||
| 1 | gm0969 | 99 | Shewanella frigidimarina NCIMB 400 | |||
| 1 | gm0970 | 128 | Shewanella halifaxensis HAW-EB4 | |||
| 1 | gm0971 | 102 | Shewanella loihica PV-4 | |||
| 1 | gm0972 | 106 | Shewanella oneidensis MR-1 | |||
| 1 | 12,11,11 | 1 | gm0973 | 149 | Shewanella pealeana ATCC 700345 | |
| 1 | gm0974 | 94 | Shewanella piezotolerans WP3 | |||
| 1 | gm0975 | 102 | Shewanella putrefaciens 200 | |||
| gm0976 | 103 | Shewanella putrefaciens CN-32 | ||||
| 1 | gm0977 | 134 | Shewanella sediminis HAW-EB3 | |||
| 1 | gm0978 | 108 | Shewanella sp. ANA-3 | |||
| 1 | gm0979 | 105 | Shewanella sp. MR-4 | |||
| 1 | gm0980 | 107 | Shewanella sp. MR-7 | |||
| 1 | gm0981 | 101 | Shewanella sp. W3-18-1 | |||
| 1 | gm0982 | 133 | Shewanella violacea DSS12 | |||
| 1 | gm0983 | 134 | Shewanella woodyi ATCC 51908 | |||
| 1 | 877 | 1 | gm0984 | 103 | Shigella boydii CDC 3083-94 BS512 | |
| gm0985 | 94 | Shigella boydii Sb227 | ||||
| 1 | gm0986 | 88 | Shigella dysenteriae 1617 | |||
| gm0987 | 87 | Shigella dysenteriae Sd197 | ||||
| 1 | gm0988 | 99 | Shigella flexneri | |||
| gm0989 | 104 | Shigella flexneri 2002017 | ||||
| gm0990 | 99 | Shigella flexneri 2003036 | ||||
| gm0991 | 103 | Shigella flexneri 2a str. 2457T | ||||
| gm0992 | 100 | Shigella flexneri 2a str. 301 | ||||
| gm0993 | 99 | Shigella flexneri 5 str. 8401 | ||||
| gm0994 | 100 | Shigella flexneri Shi06HN006 | ||||
| 1 | gm0995 | 98 | Shigella sonnei 53G | |||
| gm0996 | 98 | Shigella sonnei Ss046 | ||||
| 1 | gm0997 | 90 | Shimwellia blattae DSM 4481 NBRC 105725 | |||
| 1 | gm0998 | 42 | Simiduia agarivorans SA1 DSM 21679 | |||
| 1 | gm0999 | 76 | Sodalis glossinidius str. morsitans | |||
| 1 | gm1000 | 78 | Sodalis praecaptivus HS1 | |||
| 1 | gm1001 | 46 | Spiribacter salinus M19-40 | |||
| 1 | gm1002 | 46 | Spiribacter sp. UAH-SP71 | |||
| 1 | 322 | 1 | gm1003 | 71 | Stenotrophomonas maltophilia 13637 | |
| gm1004 | 77 | Stenotrophomonas maltophilia D457 | ||||
| gm1005 | 75 | Stenotrophomonas maltophilia JV3 | ||||
| gm1006 | 76 | Stenotrophomonas maltophilia K279a | ||||
| gm1007 | 74 | Stenotrophomonas maltophilia R551-3 | ||||
| 1 | gm1008 | 67 | Stenotrophomonas rhizophila DSM14405 | |||
| 1 | gm1009 | 89 | synthetic Escherichia coli C321.deltaA | |||
| 1 | gm1010 | 47 | Tatlockia micdadei ATCC33218 | |||
| 1 | gm1011 | 41 | Teredinibacter turnerae T7901 | |||
| 1 | gm1012 | 51 | Thalassolituus oleivorans MIL-1 | |||
| gm1013 | 49 | Thalassolituus oleivorans R6-15 | ||||
| 1 | gm1014 | 43 | Thioalkalimicrobium aerophilum AL3 | |||
| 1 | gm1015 | 41 | Thioalkalimicrobium cyclicum ALM1 | |||
| 1 | gm1016 | 46 | Thioalkalivibrio nitratireducens DSM 14787 | |||
| 1 | gm1017 | 49 | Thioalkalivibrio sp. K90mix | |||
| 1 | gm1018 | 45 | Thioalkalivibrio sulfidiphilus HL-EbGr7 HL-EbGR7 | |||
| 1 | gm1019 | 48 | Thioalkalivibrio thiocyanoxidans ARh 4 | |||
| 1 | gm1020 | 53 | Thiocystis violascens DSM 198 | |||
| 1 | gm1021 | 48 | Thioflavicoccus mobilis 8321 | |||
| 1 | gm1022 | 40 | Thiolapillus brandeum Hiromi 1 | |||
| 1 | gm1023 | 45 | Thiomicrospira crunogena XCL-2 | |||
| 1 | gm1024 | 45 | Thioploca ingrica | |||
| 1 | gm1025 | 92 | Tolumonas auensis DSM 9187 | |||
| 1 | gm1026 | 106 | Vibrio alginolyticus NBRC 15630 ATCC 17749 | |||
| 1 | gm1027 | 87 | Vibrio anguillarum 775 | |||
| gm1028 | 94 | Vibrio anguillarum NB10 | ||||
| 1 | gm1029 | 96 | Vibrio campbellii ATCC BAA-1116 | |||
| gm1030 | 121 | Vibrio campbellii ATCC BAA-1116 BB120 | ||||
| 1 | gm1031 | 94 | Vibrio cholerae 10432-62 | |||
| gm1032 | 104 | Vibrio cholerae 1154-74 | ||||
| gm1033 | 99 | Vibrio cholerae 2012EL-2176 | ||||
| gm1034 | 81 | Vibrio cholerae H1 | ||||
| gm1035 | 98 | Vibrio cholerae IEC224 | ||||
| gm1036 | 95 | Vibrio cholerae LMA3984-4 | ||||
| gm1037 | 97 | Vibrio cholerae M66-2 | ||||
| gm1038 | 98 | Vibrio cholerae MJ-1236 | ||||
| gm1039 | 90 | Vibrio cholerae MS6 | ||||
| gm1040 | 94 | Vibrio cholerae O1 biovar El Tor FJ147 | ||||
| gm1041 | 98 | Vibrio cholerae O1 biovar El Tor str. N16961 | ||||
| gm1042 | 79 | Vibrio cholerae O1 str. 2010EL-1786 | ||||
| 2*96 | gm1043 | 192 | Vibrio cholerae O395 | |||
| 1 | gm1044 | 87 | Vibrio coralliilyticus OCN014 | |||
| gm1045 | 117 | Vibrio coralliilyticus RE98 | ||||
| 1 | gm1046 | 100 | Vibrio furnissii NCTC 11218 | |||
| 1 | gm1047 | 104 | Vibrio nigripulchritudo SFn1 | |||
| 1 | 12,11,11 | 1 | gm1048 | 126 | Vibrio parahaemolyticus BB22OP | |
| 1 | gm1049 | 130 | Vibrio parahaemolyticus O1 K33 str. CDC K4557 | |||
| gm1050 | 131 | Vibrio parahaemolyticus O1 Kuk str. FDA R31 | ||||
| gm1051 | 127 | Vibrio parahaemolyticus RIMD 2210633 O3 K6 substr. RIMD 2210633 | ||||
| gm1052 | 122 | Vibrio parahaemolyticus UCM-V493 | ||||
| 1 | gm1053 | 121 | Vibrio sp. EJY3 | |||
| 1 | gm1054 | 125 | Vibrio sp. Ex25 EX25 | |||
| 1 | gm1055 | 114 | Vibrio tasmaniensis LGP32 | |||
| 1 | gm1056 | 118 | Vibrio tubiashii ATCC 19109 | |||
| 1 | gm1057 | 109 | Vibrio vulnificus 93U204 | |||
| gm1058 | 113 | Vibrio vulnificus CMCP6 | ||||
| gm1059 | 114 | Vibrio vulnificus MO6-24/O | ||||
| gm1060 | 113 | Vibrio vulnificus YJ016 | ||||
| 1 | gm1061 | 34 | Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis | |||
| 1 | gm1062 | 53 | Xanthomonas albilineans GPE PC73 | |||
| 1 | gm1063 | 55 | Xanthomonas axonopodis pv. citri str. 306 | |||
| gm1064 | 54 | Xanthomonas axonopodis pv. citrumelo F1 | ||||
| gm1065 | 55 | Xanthomonas axonopodis Xac29-1 | ||||
| 1 | 222 | 1 | gm1066 | 55 | Xanthomonas campestris 17 | |
| gm1067 | 55 | Xanthomonas campestris pv. campestris B100 | ||||
| gm1068 | 57 | Xanthomonas campestris pv. campestris str. 8004 | ||||
| gm1069 | 58 | Xanthomonas campestris pv. campestris str. ATCC 33913 | ||||
| gm1070 | 58 | Xanthomonas campestris pv. raphani 756C | ||||
| gm1071 | 59 | Xanthomonas campestris pv. vesicatoria str. 85-10 | ||||
| 1 | 222 | 1 | gm1072 | 55 | Xanthomonas citri subsp. citri 5208 | |
| gm1073 | 55 | Xanthomonas citri subsp. citri A306 | ||||
| gm1074 | 57 | Xanthomonas citri subsp. citri Aw12879 | ||||
| gm1075 | 57 | Xanthomonas citri subsp. citri AW13 | ||||
| gm1076 | 57 | Xanthomonas citri subsp. citri AW14 | ||||
| gm1077 | 57 | Xanthomonas citri subsp. citri AW15 | ||||
| gm1078 | 57 | Xanthomonas citri subsp. citri AW16 | ||||
| gm1079 | 55 | Xanthomonas citri subsp. citri BL18 | ||||
| gm1080 | 55 | Xanthomonas citri subsp. citri FB19 | ||||
| gm1081 | 55 | Xanthomonas citri subsp. citri gd2 | ||||
| gm1082 | 55 | Xanthomonas citri subsp. citri gd3 | ||||
| gm1083 | 55 | Xanthomonas citri subsp. citri jx4 | ||||
| gm1084 | 55 | Xanthomonas citri subsp. citri jx5 | ||||
| gm1085 | 55 | Xanthomonas citri subsp. citri mf20 | ||||
| gm1086 | 55 | Xanthomonas citri subsp. citri MN10 | ||||
| gm1087 | 55 | Xanthomonas citri subsp. citri MN11 | ||||
| gm1088 | 55 | Xanthomonas citri subsp. citri MN12 | ||||
| gm1089 | 55 | Xanthomonas citri subsp. citri NT17 | ||||
| gm1090 | 55 | Xanthomonas citri subsp. citri UI6 | ||||
| gm1091 | 55 | Xanthomonas citri subsp. citri UI7 | ||||
| 1 | gm1092 | 55 | Xanthomonas fuscans subsp. fuscans 4834-R | |||
| 1 | gm1093 | 55 | Xanthomonas oryzae pv. oryzae KACC 10331 KACC10331 | |||
| gm1094 | 54 | Xanthomonas oryzae pv. oryzae MAFF 311018 | ||||
| gm1095 | 54 | Xanthomonas oryzae pv. oryzae PXO86 | ||||
| gm1096 | 55 | Xanthomonas oryzae pv. oryzae PXO99A | ||||
| gm1097 | 54 | Xanthomonas oryzae pv. oryzicola BLS256 | ||||
| gm1098 | 57 | Xanthomonas oryzae pv. oryzicola CFBP7342 | ||||
| 1 | gm1099 | 57 | Xanthomonas sacchari R1 | |||
| 1 | 877 | 1 | gm1100 | 82 | Xenorhabdus bovienii CS03 | |
| gm1101 | 88 | Xenorhabdus bovienii SS-2004 | ||||
| 1 | gm1102 | 79 | Xenorhabdus doucetiae FRM16 | |||
| 1 | gm1103 | 81 | Xenorhabdus nematophila AN6/1 | |||
| gm1104 | 81 | Xenorhabdus nematophila ATCC 19061 | ||||
| 1 | gm1105 | 80 | Xenorhabdus poinarii G6 | |||
| 1 | 222 | 1 | gm1106 | 53 | Xylella fastidiosa 9a5c | |
| gm1107 | 52 | Xylella fastidiosa M12 | ||||
| gm1108 | 50 | Xylella fastidiosa M23 | ||||
| gm1109 | 50 | Xylella fastidiosa MUL0034 | ||||
| gm1110 | 49 | Xylella fastidiosa subsp. fastidiosa GB514 | ||||
| gm1111 | 55 | Xylella fastidiosa subsp. sandyi Ann-1 | ||||
| gm1112 | 49 | Xylella fastidiosa Temecula1 | ||||
| 1 | gm1113 | 84 | Yersinia aldovae 670-83 | |||
| 1 | gm1114 | 79 | Yersinia enterocolitica 2516-87 | |||
| 877 | 1 | gm1115 | 85 | Yersinia enterocolitica 8081 | ||
| gm1116 | 83 | Yersinia enterocolitica subsp. enterocolitica 8081 | ||||
| gm1117 | 73 | Yersinia enterocolitica subsp. palearctica 105.5Rr | ||||
| gm1118 | 72 | Yersinia enterocolitica subsp. palearctica Y11 | ||||
| gm1119 | 79 | Yersinia enterocolitica type O 5 str. YE53/03 | ||||
| gm1120 | 86 | Yersinia enterocolitica WA | ||||
| 1 | gm1121 | 86 | Yersinia frederiksenii Y225 | |||
| 1 | gm1122 | 82 | Yersinia intermedia Y228 | |||
| 1 | gm1123 | 85 | Yersinia kristensenii ATCC 33639 | |||
| gm1124 | 85 | Yersinia kristensenii Y231 | ||||
| 1 | gm1125 | 140 | Yersinia pestis A1122 | |||
| gm1126 | 141 | Yersinia pestis Angola | ||||
| gm1127 | 142 | Yersinia pestis Antiqua | ||||
| 877 | 1 | gm1128 | 73 | Yersinia pestis biovar Medievalis str. Harbin 35 | ||
| gm1129 | 73 | Yersinia pestis biovar Microtus str. 91001 | ||||
| gm1130 | 71 | Yersinia pestis CO92 | ||||
| gm1131 | 71 | Yersinia pestis D106004 | ||||
| gm1132 | 74 | Yersinia pestis D182038 | ||||
| gm1133 | 72 | Yersinia pestis Dodson | ||||
| gm1134 | 70 | Yersinia pestis El Dorado | ||||
| gm1135 | 71 | Yersinia pestis Harbin35 | ||||
| gm1136 | 72 | Yersinia pestis Java9 | ||||
| gm1137 | 74 | Yersinia pestis KIM10+ | ||||
| gm1138 | 75 | Yersinia pestis KIM5 | ||||
| gm1139 | 72 | Yersinia pestis Nairobi | ||||
| gm1140 | 73 | Yersinia pestis Nepal516 | ||||
| gm1141 | 73 | Yersinia pestis Nicholisk 41 | ||||
| gm1142 | 72 | Yersinia pestis PBM19 | ||||
| 73+74 | gm1143 | 147 | Yersinia pestis Pestoides F | |||
| gm1144 | 74 | Yersinia pestis Pestoides G | ||||
| gm1145 | 71 | Yersinia pestis Shasta | ||||
| gm1146 | 74 | Yersinia pestis str. Pestoides B | ||||
| gm1147 | 69 | Yersinia pestis Z176003 | ||||
| 1 | gm1148 | 83 | Yersinia pseudotuberculosis 1 | |||
| 877 | 1 | gm1149 | 82 | Yersinia pseudotuberculosis ATCC 6904 | ||
| gm1150 | 84 | Yersinia pseudotuberculosis EP2/+ | ||||
| gm1151 | 87 | Yersinia pseudotuberculosis IP 31758 | ||||
| gm1152 | 87 | Yersinia pseudotuberculosis IP 32953 | ||||
| gm1153 | 87 | Yersinia pseudotuberculosis IP 32953 IP32953 | ||||
| gm1154 | 86 | Yersinia pseudotuberculosis MD67 | ||||
| gm1155 | 170 | Yersinia pseudotuberculosis PB1/+ | ||||
| gm1156 | 88 | Yersinia pseudotuberculosis str. PA3606 Pa3606 | ||||
| 2*85 | gm1157 | 170 | Yersinia pseudotuberculosis YPIII | |||
| 1 | gm1158 | 82 | Yersinia rohdei YRA | |||
| 1 | gm1159 | 84 | Yersinia ruckeri Big Creek 74 | |||
| gm1160 | 82 | Yersinia ruckeri YRB | ||||
| 1 | gm1161 | 88 | Yersinia similis 228 |
Alpha[modifier | modifier le wikicode]
alpha blocs[modifier | modifier le wikicode]
- Lien tableur: alpha blocs
- Légende:
| lien | blocs | 16s | total aas | avec | sans | total page | alf001-34 | Notes | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| alf001 | 5*16atcgca235-atgf | 9 | 60 | 15 | 45 | 16-atcgca-35 | 16-gcaatc-35 | 16-atc-35 | 16-gca-35 | 16, 235 | |||
| alf010 | 2*16atcgca235-atgf | 48 | 6 | 42 | sans | 16 | incomplets | ||||||
| alf011 | 2*16atcgca235-atgf | 48 | 6 | 42 | atgf | 30 | 2*16s23s | ||||||
| 4 | autres 1-3 | 1 | 16atcgca23 | ||||||||||
| alf012 | 3*16atcgca-cds-23-cds-5-atgf | 55 | 12 | 43 | cds | 3 | autres 1-3 | ||||||
| 16atcgca-cds-cds-23-cds-5-atgf | cds, atgf | 13 | 16atcgca235-cgg | ||||||||||
| 63 | total | 60 | 0 | 3 | différents | ||||||||
| alf013 | 3*16atcgca235-atgf | 56 | 9 | 47 | 3*16atcgca-cds-23-cds-5-atgf | ||||||||
| 3 | 16atcgca-cds-cds-23-cds-5-atgf | ||||||||||||
| alf014 agr | 5*16atcgca-cds-23-5-atgf | 58 | 15 | 43 | |||||||||
| 5 | |||||||||||||
| alf015 | 4*16atcgca-cds-23-5-atgf | 57 | 15 | 42 | |||||||||
| 16atcgca23-5-atgf | 5 | ||||||||||||
| alf017 | 4*16atcgca235-atgf | 56 | 12 | 44 | |||||||||
| 4 | |||||||||||||
| alf020 | 16s-cds, 23s-5s | 37 | 0 | 37 | |||||||||
| alf021 | 16s-cds, 23s-5s | 3 | 35 | 0 | 35 | ||||||||
| alf025 | 16s-cds-cds, 23s-5s | 37 | 0 | 37 | |||||||||
| alf029 | 2*16atcgca235-atgf | 51 | 9 | 42 | |||||||||
| 16atcgca235-cgg | 3 | ||||||||||||
| alf030 | 3*16atcgca235 | 54 | 6 | 48 | |||||||||
| 3 | |||||||||||||
| alf031 abq | 5*16atcgca235 | 88 | 21 | 67 | |||||||||
| 3*16atcgca235-atgf | 9 | ||||||||||||
| 16atcgca23 | |||||||||||||
| alf033 | 4*16atcgca235-atgf | 83 | 20 | 63 | |||||||||
| 4*16atcgca235 | 9 | ||||||||||||
| 16s23s | |||||||||||||
| alf034 | 4*16atcgca235-atgf | 9 | 84 | 20 | 64 | ||||||||
| 4*16atcgca235 | |||||||||||||
| 16s23s | 66 | ||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | alf035-159 | Notes | |||||
| alf035 | 2*16atcgca235-atgf | 10 | 43 | 6 | 37 | 16-atcgca-35 | 16-gcaatc-35 | 16-atc-35 | 16-gca-35 | 16, 235 | |||
| alf036 | 2*16atcgca235-atgf | 45 | 6 | 39 | sans | 13 | 2 | ||||||
| alf037 | 2*16atcgca235-atgf | 42 | 6 | 36 | atgf | 19 | 8 | ||||||
| alf038 | 2*16atcgca-cds-235-atgf | 43 | 6 | 37 | autres 1-3 | ||||||||
| alf039 | 2*16atcgca235-atgf | 43 | 6 | 37 | cds | 1 | |||||||
| cds, atgf | 14 | ||||||||||||
| alf043 | 2*16atcgca-cds-235-atgf | 4 | 43 | 6 | 37 | 57 | total | 46 | 9 | 2 | |||
| alf044 | 2*16atcgca-cds-235-atgf | 43 | 6 | 37 | |||||||||
| alf046 | 2*16atcgca-cds-235-atgf | 8 | 43 | 6 | 37 | ||||||||
| alf047 | 3*16atcgca235-atgf | 54 | 9 | 45 | |||||||||
| alf048 | 16atcgca235 | 60 | 2 | 58 | |||||||||
| alf049 | 2*16atcgca235 | 64 | 4 | 60 | |||||||||
| alf052 | 2*16atcgca235 | 12 | 57 | 4 | 53 | ||||||||
| alf053 | 2*16atcgca235 | 56 | 4 | 52 | |||||||||
| alf054 | 2*16atcgca235 | 52 | 4 | 48 | |||||||||
| alf055 | 16atcgca235 | 50 | 2 | 48 | |||||||||
| alf056 | 2*16atcgca235-atgf | 49 | 6 | 43 | |||||||||
| alf057 | 3*16atcgca-cds-235-atgf | 55 | 9 | 46 | |||||||||
| alf071 | 3*16atcgca-cds-235-atgf | 11 | 55 | 9 | 46 | ||||||||
| alf105 | 16-gca-atc-235-atgf | 42 | 3 | 39 | |||||||||
| alf111 | 3*16-gca-atc-235-atgf | 46 | 9 | 37 | |||||||||
| alf117 | 2*16atcgca235 | 43 | 4 | 39 | |||||||||
| alf123 | 2*16atcgca235-atgf | 52 | 6 | 46 | |||||||||
| alf130 | 16s, 23s5s | 2 | 36 | 0 | 36 | ||||||||
| alf131 | 16s, 23s5s | 37 | 0 | 37 | |||||||||
| alf146 | 4*16atcgca235-atgf | 5 | 60 | 12 | 48 | ||||||||
| alf159 | 16atcgca235 | 53 | 2 | 51 | |||||||||
| alf162 | 4*16-gca-atc-235-atgf | 5 | 58 | 14 | 44 | ||||||||
| 16-gca-atc-cds-235 | 57 | ||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | alf166-317 | Notes | |||||
| alf166 | 5*16-gca-atc-235-atgf | 7 | 66 | 15 | 51 | 16-atcgca-35 | 16-gcaatc-35 | 16-atc-35 | 16-gca-35 | 16, 235 | |||
| alf174 | 2*16atcgca235-atgf | 55 | 6 | 49 | sans | 10 | 2 | 2 | différents | ||||
| atgf | 35 | 9 | 16atcgca23-cds-5-atgf | ||||||||||
| alf187 | 4*16atcgca235-atgf | 6 | 72 | 14 | 58 | autres 1-3 | |||||||
| 2*16-gca-235 | cds | ||||||||||||
| cds, atgf | 4 | ||||||||||||
| alf198 | 16atcgca235 | 16 | 58 | 2 | 56 | 62 | total | 49 | 9 | 2 | 2 | ||
| alf202 | 3*16atcgca235-atgf | 59 | 9 | 50 | |||||||||
| alf203 oan | 4*16atcgca-cds-235-atgf | 61 | 12 | 49 | |||||||||
| alf212 | 4*16atcgca235-atgf | 62 | 12 | 50 | |||||||||
| alf218 | 4*16-gca-atc-235-atgf | 61 | 12 | 49 | |||||||||
| alf223 | 4*16atcgca235 | 6 | 70 | 14 | 56 | ||||||||
| 2*16atcgca235-atgf | |||||||||||||
| alf224 | 3*16atcgca235-atgf | 3 | 54 | 9 | 45 | ||||||||
| alf298 rtb | 16s,235s | 2 | 33 | 0 | 33 | ||||||||
| alf301 | 16s,235s | 39 | 0 | 39 | |||||||||
| alf303 | 16atcgca235 | 5 | 38 | 2 | 36 | ||||||||
| alf304 | 16atcgca235 | 38 | 2 | 36 | |||||||||
| alf305 | 2*16atcgca235-atgf | 54 | 8 | 46 | |||||||||
| 16atcgca235 | |||||||||||||
| alf306 | 5*16atcgca235-atgf | 5 | 64 | 15 | 49 | ||||||||
| alf307 | 2*16atcgca235-atgf | 3 | 56 | 9 | 47 | ||||||||
| 16atcgca23-cds-5-atgf | |||||||||||||
| alf308 | 3*16atcgca235-atgf | 6 | 56 | 9 | 47 | ||||||||
| alf309 | 3*16atcgca235-atgf | 56 | 9 | 47 | |||||||||
| alf317 | 2*16atcgca235 | 3 | 62 | 7 | 55 | ||||||||
| 16atcgca235-atgf | 62 | ||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | alf321-343 | Notes | |||||
| alf321 | 2*16atcgca235 | 3 | 63 | 7 | 56 | 16-atcgca-35 | 16-gcaatc-35 | 16-atc-35 | 16-gca-35 | 16, 235 | |||
| 16atcgca235-atgf | sans | 5 | 0 | 1 | |||||||||
| atgf | 8 | 4 | |||||||||||
| alf326 | 16atcgca235-atgf | 1 | 47 | 3 | 44 | autres 1-3 | |||||||
| cds | |||||||||||||
| alf329 | 3*16atcgca235-atgf | 4 | 61 | 11 | 50 | cds, atgf | |||||||
| 16atcgca235 | 18 | total | 13 | 0 | 4 | 0 | 1 | ||||||
| alf330 | 4*16-atc-235-atgf | 7 | 58 | 8 | 50 | ||||||||
| alf331 | 16s,235s | 34 | 0 | 34 | |||||||||
| alf341 | 2*16atcgca235 | 55 | 4 | 51 | |||||||||
| alf343 | 3*16atcgca235-atgf | 3 | 52 | 9 | 43 | ||||||||
| 18 | |||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | total | Notes | |||||
| 70 | 16-atcgca-35 | 16-gcaatc-35 | 16-atc-35 | 16-gca-35 | 16, 235 | incomplets | |||||||
| sans | 44 | 0 | 0 | 2 | 5 | 2*16s23s | |||||||
| Total | 3715 | 525 | 3190 | atgf | 92 | 17 | 4 | 0 | 0 | 16atcgca23 | |||
| Moyenne | 53 | 8 | 46 | autres 1-3 | 1 | 0 | 0 | 0 | 0 | autres 1-3 | |||
| ecartype | 11 | 5 | 8 | cds | 0 | 1 | 0 | 0 | 3 | 16atcgca235-cgg | |||
| max | 88 | 21 | 67 | cds, atgf | 31 | 0 | 0 | 0 | 0 | différents | |||
| min | 33 | 0 | 33 | 200 | total | 168 | 18 | 4 | 2 | 8 | 3*16atcgca-cds-23-cds-5-atgf | ||
| 16atcgca-cds-cds-23-cds-5-atgf | |||||||||||||
| 16atcgca-23-cds-5-atgf |
alpha notes[modifier | modifier le wikicode]
- Lien tableur: alpha notes
- Légende:
- Notes du tableau des blocs, pour mémoire, les génomes étudiés ont très peu de variations et d'altérations
- - incomplets 2*16s23s 16atcgca23
- - Autres 1-3 16atcgca235-cgg
- - différents
- 3*16atcgca-cds-23-cds-5-atgf
- 16atcgca-cds-cds-23-cds-5-atgf
- 16atcgca-23-cds-5-atgf
alpha typage[modifier | modifier le wikicode]
alpha type 16-y-235 après 16s[modifier | modifier le wikicode]
- Lien tableur: alpha type 16-y-235 après 16s
- Légende:
- - atcgca-cds° contient un 16atcgca-cds-cds-23-cds-5-atgf
- - 16s, 235 supposés être des 16s23s5s puisqu'ils sont les seuls dans le génome.
| 16s-y-23s5s | tableau | incomplets | 16s, 235 | total | % |
| 16s23s5s | 0 | 2 | 8 | 10 | 4,9 |
| atcgca | 137 | 1 | 138 | 67 | |
| gcaatc | 17 | 17 | 8 | ||
| gca | 4 | 4 | 2,0 | ||
| atc | 2 | 2 | 1,0 | ||
| atcgca-cds° | 31 | 31 | 16 | ||
| gcaatc-cds | 1 | 1 | 0,5 | ||
| total | 192 | 3 | 8 | 203 | 100 |
alpha type 16235-z après 5s[modifier | modifier le wikicode]
- Lien tableur: alpha type 16235-z après 5s
- Légende:
- Noice: 5 blocs ont un cds entre 23s et 5s. En général l'intercalaire 23s-5s est relativement constant dans un génom et même en général. A comparer donc ces cds à ces intercalaires.
| 16s23s5s-z | sans | atgf | cgg | 23s-cds-5s-atgf | total |
|---|---|---|---|---|---|
| tableau | 47 | 139 | 1 | 5 | 192 |
| % | 24,5 | 72,4 | 0,5 | 2,6 | 100 |
alpha type x-16235 avant 16s[modifier | modifier le wikicode]
- Lien tableur: alpha type x-16235 avant 16s
- Légende:
- Note: Il n'y a pas de blocs du type x-16s23s5s.
alpha gamma typage[modifier | modifier le wikicode]
- Lien tableur: alpha gamma typage
- Légende:
- Notes: Pour les effectifs voir alpha blocs, les totaux de fin pour alpha, et gamma type 16235-z après 5s pour gamma et z,z'.
- - Pour alpha les 10 blocs 16s,23s5s sont considérés comme tel et n'ont pas donc de z.
- - Pour alpha les cds sont considérés comme des intercalaires.
| après 16s | |||||||
|---|---|---|---|---|---|---|---|
| 16-y-235-z | 16s23s5s | atcgca | gcaatc | gaa | autres | total | % |
| gamma | |||||||
| sans z | 58 | 238 | 14 | 160 | 37 | 507 | 72 |
| avec z | 17 | 85 | 0 | 78 | 17 | 197 | 28 |
| total | 75 | 323 | 14 | 238 | 54 | 704 | |
| % | 11 | 46 | 2 | 34 | 8 | ||
| alpha | |||||||
| sans z | 0 | 44 | 1 | 0 | 10 | 55 | 27.5 |
| avec z | 0 | 124 | 17 | 0 | 4 | 145 | 72.5 |
| total | 0 | 168 | 18 | 0 | 14 | 200 | |
| % | 0 | 84 | 9 | 0 | 7 | ||
| après 5s | |||||||
| 16-235-z,z' | gac-tgg | gac | acc-5s | atgf | autres | total | |
| gamma | 66 | 80 | 46 | 0 | 26 | 218 | |
| % | 30 | 37 | 21 | 0 | 12 | ||
| alpha | 0 | 0 | 0 | 144 | 1 | 145 | |
| % | 0 | 0 | 0 | 99 | 1 | ||
alpha typage cds[modifier | modifier le wikicode]
- Lien tableur: alpha typage cds
- Légende:
- - date NCBI, c'est la date relevée sur le NCBI au moment du prélèvement de l'adresse lors de la publication de ce tableau, c.a.d le 26.1.20. Seuls alf015 043 203 ont fait défaut. Les exceptions (*): Pour alf043 j’avais prélevé le 1.9.19 juste la séquence de cds, avant la date de NCBI du 5.1.20. Pour alf203 j'ai repris les adresses de oan opérons du 27.12.19 avant la date de NCBI du 5.1.20. Pour alf015 j'ai pu récupérer l’adresse du 1.9.19 comme pour alf043.
- - génome, code du tableau des noms alpha
- - cds, le nom du cds dans le bloc à rRNAs, c12 pour 2ème cds du 1er bloc situé sur le chromosome circulaire (c) ou bien l12, l pour chromosome linéaire.
- - après RNA, gca cp, c'est le cds qui se trouve juste après le tRNA gca et cp pour dire que le sens du cds est différent de celui du bloc. Dans la plupart des cas les RNAs du bloc ont le même sens (complement ou direct). En gras et souligné sont les exceptions de ce tableau où tous les cds après un tRNA (gca atc) changent de sens et tous les cds apès un rRNA (16s 23s) ne changent pas de sens. Il y a aussi le cas de 2 cds successifs, le 2ème a, dans la colonne "après RNA", cds qui n'est pas un RNA. C'est le cas de al012. Alf020 21 25, les cds se trouvent après 16s. Comme le bloc est divisé en 16s et 23s5s, j'ai supposé que les 2 tRNAs atc-gca, hypothétiques, ont disparus. Ces cds ne sont pas hypothétiques mais ont des tailles comparables aux hp, hypothetical protéine, de la colonne "séquence aas".
- - séquence en aas: La longueur des séquences des hp ne permet pas de les afficher ici. On les trouve dans le tableur, voir le lien ci-dessus.
- - P-hp pour pseudo hp, NCBI ne donne pas leur traduction.
- Notes du 20.7.20, disparitions
- - alf12: il y a les séquences du 30.01.2014 dans[1] AE007869.2 qui contiennent les adresses du tableau ci-dessous et celles du[2] 10.03.2020 où ces adresses ont disparues.
- - alf14: 12.04.2020 rien, ancien du 30.01.2014[3] a les cds mais avec des adresses décalées recherche sur " trna ".
- - alf15 disparus à maj 18.6.20 comme alf62 à maj 2.2.20 comme alf307 à maj 4.4.20.
- - Puis ok pour ceux de 2019 ayant gardé la même mise à jour. alf44 ok avec maj du 20.5.20, alf57 ok du 4.4.20, alf71 ok du 18.6.20
- - aua disparu même si maj de 2019 (le chromosome. Le plasmide ok voir et pau20rrn [2].
| date NCBI | génome | sens | adresse | cds | après RNA | aas | égale en aas | séquence aas |
|---|---|---|---|---|---|---|---|---|
| 03/08/16 | alf12 | comp | 59238..59627 | c11 | gca cp | 129 | c11=c22 | hp |
| 62235..62492 | c12 | 23s | 85 | c12=c23 | hp | |||
| 2516197..2516583 | c21 | gca cp | 128 | hp | ||||
| 2515743..2516132 | c22 | cds cp | 129 | hp | ||||
| comp | 2512878..2513135 | c23 | 23s | 85 | hp | |||
| comp | 1044310..1044699 | l11 | gca cp | 129 | c11=l11 | hp | ||
| 1047307..1047564 | l12 | 23s | 85 | c12=l12 | hp | |||
| comp | 1306725..1307114 | l21 | gca cp | 129 | hp | |||
| 1309700..1309999 | l22 | 23s | 99 | hp | ||||
| 26/08/19 | alf14 agr | comp | <59429..59626 | c11 | gca cp | 66 | P-hp | |
| 2496166..>2496363 | c21 | gca cp | 67 | P-hp | ||||
| comp | <1429429..1429626 | l11 | gca cp | 68 | P-hp | |||
| comp | <1690307..1690504 | l21 | gca cp | 69 | P-hp | |||
| comp | <2105696..2105893 | l31 | gca cp | 70 | P-hp | |||
| 07/01/20 | alf15 | comp | <59347..59592 | c11 | gca cp | 82 | P-hp | |
| 2508109..2508427 | c21 | gca cp | 106 | P-hp | ||||
| comp | <1122642..1122887 | l11 | gca cp | 82 | P-hp | |||
| *01/09/2019 | avant | ? | 2044048..2044367 | l21 | gca | - | P-hp | |
| 25/08/19 | alf020 | comp | 1001462..1001845 | c11 | 16s | 127 | sdhC | hp |
| comp | 1001115..1001450 | c12 | cds | 111 | sdhD | hp | ||
| 27/08/19 | alf021 | 249441..249824 | c11 | 16s | 127 | sdhC | hp | |
| 249836..250165 | c12 | cds | 109 | sdhD | hp | |||
| 29/11/19 | alf025 | comp | 1055653..1056036 | c11 | 16s | 127 | sdhC | hp |
| comp | 1055320..1055649 | c12 | cds | 109 | sdhD | hp | ||
| 25/08/19 | alf038 | 1751403..1751597 | c11 | gca cp | 64 | c11=c21 | hp | |
| 1896294..1896488 | c21 | gca cp | 64 | hp | ||||
| *01/09/2019 | alf043 | - | c11 | gca | 72 | c11=c21 | hp | |
| 05/01/20 | néant | - | c21 | gca | 72 | hp | ||
| 08/08/19 | alf044 | comp | 1854849..1855037 | c11 | gca | 62 | c11=c21 | hp |
| comp | 2061198..2061386 | c21 | gca | 62 | hp | |||
| 26/08/19 | alf046 | 1353691..1353915 | c11 | gca cp | 74 | c11=c21 | hp | |
| 1496257..1496481 | c21 | gca cp | 74 | hp | ||||
| 24/12/19 | alf057 | 1602851..1603093 | c11 | gca cp | 80 | c11=c21 | hp | |
| 1806931..1807173 | c21 | gca cp | 80 | c11=c31 | hp | |||
| 1057289..1057531 | c31 | gca cp | 80 | hp | ||||
| alf057=alf071 | ||||||||
| 30/03/17 | alf071 | 1586714..1586956 | c11 | gca cp | 80 | c11=c21 | hp | |
| 1791119..1791361 | c21 | gca cp | 80 | c11=c31 | hp | |||
| 1106853..1107095 | c31 | gca cp | 80 | hp | ||||
| 18/12/14 | alf162 | 1548251..1548361 | c11 | atc cp | 36 | hp | ||
| *27/12/2019 | alf203 oan | comp | 1085980..>1086168 | c11 | gca cp | 63 | P-hp | |
| 05/01/20 | néant | comp | 1348203..>1348391 | c21 | gca cp | 63 | P-hp | |
| comp | 458785..>458973 | c31 | gca cp | 63 | P-hp | |||
| <1601419..1601607 | c41 | gca cp | 63 | P-hp | ||||
| 27/07/17 | alf307 | comp | 3626306..3626473 | c11 | 23s cp | 55 | hp | |
| 28/08/19 | aua | 4501..4851 | c11 | gca cp | 76 | hp |
alpha typage absence de cds[modifier | modifier le wikicode]
- Lien tableur: alpha typage absence de cds
- Légende:
- alf014 agr 28/08/19: Les 4 comp sont identiques (exact()), commencent par atg et se terminent par ttt qui n’est pas un stop. Le c21 est de même longueur, 198 pbs, mais je ne l'ai pas retourné pour comparer.
comp <59429..59626 c11 2496166..>2496363 c21 comp <1429429..1429626 l11 comp <1690307..1690504 l21 comp <2105696..2105893 l31 l11 1429381 gcctgtgtgg gtggattgat cggtaagttg aatatccttt tgaagaaa*aa aaacgtttgc 1429441 atcgttcgca aggactgatg cctgttctga atacattgtg aagagaagat atgtctggaa 1429501 gcgtccaggt gttttgggtt tatgcctgaa acgtccgaga ccaatccttg tgaaaccatg 1429561 tgatggctta gtcggccgga attggtggag gggttggagg taggaaggat cgcttgtccg 1429621 aggcat*tttt gttgttggag catttgctcc tctgatggga atgctggatt gatgttgcct l21 1690261 ctgtgtgggt ggattgatcg gtaagttgaa tatccttttg aagaaa*aaaa acgtttgcat 1690321 cgttcgcaag gactgatgcc tgttctgaat acattgtgaa gagaagatat gtctggaagc 1690381 gtccaggtgt tttgggttta tgcctgaaac gtccgagacc aatccttgtg aaaccatgtg 1690441 atggcttagt cggccggaat tggtggaggg gttggaggta ggaaggatcg cttgtccgag 1690501 gcat*ttttgt tgttggagca tttgctcctc tgatgggaat gctggattga tgttgcctga l31 2105641 cctatcggcc tgtgtgggtg gattgatcgg taagttgaat atccttttga agaaa*aaaaa 2105701 cgtttgcatc gttcgcaagg actgatgcct gttctgaata cattgtgaag agaagatatg 2105761 tctggaagcg tccaggtgtt ttgggtttat gcctgaaacg tccgagacca atccttgtga 2105821 aaccatgtga tggcttagtc ggccggaatt ggtggagggg ttggaggtag gaaggatcgc 2105881 ttgtccgagg cat*ttttgtt gttggagcat ttgctcctct gatgggaatg ctggattgat c11 59401 cggtaagttg aatatccttt tgaagaaa*aa aaacgtttgc atcgttcgca aggactgatg 59461 cctgttctga atacattgtg aagagaagat atgtctggaa gcgtccaggt gttttgggtt 59521 tatgcctgaa acgtccgaga ccaatccttg tgaaaccatg tgatggctta gtcggccgga 59581 attggtggag gggttggagg taggaaggat cgcttgtccg aggcat*tttt gttgttggag c21 2496121 caatccagca ttcccatcag aggagcaaat gctccaacaa caaaa*atgcc tcggacaagc 2496181 gatccttcct acctccaacc cctccaccaa ttccggccga ctaagccatc acatggtttc 2496241 acaaggattg gtctcggacg tttcaggcat aaacccaaaa cacctggacg cttccagaca 2496301 tatcttctct tcacaatgta ttcagaacag gcatcagtcc ttgcgaacga tgcaaacgtt 2496361 ttt*tttcttc aaaaggatat tcaacttacc gatcaatcca cccacacagg ccgataggcc
- alf203 oan 05/01/20: Les 3 comp sont identiques (exact()), commencent par tat qui n'est pas Met et se terminent par tga qui est un stop. Le c41 est de même longueur, 189 pbs, mais je ne l'ai pas retourné pour comparer.
comp 1085980..>1086168 c11 comp 1348203..>1348391 c21 comp 458785..>458973 c31 <1601419..1601607 c41 c11 1085881 tgggagagca cctgctttgc aagcaggggg tcgtcggttc gatcccgtct ggctccacca 1085941 tcactttttt ggtgtcgagt aggacggata gacagtcag*t caacaagaga aagaaccaag 1086001 tttgcggact ttacgaagtc tgcgtgttct gtatgaaatc gtgaagagaa gatgtaatcg 1086061 gatcaactat ccagttgatg tcgcaatggt ttgctcaaac cttgcattat gattggacgc 1086121 taaccgcgcc accgattgta tctcgagaag ctggtctttc tgctgata*tg atcagagctt c21 1348141 ttcgatcccg tctggctcca ccatcacttt tttggtgtcg agtaggacgg atagacagtc 1348201 ag*tcaacaag agaaagaacc aagtttgcgg actttacgaa gtctgcgtgt tctgtatgaa 1348261 atcgtgaaga gaagatgtaa tcggatcaac tatccagttg atgtcgcaat ggtttgctca 1348321 aaccttgcat tatgattgga cgctaaccgc gccaccgatt gtatctcgag aagctggtct 1348381 ttctgctgat a*tgatcagag cttaatgctt tgatggatat tggcaatgag agtgatcaag c31 458701 tttgcaagca gggggtcgtc ggttcgatcc cgtctggctc caccatcact tttttggtgt 458761 cgagtaggac ggatagacag tcag*tcaaca agagaaagaa ccaagtttgc ggactttacg 458821 aagtctgcgt gttctgtatg aaatcgtgaa gagaagatgt aatcggatca actatccagt 458881 tgatgtcgca atggtttgct caaaccttgc attatgattg gacgctaacc gcgccaccga 458941 ttgtatctcg agaagctggt ctttctgctg ata*tgatcag agcttaatgc tttgatggat c41 1601341 caaggcatcc accaaatgcc cttaagacac ttgatcactc tcattgccaa tatccatcaa 1601401 agcattaagc tctgatca*ta tcagcagaaa gaccagcttc tcgagataca atcggtggcg 1601461 cggttagcgt ccaatcataa tgcaaggttt gagcaaacca ttgcgacatc aactggatag 1601521 ttgatccgat tacatcttct cttcacgatt tcatacagaa cacgcagact tcgtaaagtc 1601581 cgcaaacttg gttctttctc ttgttga*ctg actgtctatc cgtcctactc gacaccaaaa
- alf036 28/11/19: Le 1.9.19 j'avais relevé les adresses et les séquences de 2 cds particuliers par leurs séquences. NCBI ne les montrent plus le 28/11/19. Je les ai retrouvées mais la Met du début est remplacée par att.Voici les séquences en 1.9.19:
cds1 adresse 257745..257999, intercalaire avec atgf d'adresse 257437..257513: 231 pbs
MVACIPKSKRSTLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSNWRFTD
cds2 comp 1107699..1107995, intercalaire avec atgf d'adresse 1108279..1108355: 283 pbs
MLYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLFSILYSLIGASLIKHW
- -- Les intercalaires du 28/11/19
| sens | adresse | gène | intercal | aas | protéines |
|---|---|---|---|---|---|
| comp | <250713..250865 | cds | 1022 | 51 | transcriptional repressor |
| 251888..253381 | 16s | 315 | 1494 | ||
| 253697..253773 | atc | 122 | |||
| 253896..253971 | gca | 305 | |||
| 254277..257097 | 23s | 96 | 2821 | ||
| 257194..257308 | 5s | 128 | 115 | ||
| 257437..257513 | atgf | 1208 | |||
| 258722..259111 | cds | 130 | hp | ||
| comp | 1106662..1107051 | cds | 1227 | 130 | hp |
| comp | 1108279..1108355 | atgf | 128 | ||
| comp | 1108484..1108598 | 5s | 96 | 115 | |
| comp | 1108695..1111515 | 23s | 305 | 2821 | |
| comp | 1111821..1111896 | gca | 122 | ||
| comp | 1112019..1112095 | atc | 315 | ||
| comp | 1112411..1113904 | 16s | 1022 | 1494 | |
| 1114927..1115313 | cds | 129 | transcriptional repressor |
- -- Les séquences NCBI du 28/11/19
Après verification le M (atg) d’avant est devenu att le 28/11/19. Et taa est stop. 257745..257999 257701 tttctcattg tataaatact gagtataaat actgatttcc agaa*attgtt gcttgcatac 257761 ctaaaagcaa aagaagcacc ttattctcta ttctctattc tctattctct attctctatt 257821 ctctattctc tattctctat tctctattct ctattctcta ttctctattc tctattctct 257881 attctctatt ctctattctc tattctctat tctctattct ctattctcta ttctctattc 257941 tctattctct attctctatt ctctattctc tattctctaa ttggcgcttc actgattaa*a 258001 cactggtaac cgaaaaatta aattttatat tttatactag ggacgtagct taccttgagc comp 1107699..1107995 1107661 tacgtcccta gtataaaata taaaatttaa tttttcggtt accagtgt*tt a atcagtgaa 1107721 gcgccaatta gagaatagag aatagagaat agagaataga gaatagagaa tagagaatag 1107781 agaatagaga atagagaata gagaatagag aatagagaat agagaataga gaatagagaa 1107841 tagagaatag agaatagaga atagagaata gagaatagag aatagagaat agagaataga 1107901 gaatagagaa tagagaatag agaatagaga atagagaata gagaatagag aatagagaat 1107961 agagaataga gaatagagaa tagagaatag agaat*agaga atagagaata aggtgcttct 1108021 tttgctttta ggtatgcaag caacaatttc tggaaatcag tatttatact cagtatttat 1108081 acaatgagaa agtaccccac aagctgagat gttgatgaaa gagagctgca cacacccttg 1108141 tagggacttg gttttggtgt aggggcttgg ttttggggag cagaacgcca atgttaaaca
alpha typage cds et intercalaires[modifier | modifier le wikicode]
- Lien tableur: alpha typage cds et intercalaires
- Légende:
| génome | 16s-aa1 | aa2-23s | 16s-23s | n blocs | type | lien | notes |
|---|---|---|---|---|---|---|---|
| alpha typage, cds et intercalaires | |||||||
| alf036 | 315 | 305 | _ | 2 | atc-gca | alf036 | * |
| alf254 rru | 184 | 362 | _ | 4 | atc-gca | rru | * |
| alf031 abq | 94-110 | 254-266 | _ | 8 | atc-gca | abq | * |
| “ | _ | _ | 262 | 1 | 16s-23s | ||
| alf032 abs | 107-110 | 269-272 | _ | 4 | atc-gca | abs | * |
| alf253 rpm | 112 | 212-216 | _ | 6 | atc | rpm | * |
| “ | 182 | 196 | _ | 1 | gca | * | |
| alf203 oan | 268 | 266 | _ | 4 | atc-gca cds | oan | 0 cds |
| alf014 agr | 337 | 585 | _ | 5 | atc-gca cds | agr | 0 cds |
| aua | 236 | 478 | _ | 1 | atc-gca cds | aua | ok |
| * | |||||||
| gamma typage, cds et intercalaires | |||||||
| spl | _ | _ | 338-374 | 8 | atc-gca | spl | * |
| “ | 71 | 329-364 | _ | 3 | atc-gca | * | |
| vpb | 80 | 257 | _ | 1 | gaa, gta | vpb | * |
| “ | 80 | 253-312 | _ | 3 | gaa, gta cds | 0 cds | |
| “ | 80 | 258 | _ | 1 | gaa | * | |
| “ | 88 | 258 | _ | 1 | gcc-gaa | * | |
| “ | 56 | 257 | _ | 2 | atc-gca | * | |
| “ | _ | _ | 261 | 3 | 16s-23s | * | |
| eal | 85 | 198 | _ | 4 | gaa | eal | * |
| “ | 68-70 | 186 | _ | 3 | atc-gca | * | |
| eco | 68 | 174-183 | _ | 3 | atc-gca | eco | * |
| “ | 85 | 193 | _ | 2 | gaa | * | |
| “ | 171 | 184-193 | _ | 2 | gaa | * | |
| vha | 97 | 265-290 | _ | 4 | atc-gca cds | vha | 0/3 cds |
| “ | 56 | 290 | _ | 1 | atc-gca | * | |
| “ | 82 | 310 | _ | 1 | gaa, gta | * | |
| “ | 114-122 | 253-310 | _ | 3 | gaa, gta cds | * | |
| “ | 129 | 257 | _ | 1 | gcc-gaa cds | * | |
| amed | 66 | 231 | _ | 3 | atc-gca | amed | * |
| “ | 192-268 | 229-245 | _ | 6 | gaa | * | |
| * | |||||||
| bacilli typage, cds et intercalaires | |||||||
| bsu | _ | _ | 164-167 | 13 | 16s-23s | bsu | * |
| “ | 99 | 81 | _ | 2 | atc-gca | * | |
| lmo | _ | _ | 244 | 6 | 16s-23s | lmo | * |
| “ | 127 | 172 | _ | 2 | atc-gca | * | |
| lam | _ | _ | 192 | 2 | 16s-23s cds | lam | 0 cds |
| “ | 125 | 115 | _ | 2 | atc-gca | * | |
| ppm | _ | _ | 207-221 | 6 | 16s-23s | ppm | * |
| “ | _ | _ | 280-400 | 4 | 16s-23s | * | |
| “ | 93-108 | 128 | _ | 2 | 5s-atc-gca | * | |
| “ | 89 | 185 | _ | 1 | gca | * | |
| pmq | _ | _ | 248-269 | 14 | 16s-23s | pmq | * |
| lbu | _ | _ | 208 | 4 | 16s-23s | lbu | * |
| “ | 105 | 126 | _ | 5 | atc-gca | * | |
| ban | _ | _ | 141 | 7 | 16s-23s | ban | * |
| “ | _ | _ | 153-173 | 2 | 16s-23s | * | |
| “ | 130 | 77 | _ | 2 | atc-gca | * | |
| clostridia typage, cds et intercalaires | |||||||
| psor | _ | _ | 196 | 9 | 16s-23s | psor | * |
| “ | _ | _ | 137 | 1 | 16s-23s | * | |
| “ | 54 | 114 | _ | 4 | gca | * | |
| “ | 109-123 | 95-152 | _ | 3 | gca | * | |
| cdc | _ | _ | 279-320 | 5 | 16s-23s | cdc | * |
| “ | _ | _ | 184-217 | 2 | 16s-23s | * | |
| “ | 52-68 | 249-373 | _ | 3 | gca | * | |
| cdc8 | _ | _ | 261-321 | 5 | 16s-23s | cdc8 | * |
| “ | _ | _ | 184-217 | 2 | 16s-23s | * | |
| cbc | _ | _ | 228 | 4 | 16s-23s | cbc | * |
| cbn | _ | _ | 233 | 8 | 16s-23s | cbn | * |
| “ | 74-121 | 96 | _ | 2 | gca-atc | * | |
| cle | 196* | 262-282 | _ | 4 | 5s-gca* | cle | * |
| “ | 262* | 258 | _ | 1 | 5s-atc* | * | |
| “ | 196* | 261 | _ | 2 | 5s-atc-gca* | * | |
| hmo | 508* | 233 | _ | 3 | 5s-gcc* | hmo | * |
| “ | 433* | 233 | _ | 2 | 5s-gcc* | * | |
| “ | 432* | 141-194 | _ | 2 | 5s-atc* | * | |
| “ | 433* | 229 | _ | 1 | 5s-atc-gca* | * | |
| “ | 508* | 236 | _ | 1 | 5s-atc-gca* | * | |
| “ | _ | _ | 569 | 1 | 5s-16s-23s | * | |
| cbei | _ | _ | 339 | 7 | 16s-23s | cbei | * |
| “ | _ | _ | 502-578 | 3 | 16s-23s | * | |
| “ | _ | _ | 214 | 3 | 16s-23s | * | |
| “ | 140 | 111 | _ | 1 | gca-atc | * | |
| “ | 132 | 84 | _ | 1 | atc | * | |
| “ | 137 | 118 | _ | 1 | gca | * | |
Tableau des noms alpha[modifier | modifier le wikicode]
- Lien tableur: Tableau des noms alpha
- Légende:
- - rupture, un seul génome est choisi parmi ceux portant le même nom défini par ses 2 1ers qualificatifs. Le total de ces génomes est de 189 indiqué au bas du tableau.
- - fait, les génomes que j'ai étudié ici pour les blocs à rRNAs. J'en ai fait ici 70 sur les 189 définis par leur nom de rupture.
- - notes, concerne des remarques souvent sur le nombre de tRNAs par génome qui, suivant la méthode de prélèvement que j'ai utilisée, est quelques fois le total de plusieurs échantillons du même génome. Il suffit de le verifier dans la base gtRNAdb.
- - rRNAs: c'est la présentation de NCBI, x y z, pour x 5s y 16s et z 23s.
- - code: utilisé dans alpha blocs.
- Notes: 348 génomes alphaproteobacteria avec 17165 tRNAs, prélèvement fait vers le 20.8.19 à partir de la base de données gtRNAdb [3]
| ruptures | notes | rRNAs | fait | code | tRNAs | génomes |
|---|---|---|---|---|---|---|
| 1 | 555 | 1 | alf001 | 60 | Acetobacter pasteurianus 386B | |
| alf002 | 60 | Acetobacter pasteurianus IFO 3283-01 IFO 3283 substr. IFO 3283-01 | ||||
| alf003 | 57 | Acetobacter pasteurianus IFO 3283-01-42C IFO 3283 substr. IFO 3283-01-42C | ||||
| alf004 | 60 | Acetobacter pasteurianus IFO 3283-03 IFO 3283 substr. IFO 3283-03 | ||||
| alf005 | 60 | Acetobacter pasteurianus IFO 3283-07 IFO 3283 substr. IFO 3283-07 | ||||
| alf006 | 60 | Acetobacter pasteurianus IFO 3283-12 IFO 3283 substr. IFO 3283-12 | ||||
| alf007 | 60 | Acetobacter pasteurianus IFO 3283-22 IFO 3283 substr. IFO 3283-22 | ||||
| alf008 | 60 | Acetobacter pasteurianus IFO 3283-26 IFO 3283 substr. IFO 3283-26 | ||||
| alf009 | 60 | Acetobacter pasteurianus IFO 3283-32 IFO 3283 substr. IFO 3283-32 | ||||
| 1 | 222 | 1 | alf010 | 48 | Acidiphilium cryptum JF-5 | |
| 1 | 222 | 1 | alf011 | 48 | Acidiphilium multivorum AIU301 | |
| 1 | 444 | 1 | alf012 | 55 | Agrobacterium fabrum str. C58 | |
| 1 | 333 | 1 | alf013 | 56 | Agrobacterium radiobacter K84 | |
| 1 | agr | 555 | 1 | alf014 | 58 | Agrobacterium sp. H13-3 |
| 1 | 555 | 1 | alf015 | 57 | Agrobacterium tumefaciens Ach5 | |
| alf016 | 57 | Agrobacterium tumefaciens LBA4213 Ach5 | ||||
| 1 | 444 | 1 | alf017 | 56 | Agrobacterium vitis S4 | |
| 1 | - | alf018 | 32 | alpha proteobacterium HIMB5 | ||
| 1 | - | alf019 | 35 | alpha proteobacterium HIMB59 | ||
| 1 | 111 | 1 | alf020 | 37 | Anaplasma centrale str. Israel | |
| 1 | 111 | 1 | alf021 | 35 | Anaplasma marginale str. Dawn | |
| alf022 | 37 | Anaplasma marginale str. Florida | ||||
| alf023 | 37 | Anaplasma marginale str. Gypsy Plains | ||||
| alf024 | 37 | Anaplasma marginale str. St. Maries | ||||
| 1 | 111 | 1 | alf025 | 37 | Anaplasma phagocytophilum str. Dog2 | |
| alf026 | 37 | Anaplasma phagocytophilum str. HZ | ||||
| alf027 | 37 | Anaplasma phagocytophilum str. HZ2 | ||||
| alf028 | 37 | Anaplasma phagocytophilum str. JM | ||||
| 1 | 333 | 1 | alf029 | 51 | Asticcacaulis excentricus CB 48 | |
| 1 | 333 | 1 | alf030 | 54 | Azorhizobium caulinodans ORS 571 | |
| 1 | abq | 899 | 1 | alf031 | 88 | Azospirillum brasilense Az39 |
| abs | alf032 | 85 | Azospirillum brasilense Sp245 | |||
| 1 | 899 | 1 | alf033 | 83 | Azospirillum lipoferum 4B | |
| 1 | 899 | 1 | alf034 | 84 | Azospirillum sp. B510 | |
| 1 | 222 | 1 | alf035 | 43 | Bartonella australis Aust/NH1 | |
| 1 | 222 | 1 | alf036 | 45 | Bartonella bacilliformis KC583 ATCC 35685 | |
| 1 | 222 | 1 | alf037 | 42 | Bartonella clarridgeiae 73 | |
| 1 | 222 | 1 | alf038 | 43 | Bartonella grahamii as4aup | |
| 1 | 222 | 1 | alf039 | 43 | Bartonella henselae BM1374163 | |
| alf040 | 45 | Bartonella henselae BM1374165 | ||||
| alf041 | 44 | Bartonella henselae str. Houston-1 | ||||
| 1 | alf042 | 43 | Bartonella quintana RM-11 | |||
| 222 | 1 | alf043 | 43 | Bartonella quintana str. Toulouse | ||
| 1 | 222 | 1 | alf044 | 43 | Bartonella tribocorum BM1374166 | |
| alf045 | 43 | Bartonella tribocorum CIP 105476 | ||||
| 1 | 222 | 1 | alf046 | 43 | Bartonella vinsonii subsp. berkhoffii str. Winnie | |
| 1 | 333 | 1 | alf047 | 54 | Beijerinckia indica subsp. indica ATCC 9039 | |
| 1 | 111 | 1 | alf048 | 60 | Bradyrhizobium diazoefficiens USDA 110 USDA110 | |
| 1 | 222 | 1 | alf049 | 64 | Bradyrhizobium japonicum E109 | |
| alf050 | 59 | Bradyrhizobium japonicum SEMIA 5079 | ||||
| alf051 | 66 | Bradyrhizobium japonicum USDA 6 | ||||
| 1 | 222 | 1 | alf052 | 57 | Bradyrhizobium oligotrophicum S58 | |
| 1 | 222 | 1 | alf053 | 56 | Bradyrhizobium sp. BTAi1 | |
| 1 | 222 | 1 | alf054 | 52 | Bradyrhizobium sp. ORS 278 ORS278 | |
| 1 | 111 | 1 | alf055 | 50 | Bradyrhizobium sp. S23321 | |
| 1 | 222 | 1 | alf056 | 49 | Brevundimonas subvibrioides ATCC 15264 | |
| 1 | 333 | 1 | alf057 | 55 | Brucella abortus 2308 | |
| alf058 | 55 | Brucella abortus 3196 | ||||
| alf059 | 55 | Brucella abortus 63 75 | ||||
| alf060 | 55 | Brucella abortus A13334 | ||||
| alf061 | 55 | Brucella abortus BDW | ||||
| alf062 | 54 | Brucella abortus BER | ||||
| alf063 | 54 | Brucella abortus BFY | ||||
| alf064 | 55 | Brucella abortus bv. 1 str. 9-941 | ||||
| alf065 | 55 | Brucella abortus bv. 2 str. 86/8/59 | ||||
| alf066 | 55 | Brucella abortus bv. 6 str. 870 | ||||
| alf067 | 55 | Brucella abortus bv. 9 str. C68 | ||||
| alf068 | 55 | Brucella abortus NCTC 10505 | ||||
| alf069 | 55 | Brucella abortus S19 | ||||
| alf070 | 47 | Brucella abortus ZW053 | ||||
| 1 | 333 | 1 | alf071 | 55 | Brucella canis ATCC 23365 | |
| alf072 | 55 | Brucella canis HSK A52141 | ||||
| alf073 | 55 | Brucella canis RM6/66 | ||||
| alf074 | 49 | Brucella canis str. Oliveri | ||||
| alf075 | 55 | Brucella canis SVA13 | ||||
| 1 | alf076 | 54 | Brucella ceti TE10759-12 | |||
| alf077 | 54 | Brucella ceti TE28753-12 | ||||
| 1 | alf078 | 55 | Brucella melitensis ATCC 23457 | |||
| alf079 | 108 | Brucella melitensis bv. 1 str. 16M | ||||
| alf080 | 55 | Brucella melitensis bv. 2 str. 63/9 | ||||
| alf081 | 55 | Brucella melitensis bv. 3 str. Ether ether | ||||
| alf082 | 55 | Brucella melitensis M28 | ||||
| alf083 | 55 | Brucella melitensis M5-90 | ||||
| alf084 | 54 | Brucella melitensis NI | ||||
| 1 | alf085 | 55 | Brucella microti CCM 4915 | |||
| 1 | alf086 | 53 | Brucella ovis ATCC 25840 | |||
| 1 | alf087 | 55 | Brucella pinnipedialis 6/566 | |||
| alf088 | 55 | Brucella pinnipedialis B2/94 | ||||
| 1 | alf089 | 110 | Brucella suis 1330 | |||
| alf090 | 55 | Brucella suis 513UK | ||||
| alf091 | 54 | Brucella suis ATCC 23445 | ||||
| alf092 | 55 | Brucella suis BSP | ||||
| alf093 | 55 | Brucella suis bv. 1 str. S2 | ||||
| alf094 | 54 | Brucella suis bv. 2 Bs143CITA | ||||
| alf095 | 54 | Brucella suis bv. 2 Bs364CITA | ||||
| alf096 | 54 | Brucella suis bv. 2 Bs396CITA | ||||
| alf097 | 54 | Brucella suis bv. 2 PT09143 | ||||
| alf098 | 54 | Brucella suis bv. 2 PT09172 | ||||
| alf099 | 55 | Brucella suis bv. 3 str. 686 | ||||
| alf100 | 55 | Brucella suis Human/AR/US/1981 | ||||
| alf101 | 55 | Brucella suis VBI22 | ||||
| alf102 | 58 | Brucella suis ZW043 | ||||
| alf103 | 55 | Brucella suis ZW046 | ||||
| 1 | - | alf104 | 44 | Candidatus Caedibacter acanthamoebae | ||
| 1 | 111 | 1 | alf105 | 42 | Candidatus Endolissoclinum faulkneri L2 | |
| alf106 | 42 | Candidatus Endolissoclinum faulkneri L5 | ||||
| 1 | - | alf107 | 19 | Candidatus Hodgkinia cicadicola | ||
| - | alf108 | 14 | Candidatus Hodgkinia cicadicola Dsem | |||
| - | alf109 | 13 | Candidatus Hodgkinia cicadicola TETUND1 | |||
| - | alf110 | 17 | Candidatus Hodgkinia cicadicola TETUND2 | |||
| 1 | 333 | 1 | alf111 | 46 | Candidatus Liberibacter americanus str. Sao Paulo | |
| alf112 | 45 | Candidatus Liberibacter asiaticus str. gxpsy | ||||
| alf113 | 45 | Candidatus Liberibacter asiaticus str. Ishi-1 | ||||
| alf114 | 45 | Candidatus Liberibacter asiaticus str. psy62 | ||||
| alf115 | 46 | Candidatus Liberibacter solanacearum CLso-ZC1 | ||||
| 1 | alf116 | 35 | Candidatus Midichloria mitochondrii IricVA | |||
| 1 | 222 | 1 | alf117 | 43 | Candidatus Paracaedibacter acanthamoebae | |
| 1 | alf118 | 32 | Candidatus Pelagibacter sp. IMCC9063 | |||
| alf119 | 32 | Candidatus Pelagibacter ubique HTCC1062 | ||||
| 1 | alf120 | 44 | Candidatus Phaeomarinobacter ectocarpi Ec32 | |||
| 1 | alf121 | 38 | Candidatus Puniceispirillum marinum IMCC1322 | |||
| 1 | alf122 | 33 | Candidatus Rickettsia amblyommii str. GAT-30V | |||
| 1 | 222 | 1 | alf123 | 52 | Caulobacter crescentus CB15 | |
| alf124 | 52 | Caulobacter crescentus NA1000 | ||||
| 1 | alf125 | 53 | Caulobacter segnis ATCC 21756 | |||
| 1 | alf126 | 51 | Caulobacter sp. K31 | |||
| 1 | alf127 | 50 | Celeribacter indicus P73 | |||
| 1 | alf128 | 54 | Chelativorans sp. BNC1 | |||
| 1 | alf129 | 47 | Dinoroseobacter shibae DFL 12 DSM 16493 | |||
| 1 | 111 | 1 | alf130 | 36 | Ehrlichia canis str. Jake | |
| 1 | 111 | 1 | alf131 | 37 | Ehrlichia chaffeensis str. Arkansas | |
| alf132 | 37 | Ehrlichia chaffeensis str. Heartland | ||||
| alf133 | 37 | Ehrlichia chaffeensis str. Jax | ||||
| alf134 | 37 | Ehrlichia chaffeensis str. Liberty | ||||
| alf135 | 37 | Ehrlichia chaffeensis str. Osceola | ||||
| alf136 | 37 | Ehrlichia chaffeensis str. Saint Vincent | ||||
| alf137 | 37 | Ehrlichia chaffeensis str. Wakulla | ||||
| alf138 | 37 | Ehrlichia chaffeensis str. West Paces | ||||
| 1 | alf139 | 37 | Ehrlichia muris AS145 | |||
| 1 | alf140 | 36 | Ehrlichia ruminantium str. Gardel | |||
| alf141 | 72 | Ehrlichia ruminantium str. Welgevonden | ||||
| 1 | alf142 | 36 | Ehrlichia sp. HF | |||
| 1 | alf143 | 38 | endosymbiont of Acanthamoeba sp. UWC8 | |||
| 1 | alf144 | 63 | Ensifer adhaerens OV14 | |||
| 1 | alf145 | 43 | Erythrobacter litoralis HTCC2594 | |||
| 1 | 444 | 1 | alf146 | 60 | Gluconacetobacter diazotrophicus PA1 5 | |
| alf147 | 58 | Gluconacetobacter diazotrophicus PA1 5 PAl 5 | ||||
| 1 | alf148 | 57 | Gluconobacter oxydans 621H | |||
| alf149 | 57 | Gluconobacter oxydans DSM 3504 | ||||
| alf150 | 60 | Gluconobacter oxydans H24 | ||||
| 1 | alf151 | 52 | Granulibacter bethesdensis CGDNIH1 | |||
| alf152 | 53 | Granulibacter bethesdensis CGDNIH2 | ||||
| alf153 | 52 | Granulibacter bethesdensis CGDNIH3 | ||||
| alf154 | 52 | Granulibacter bethesdensis CGDNIH4 | ||||
| 1 | alf155 | 39 | Hirschia baltica ATCC 49814 | |||
| 1 | alf156 | 48 | Hyphomicrobium denitrificans 1NES1 | |||
| alf157 | 47 | Hyphomicrobium denitrificans ATCC 51888 | ||||
| 1 | alf158 | 49 | Hyphomicrobium nitrativorans NL23 | |||
| 1 | 111 | 1 | alf159 | 53 | Hyphomicrobium sp. MC1 | |
| 1 | alf160 | 43 | Hyphomonas neptunium ATCC 15444 | |||
| 1 | alf161 | 43 | Jannaschia sp. CCS1 | |||
| 1 | 555 | 1 | alf162 | 58 | Ketogulonicigenium vulgare WSH-001 | |
| alf163 | 60 | Ketogulonicigenium vulgare Y25 | ||||
| 1 | alf164 | 59 | Komagataeibacter medellinensis NBRC 3288 | |||
| 1 | alf165 | 60 | Komagataeibacter xylinus E25 | |||
| 1 | 555 | 1 | alf166 | 66 | Leisingera methylohalidivorans DSM 14336 MB2 | |
| 1 | alf167 | 47 | Liberibacter crescens BT-1 | |||
| 1 | alf168 | 45 | Magnetococcus marinus MC-1 | |||
| 1 | alf169 | 48 | Magnetospira sp. QH-2 | |||
| 1 | alf170 | 54 | Magnetospirillum gryphiswaldense MSR-1 v2 | |||
| 1 | alf171 | 53 | Magnetospirillum magneticum AMB-1 | |||
| 1 | alf172 | 45 | Maricaulis maris MCS10 | |||
| 1 | alf173 | 57 | Martelella endophytica YC6887 | |||
| 1 | 222 | 1 | alf174 | 55 | Mesorhizobium australicum WSM2073 | |
| 1 | alf175 | 54 | Mesorhizobium ciceri biovar biserrulae WSM1271 | |||
| 1 | alf176 | 55 | Mesorhizobium huakuii 7653R | |||
| 1 | alf177 | 55 | Mesorhizobium loti MAFF303099 | |||
| 1 | alf178 | 55 | Mesorhizobium opportunistum WSM2075 | |||
| 1 | alf179 | 68 | Methylobacterium extorquens AM1 | |||
| alf180 | 67 | Methylobacterium extorquens CM4 | ||||
| alf181 | 62 | Methylobacterium extorquens DM4 | ||||
| alf182 | 63 | Methylobacterium extorquens PA1 | ||||
| 1 | alf183 | 83 | Methylobacterium nodulans ORS 2060 | |||
| 1 | alf184 | 62 | Methylobacterium oryzae CBMB20 | |||
| 1 | alf185 | 61 | Methylobacterium populi BJ001 | |||
| 1 | alf186 | 63 | Methylobacterium radiotolerans JCM 2831 | |||
| 1 | 666 | 1 | alf187 | 72 | Methylobacterium sp. 4-46 | |
| 1 | alf188 | 50 | Methyloceanibacter caenitepidi Gela4 | |||
| 1 | alf189 | 51 | Methylocella silvestris BL2 | |||
| 1 | alf190 | 48 | Methylocystis sp. SC2 | |||
| 1 | alf191 | 44 | Micavibrio aeruginosavorus ARL-13 | |||
| alf192 | 40 | Micavibrio aeruginosavorus EPB | ||||
| 1 | alf193 | 52 | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | |||
| alf194 | 52 | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||||
| 1 | alf195 | 33 | Neorickettsia helminthoeca str. Oregon | |||
| 1 | alf196 | 33 | Neorickettsia risticii str. Illinois | |||
| 1 | alf197 | 33 | Neorickettsia sennetsu str. Miyayama | |||
| 1 | 111 | 1 | alf198 | 58 | Nitrobacter hamburgensis X14 | |
| 1 | alf199 | 50 | Nitrobacter winogradskyi Nb-255 | |||
| 1 | alf200 | 59 | Novosphingobium aromaticivorans DSM 12444 | |||
| 1 | alf201 | 57 | Novosphingobium pentaromativorans US6-1 | |||
| 1 | 333 | 1 | alf202 | 59 | Novosphingobium sp. PP1Y | |
| 1 | oan | 444 | 1 | alf203 | 61 | Ochrobactrum anthropi ATCC 49188 |
| alf204 | 59 | Ochrobactrum anthropi OAB | ||||
| 1 | alf205 | 51 | Octadecabacter antarcticus 307 | |||
| 1 | alf206 | 49 | Octadecabacter arcticus 238 | |||
| 1 | alf207 | 54 | Oligotropha carboxidovorans OM4 | |||
| alf208 | 54 | Oligotropha carboxidovorans OM5 | ||||
| alf209 | 54 | Oligotropha carboxidovorans OM5 ATCC 49405 | ||||
| 1 | alf210 | 34 | Orientia tsutsugamushi str. Boryong | |||
| alf211 | 34 | Orientia tsutsugamushi str. Ikeda | ||||
| 1 | 444 | 1 | alf212 | 62 | Paracoccus aminophilus JCM 7686 | |
| 1 | alf213 | 55 | Paracoccus denitrificans PD1222 | |||
| 1 | alf214 | 46 | Parvibaculum lavamentivorans DS-1 | |||
| 1 | alf215 | 44 | Parvularcula bermudensis HTCC2503 | |||
| 1 | alf216 | 50 | Pelagibacterium halotolerans B2 | |||
| 1 | alf217 | 58 | Phaeobacter gallaeciensis 2.10 | |||
| 444 | 1 | alf218 | 61 | Phaeobacter gallaeciensis DSM 26640 | ||
| 1 | alf219 | 59 | Phaeobacter inhibens DSM 17395 | |||
| 1 | alf220 | 43 | Phenylobacterium zucineum HLK1 | |||
| 1 | alf221 | 45 | Planktomarina temperata RCA23 | |||
| 1 | alf222 | 53 | Polymorphum gilvum SL003B-26A1 | |||
| 1 | 666 | 1 | alf223 | 70 | Pseudovibrio sp. FO-BEG1 | |
| 1 | 333 | 1 | alf224 | 54 | Rhizobium etli bv. mimosae str. IE4771 | |
| alf225 | 51 | Rhizobium etli bv. mimosae str. Mim1 | ||||
| alf226 | 55 | Rhizobium etli bv. phaseoli str. IE4803 | ||||
| alf227 | 50 | Rhizobium etli CFN 42 | ||||
| alf228 | 54 | Rhizobium etli CIAT 652 | ||||
| 1 | alf229 | 52 | Rhizobium gallicum bv. gallicum R602 | |||
| 1 | alf230 | 51 | Rhizobium leguminosarum bv. trifolii CB782 | |||
| alf231 | 54 | Rhizobium leguminosarum bv. trifolii WSM1325 | ||||
| alf232 | 51 | Rhizobium leguminosarum bv. trifolii WSM1689 | ||||
| alf233 | 52 | Rhizobium leguminosarum bv. trifolii WSM2304 | ||||
| alf234 | 52 | Rhizobium leguminosarum bv. viciae 3841 | ||||
| 1 | alf235 | 57 | Rhizobium sp. IRBG74 | |||
| 1 | alf236 | 55 | Rhizobium sp. LPU83 | |||
| 1 | alf237 | 51 | Rhizobium sp. NT-26 | |||
| 1 | alf238 | 54 | Rhizobium tropici CIAT 899 | |||
| 1 | alf239 | 54 | Rhodobacter capsulatus SB 1003 | |||
| 1 | 2*56 | alf240 | 112 | Rhodobacter sphaeroides 2.4.1 | ||
| alf241 | 57 | Rhodobacter sphaeroides ATCC 17025 | ||||
| alf242 | 58 | Rhodobacter sphaeroides ATCC 17029 | ||||
| alf243 | 58 | Rhodobacter sphaeroides KD131 KCTC 12085 | ||||
| alf244 | 55 | Rhodobacter sphaeroides WS8N | ||||
| 1 | alf245 | 52 | Rhodomicrobium vannielii ATCC 17100 | |||
| 1 | alf246 | 50 | Rhodopseudomonas palustris BisA53 | |||
| alf247 | 52 | Rhodopseudomonas palustris BisB18 | ||||
| alf248 | 51 | Rhodopseudomonas palustris BisB5 | ||||
| alf249 | 51 | Rhodopseudomonas palustris DX-1 | ||||
| alf250 | 51 | Rhodopseudomonas palustris HaA2 | ||||
| alf251 | 55 | Rhodopseudomonas palustris TIE-1 | ||||
| 1 | alf252 | 53 | Rhodospirillum centenum SW ATCC 51521 | |||
| 1 | rpm | alf253 | 95 | Rhodospirillum photometricum DSM 122 | ||
| 1 | rru | alf254 | 55 | Rhodospirillum rubrum ATCC 11170 | ||
| alf255 | 55 | Rhodospirillum rubrum F11 | ||||
| 1 | alf256 | 33 | Rickettsia africae ESF-5 | |||
| 1 | alf257 | 33 | Rickettsia akari str. Hartford | |||
| 1 | alf258 | 33 | Rickettsia australis str. Cutlack | |||
| 1 | alf259 | 35 | Rickettsia bellii OSU 85-389 | |||
| alf260 | 35 | Rickettsia bellii RML369-C | ||||
| 1 | alf261 | 33 | Rickettsia canadensis str. CA410 | |||
| alf262 | 33 | Rickettsia canadensis str. McKiel | ||||
| 1 | alf263 | 33 | Rickettsia conorii str. Malish 7 | |||
| 1 | alf264 | 33 | Rickettsia felis URRWXCal2 California 2 | |||
| 1 | alf265 | 33 | Rickettsia heilongjiangensis 054 | |||
| 1 | alf266 | 33 | Rickettsia helvetica C9P9 | |||
| 1 | alf267 | 33 | Rickettsia japonica YH | |||
| 1 | alf268 | 33 | Rickettsia massiliae MTU5 | |||
| alf269 | 33 | Rickettsia massiliae str. AZT80 | ||||
| 1 | alf270 | 32 | Rickettsia monacensis IrR/Munich | |||
| alf271 | 34 | Rickettsia montanensis str. OSU 85-930 | ||||
| 1 | alf272 | 34 | Rickettsia parkeri str. Portsmouth | |||
| 1 | alf273 | 34 | Rickettsia peacockii str. Rustic | |||
| 1 | alf274 | 33 | Rickettsia philipii str. 364D | |||
| 1 | rpl | alf275 | 33 | Rickettsia prowazekii str. Breinl | ||
| 1 | alf276 | 33 | Rickettsia prowazekii str. BuV67-CWPP | |||
| alf277 | 33 | Rickettsia prowazekii str. Chernikova | ||||
| alf278 | 33 | Rickettsia prowazekii str. Dachau | ||||
| alf279 | 33 | Rickettsia prowazekii str. GvV257 | ||||
| alf280 | 33 | Rickettsia prowazekii str. Katsinyian | ||||
| alf281 | 33 | Rickettsia prowazekii str. NMRC Madrid E | ||||
| alf282 | 33 | Rickettsia prowazekii str. Rp22 | ||||
| alf283 | 33 | Rickettsia prowazekii str. RpGvF24 | ||||
| 1 | alf284 | 33 | Rickettsia rhipicephali str. 3-7-female6-CWPP | |||
| 1 | alf285 | 34 | Rickettsia rickettsii str. Arizona | |||
| alf286 | 34 | Rickettsia rickettsii str. Brazil | ||||
| alf287 | 34 | Rickettsia rickettsii str. Colombia | ||||
| alf288 | 34 | Rickettsia rickettsii str. Hauke | ||||
| alf289 | 34 | Rickettsia rickettsii str. Hino | ||||
| alf290 | 34 | Rickettsia rickettsii str. Hlp#2 | ||||
| alf291 | 34 | Rickettsia rickettsii str. Iowa | ||||
| alf292 | 35 | Rickettsia rickettsii str. Morgan | ||||
| alf293 | 34 | Rickettsia rickettsii str. R | ||||
| alf294 | 34 | Rickettsia rickettsii str. Sheila Smith | ||||
| 1 | alf295 | 33 | Rickettsia sibirica 246 | |||
| 1 | alf296 | 33 | Rickettsia slovaca 13-B | |||
| alf297 | 33 | Rickettsia slovaca str. D-CWPP | ||||
| 1 | rtb | 111 | 1 | alf298 | 33 | Rickettsia typhi str. B9991CWPP |
| alf299 | 33 | Rickettsia typhi str. TH1527 | ||||
| alf300 | 33 | Rickettsia typhi str. Wilmington | ||||
| 1 | 111 | 1 | alf301 | 39 | Rickettsiales bacterium Ac37b | |
| 1 | alf302 | 48 | Roseibacterium elongatum DSM 19469 DFL-43 | |||
| 1 | 111 | 1 | alf303 | 38 | Roseobacter denitrificans OCh 114 | |
| 1 | 111 | 1 | alf304 | 38 | Roseobacter litoralis Och 149 | |
| 1 | 333 | 1 | alf305 | 54 | Ruegeria pomeroyi DSS-3 | |
| 1 | 555 | 1 | alf306 | 64 | Ruegeria sp. TM1040 | |
| 1 | 333 | 1 | alf307 | 56 | Sinorhizobium fredii NGR234 | |
| 1 | 333 | 1 | alf308 | 56 | Sinorhizobium medicae WSM419 | |
| 1 | 333 | 1 | alf309 | 56 | Sinorhizobium meliloti 1021 | |
| alf310 | 56 | Sinorhizobium meliloti 2011 | ||||
| alf311 | 59 | Sinorhizobium meliloti AK83 | ||||
| alf312 | 56 | Sinorhizobium meliloti BL225C | ||||
| alf313 | 57 | Sinorhizobium meliloti GR4 | ||||
| alf314 | 58 | Sinorhizobium meliloti Rm41 | ||||
| alf315 | 56 | Sinorhizobium meliloti RMO17 | ||||
| alf316 | 61 | Sinorhizobium meliloti SM11 | ||||
| 1 | 333 | 1 | alf317 | 62 | Sphingobium chlorophenolicum L-1 | |
| 1 | alf318 | 58 | Sphingobium japonicum UT26S | |||
| 1 | alf319 | 53 | Sphingobium sp. SYK-6 | |||
| 1 | alf320 | 57 | Sphingobium sp. YBL2 | |||
| 1 | 333 | 1 | alf321 | 63 | Sphingomonas sanxanigenens DSM 19645 NX02 | |
| 1 | alf322 | 55 | Sphingomonas sp. MM-1 | |||
| 1 | alf323 | 53 | Sphingomonas sp. WHSC-8 | |||
| 1 | alf324 | 53 | Sphingomonas taxi ATCC 55669 | |||
| 1 | alf325 | 53 | Sphingomonas wittichii RW1 | |||
| 1 | 111 | 1 | alf326 | 47 | Sphingopyxis alaskensis RB2256 | |
| 1 | alf327 | 50 | Sphingopyxis sp. Kp5.2 | |||
| 1 | alf328 | 47 | Starkeya novella DSM 506 | |||
| 1 | 444 | 1 | alf329 | 61 | Thalassospira xiamenensis M-5 DSM 17429 | |
| 1 | 444 | 1 | alf330 | 58 | Tistrella mobilis KA081020-065 | |
| 1 | 111 | 1 | alf331 | 34 | Wolbachia endosymbiont of Cimex lectularius wCle | |
| alf332 | 34 | Wolbachia endosymbiont of Culex quinquefasciatus Pel wPip | ||||
| alf333 | 34 | Wolbachia endosymbiont of Drosophila melanogaster wMel | ||||
| alf334 | 34 | Wolbachia endosymbiont of Drosophila simulans wAu | ||||
| alf335 | 35 | Wolbachia endosymbiont of Drosophila simulans wHa | ||||
| alf336 | 34 | Wolbachia endosymbiont of Drosophila simulans wNo | ||||
| alf337 | 34 | Wolbachia endosymbiont of Onchocerca ochengi wOo | ||||
| alf338 | 34 | Wolbachia endosymbiont of Onchocerca volvulus str. Cameroon | ||||
| alf339 | 34 | Wolbachia endosymbiont strain TRS of Brugia malayi | ||||
| 1 | alf340 | 35 | Wolbachia sp. wRi | |||
| 1 | 222 | 1 | alf341 | 55 | Xanthobacter autotrophicus Py2 | |
| 1 | alf342 | 49 | Zymomonas mobilis subsp. mobilis ATCC 10988 | |||
| 333 | 1 | alf343 | 52 | Zymomonas mobilis subsp. mobilis ATCC 29191 | ||
| alf344 | 52 | Zymomonas mobilis subsp. mobilis NCIMB 11163 | ||||
| alf345 | 52 | Zymomonas mobilis subsp. mobilis NRRL B-12526 | ||||
| 49+52 | alf346 | 101 | Zymomonas mobilis subsp. mobilis str. CP4 NRRL B-14023 | |||
| alf347 | 52 | Zymomonas mobilis subsp. mobilis ZM4 ATCC 31821 | ||||
| alf348 | 52 | Zymomonas mobilis subsp. pomaceae ATCC 29192 | ||||
| 189 | 70 |
Beta[modifier | modifier le wikicode]
beta blocs[modifier | modifier le wikicode]
- Lien tableur: beta blocs
- Légende:
- - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 23s°: 23S ribosomal RNA rRNA prediction is too short
- - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 16s°: 16S ribosomal RNA rRNA prediction is too short
| lien | blocs | 16s | total aas | avec | sans | total page | bet001-31 | Notes | |||
|---|---|---|---|---|---|---|---|---|---|---|---|
| bet001 | 2*16atcgca235 | 3 | 60 | 6 | 54 | 16s23s5s | 6-atcgca-35 | avant | |||
| 16atcgca2355 | sans | 2 | 61 | 3aas | |||||||
| 3aas | 2 | 2*16atcgca235-tac-gga-acc | |||||||||
| bet004 | 2*16atcgca235 | 3 | 55 | 9 | 46 | cds | |||||
| 16atcgca235-tac-gga-acc | cds-3aas | 5s de trop | |||||||||
| 65 | total | 2 | 63 | 0 | 16atcgca2355 | ||||||
| bet005 | 2*16atcgca235 | 3 | 57 | 9 | 48 | ||||||
| 16atcgca235-tac-gga-acc | |||||||||||
| bet006 | 3*16atcgca235 | 3 | 53 | 6 | 47 | ||||||
| bet007 | 3*16atcgca235 | 3 | 56 | 6 | 50 | ||||||
| bet008 | 3*16atcgca235 | 3 | 54 | 6 | 48 | ||||||
| bet009 | 2*16atcgca235 | 2 | 43 | 4 | 39 | ||||||
| bet010 | 2*16atcgca235 | 2 | 42 | 4 | 38 | ||||||
| bet011 | 3*16atcgca235 | 3 | 57 | 6 | 51 | ||||||
| bet013 | 4*16atcgca235 | 4 | 63 | 8 | 55 | ||||||
| bet014 | 4*16atcgca235 | 4 | 56 | 8 | 48 | ||||||
| bet015 | 5*16atcgca235 | 5 | 67 | 10 | 57 | ||||||
| bet016 | 2*16atcgca235 | 3 | 40 | 4 | 36 | ||||||
| 16s23s5s | |||||||||||
| bet018 | 3*16atcgca235 | 3 | 64 | 6 | 58 | ||||||
| bet019 | 3*16atcgca235 | 3 | 57 | 6 | 51 | ||||||
| bet022 | 3*16atcgca235 | 3 | 57 | 6 | 51 | ||||||
| bet024 | 3*16atcgca235 | 3 | 56 | 6 | 50 | ||||||
| bet025 | 3*16atcgca235 | 3 | 53 | 6 | 47 | ||||||
| bet029 | 3*16atcgca235 | 3 | 53 | 6 | 47 | ||||||
| bet031 | 5*16atcgca235 | 6 | 69 | 10 | 59 | ||||||
| 16s23s5s | 65 | ||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | bet032-167 | Notes | |||
| bet032 | 4*16atcgca235 | 6 | 72 | 13 | 59 | 16s23s5s | 6-atcgca-35 | avant | |||
| 16s-cds-235 | sans | 33 | 3aas | ||||||||
| 16atcgca235-tac-gga-acc | 3aas | 2 | 2*16atcgca235-tac-gga-acc | ||||||||
| cds | 3 | 26 | |||||||||
| bet039 | 16atcgca235 | 6 | 70 | 13 | 57 | cds-3aas | 6 | cds-3aas | |||
| 16atcgca-cds-235-tac-gga-acc | 70 | total | 3 | 67 | 0 | 6*16atcgca-cds-235-tac-gga-acc | |||||
| 3*16atcgca-cds-235 | |||||||||||
| 16s-cds-235 | |||||||||||
| incomplets | |||||||||||
| bet042 | 4*16atcgca235 | 5 | 70 | 13 | 57 | 16atcgca-cds-23s° | |||||
| 16atcgca-cds-235-tac-gga-acc | |||||||||||
| bet043 | 5*16atcgca235 | 6 | 65 | 15 | 50 | ||||||
| 16atcgca235-tac-gga-acc | |||||||||||
| bet044 | 4*16atcgca-cds-235 | 5 | 71 | 13 | 58 | ||||||
| 16atcgca-cds-235-tac-gga-acc | |||||||||||
| bet046 | 4*16atcgca-cds-235 | 5 | 71 | 13 | 58 | ||||||
| 16atcgca-cds-235-tac-gga-acc | |||||||||||
| bet049 | 4*16atcgca-cds-235 | 6 | 71 | 13 | 58 | ||||||
| 16-cds-235 | |||||||||||
| 16atcgca-cds-235-tac-gga-acc | |||||||||||
| bet050 | 3*16atcgca-cds-23-cds-5 | 4 | 59 | 8 | 51 | ||||||
| 16atcgca-cds-23s° | |||||||||||
| bet067 | 4*16atcgca-cds-235 | 5 | 70 | 13 | 57 | ||||||
| 16atcgca-cds-235-tac-gga-acc | |||||||||||
| bet080 | 4*16atcgca-cds-23-cds-5 | 4 | 66 | 8 | 58 | ||||||
| bet160 | 2*16atcgca235 | 2 | 46 | 4 | 42 | ||||||
| bet161 | 8*16atcgca235 | 8 | 101 | 16 | 85 | ||||||
| bet167 | 9*16atcgca235 | 9 | 105 | 18 | 87 | ||||||
| 71 | |||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Bet173-262 | Notes | |||
| bet173 | 4*16atcgca235 | 5 | 85 | 11 | 74 | 16s23s5s | 6-atcgca-35 | avant | |||
| agc-16atcgca235 | sans | 26 | 3 | avant | |||||||
| 3aas | agc-16atcgca235 | ||||||||||
| bet182 | 16atcgca235 | 1 | 72 | 2 | 70 | cds | 2*atgf-16atcgca235 | ||||
| cds-3aas | |||||||||||
| bet183 | 16atcgca235 | 2 | 47 | 5 | 42 | 29 | total | 0 | 26 | 3 | |
| atgf-16atcgca235 | |||||||||||
| bet188 | 4*16atcgca235 | 4 | 66 | 8 | 58 | ||||||
| bet214 | 16atcgca235 | 1 | 42 | 2 | 40 | ||||||
| bet219 | 3*16atcgca235 | 3 | 66 | 6 | 60 | ||||||
| bet224 | 4*16atcgca235 | 4 | 82 | 8 | 74 | ||||||
| bet228 | 2*16atcgca235 | 2 | 53 | 4 | 49 | ||||||
| bet236 | 3*16atcgca235 | 3 | 58 | 6 | 52 | ||||||
| bet257 | 16atcgca235 | 2 | 47 | 5 | 42 | ||||||
| atgf-16atcgca235 | |||||||||||
| bet262 | 2*16atcgca235 | 2 | 65 | 4 | 61 | ||||||
| 29 | |||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Total | Notes | |||
| 44 | 16s23s5s | 6-atcgca-35 | avant | ||||||||
| Total | 2732 | 353 | 2379 | sans | 2 | 120 | 3 | 3aas | |||
| Moyenne | 62 | 8 | 54 | 3aas | 0 | 4 | 4*16atcgca235-tac-gga-acc | ||||
| ecartype | 14 | 4 | 11 | cds | 3 | 26 | |||||
| max | 105 | 18 | 87 | cds-3aas | 0 | 6 | cds-3aas | ||||
| min | 40 | 2 | 36 | 164 | total | 5 | 156 | 3 | 6*16atcgca-cds-235-tac-gga-acc | ||
| 165 blocs | 44 génomes | 36 cds / 9 | |||||||||
| avant | |||||||||||
| agc-16atcgca235 | |||||||||||
| 2*atgf-16atcgca235 | |||||||||||
| incomplets | |||||||||||
| 16atcgca-cds-23s° | |||||||||||
| 5s de trop | |||||||||||
| 16atcgca2355 |
beta notes[modifier | modifier le wikicode]
- Les cds dans 16s-atcgca-cds-23s5s ont disparus au 10.2.20 du NCBI. De même pour 16s-cds-23s5s.
- La grande homogénéité de ces échantillons est due au grand nombre de génomes Burkholderia, 11 sur 44 beta décomptés.
beta typage[modifier | modifier le wikicode]
beta type 16-y-235 après 16s[modifier | modifier le wikicode]
- Typpe
Type total % 16s23s5s 2 1,2 atcgca 127 77 atcgca-cds 32 20 cds 3 1,8 total 164
beta type 16235-z après 5s[modifier | modifier le wikicode]
- Type
Type total % sans 153 93 tac-gga-acc 10 6 5s 1 1 total 164
beta type x-16235 avant 16s[modifier | modifier le wikicode]
- Type
Type total agc 1 atgf 2
Tableau des noms beta[modifier | modifier le wikicode]
- Lien tableur: Tableau des noms beta
- Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
- Légende
- - notes:2*70, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
- - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
- - rupture, sélection des génomes sur les 2 premiers attributs
- - fait, dans génomes beta
- - code, utilisé dans les génomes "fait"
- - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs total 16071 génomes ruptures faits total total 130 44 263
- Construction de la liste des noms
| ruptures | notes | rRNAs | fait | code | tRNAs | génomes |
|---|---|---|---|---|---|---|
| 1 | 433 | 1 | bet001 | 60 | Achromobacter xylosoxidans A8 | |
| bet002 | 58 | Achromobacter xylosoxidans C54 | ||||
| bet003 | 54 | Achromobacter xylosoxidans NH44784-1996 | ||||
| 1 | 333 | 1 | bet004 | 55 | Acidovorax avenae subsp. avenae ATCC 19860 | |
| 1 | 333 | 1 | bet005 | 57 | Acidovorax citrulli AAC00-1 | |
| 1 | 333 | 1 | bet006 | 53 | Acidovorax ebreus TPSY | |
| 1 | 333 | 1 | bet007 | 56 | Acidovorax sp. JS42 | |
| 1 | 333 | 1 | bet008 | 54 | Acidovorax sp. KKS102 | |
| 1 | 222 | 1 | bet009 | 43 | Advenella kashmirensis WT001 | |
| 1 | 222 | 1 | bet010 | 42 | Advenella mimigardefordensis DPN7 | |
| 1 | 333 | 1 | bet011 | 57 | Alicycliphilus denitrificans BC | |
| bet012 | 58 | Alicycliphilus denitrificans K601 | ||||
| 1 | 444 | 1 | bet013 | 63 | Aromatoleum aromaticum EbN1 | |
| 1 | 444 | 1 | bet014 | 56 | Azoarcus sp. BH72 | |
| 1 | 555 | 1 | bet015 | 67 | Azoarcus sp. KH32C | |
| 1 | 333 | 1 | bet016 | 40 | Basilea psittacipulmonis DSM 24701 | |
| 1 | - | bet017 | 43 | beta proteobacterium CB | ||
| 1 | 333 | 1 | bet018 | 64 | Bordetella avium 197N | |
| 1 | 333 | 1 | bet019 | 57 | Bordetella bronchiseptica 253 | |
| bet020 | 56 | Bordetella bronchiseptica MO149 | ||||
| bet021 | 56 | Bordetella bronchiseptica S798 | ||||
| 1 | 333 | 1 | bet022 | 57 | Bordetella holmesii 44057 | |
| bet023 | 56 | Bordetella holmesii ATCC 51541 | ||||
| 1 | 333 | 1 | bet024 | 56 | Bordetella parapertussis Bpp5 | |
| 1 | 333 | 1 | bet025 | 53 | Bordetella pertussis 137 | |
| bet026 | 53 | Bordetella pertussis 18323 | ||||
| bet027 | 53 | Bordetella pertussis B1917 | ||||
| bet028 | 53 | Bordetella pertussis CS | ||||
| 1 | 333 | 1 | bet029 | 53 | Bordetella petrii DSM 12804 | |
| 1 | 2*70 | bet030 | 140 | Burkholderia ambifaria AMMD | ||
| 666 | 1 | bet031 | 69 | Burkholderia ambifaria MC40-6 | ||
| 1 | 666 | 1 | bet032 | 72 | Burkholderia cenocepacia AU 1054 | |
| bet033 | 73 | Burkholderia cenocepacia DDS 22E-1 | ||||
| bet034 | 69 | Burkholderia cenocepacia DWS 37E-2 | ||||
| bet035 | 67 | Burkholderia cenocepacia H111 | ||||
| bet036 | 73 | Burkholderia cenocepacia HI2424 | ||||
| bet037 | 77 | Burkholderia cenocepacia J2315 | ||||
| bet038 | 75 | Burkholderia cenocepacia MC0-3 | ||||
| 1 | 666 | 1 | bet039 | 70 | Burkholderia cepacia DDS 7H-2 | |
| bet040 | 60 | Burkholderia cepacia GG4 | ||||
| bet041 | 70 | Burkholderia cepacia LO6 | ||||
| 1 | 555 | 1 | bet042 | 70 | Burkholderia dolosa AU0158 | |
| 1 | 666 | 1 | bet043 | 65 | Burkholderia fungorum ATCC BAA-463 | |
| 1 | 555 | 1 | bet044 | 71 | Burkholderia gladioli ATCC 10248 | |
| bet045 | 72 | Burkholderia gladioli BSR3 | ||||
| 1 | 555 | 1 | bet046 | 71 | Burkholderia glumae BGR1 | |
| bet047 | 67 | Burkholderia glumae LMG 2196 ATCC 33617 | ||||
| bet048 | 68 | Burkholderia glumae PG1 | ||||
| 1 | 666 | 1 | bet049 | 71 | Burkholderia lata 383 | |
| 1 | 343 | 1 | bet050 | 59 | Burkholderia mallei 11 | |
| bet051 | 59 | Burkholderia mallei 2000031063 | ||||
| bet052 | 59 | Burkholderia mallei 2002721276 | ||||
| bet053 | 59 | Burkholderia mallei 2002734299 | ||||
| bet054 | 56 | Burkholderia mallei 2002734306 | ||||
| bet055 | 57 | Burkholderia mallei 23344 | ||||
| bet056 | 59 | Burkholderia mallei 6 | ||||
| bet057 | 59 | Burkholderia mallei ATCC 23344 | ||||
| bet058 | 57 | Burkholderia mallei BMQ | ||||
| bet059 | 59 | Burkholderia mallei FMH 23344 | ||||
| bet060 | 56 | Burkholderia mallei India86-567-2 | ||||
| bet061 | 57 | Burkholderia mallei KC 1092 | ||||
| bet062 | 59 | Burkholderia mallei NCTC 10229 | ||||
| 2*58 | bet063 | 116 | Burkholderia mallei NCTC 10247 | |||
| bet064 | 57 | Burkholderia mallei SAVP1 | ||||
| 1 | 2*67 | bet065 | 134 | Burkholderia multivorans ATCC 17616 | ||
| bet066 | 69 | Burkholderia multivorans ATCC BAA-247 | ||||
| 555 | 1 | bet067 | 70 | Burkholderia multivorans DDS 15A-1 | ||
| 1 | bet068 | 62 | Burkholderia oklahomensis C6786 | |||
| bet069 | 62 | Burkholderia oklahomensis EO147 | ||||
| 1 | bet070 | 64 | Burkholderia phenoliruptrix BR3459a | |||
| 1 | bet071 | 67 | Burkholderia phymatum STM815 | |||
| 1 | bet072 | 66 | Burkholderia phytofirmans PsJN | |||
| 1 | 2*65 | bet073 | 130 | Burkholderia pseudomallei 1026b | ||
| 2*62 | bet074 | 124 | Burkholderia pseudomallei 1106a | |||
| bet075 | 64 | Burkholderia pseudomallei 1710b | ||||
| bet076 | 64 | Burkholderia pseudomallei 3921 | ||||
| bet077 | 63 | Burkholderia pseudomallei 406e | ||||
| bet078 | 63 | Burkholderia pseudomallei 576 | ||||
| bet079 | 64 | Burkholderia pseudomallei 668 | ||||
| 444 | 1 | bet080 | 66 | Burkholderia pseudomallei 7894 | ||
| bet081 | 64 | Burkholderia pseudomallei A79A | ||||
| bet082 | 64 | Burkholderia pseudomallei B03 | ||||
| bet083 | 64 | Burkholderia pseudomallei BDP | ||||
| bet084 | 64 | Burkholderia pseudomallei BEJ | ||||
| bet085 | 65 | Burkholderia pseudomallei BGR | ||||
| bet086 | 63 | Burkholderia pseudomallei BPC006 | ||||
| bet087 | 63 | Burkholderia pseudomallei BSR | ||||
| bet088 | 62 | Burkholderia pseudomallei HBPUB10134a | ||||
| bet089 | 64 | Burkholderia pseudomallei HBPUB10303a | ||||
| bet090 | 64 | Burkholderia pseudomallei K42 | ||||
| 2*66 | bet091 | 132 | Burkholderia pseudomallei K96243 | |||
| bet092 | 62 | Burkholderia pseudomallei Mahidol-1106a | ||||
| bet093 | 63 | Burkholderia pseudomallei MSHR1153 | ||||
| bet094 | 65 | Burkholderia pseudomallei MSHR146 | ||||
| bet095 | 62 | Burkholderia pseudomallei MSHR1655 | ||||
| bet096 | 62 | Burkholderia pseudomallei MSHR2243 | ||||
| bet097 | 64 | Burkholderia pseudomallei MSHR2543 | ||||
| bet098 | 64 | Burkholderia pseudomallei MSHR305 | ||||
| bet099 | 63 | Burkholderia pseudomallei MSHR346 | ||||
| bet100 | 65 | Burkholderia pseudomallei MSHR3965 | ||||
| bet101 | 66 | Burkholderia pseudomallei MSHR491 | ||||
| bet102 | 65 | Burkholderia pseudomallei MSHR511 | ||||
| bet103 | 64 | Burkholderia pseudomallei MSHR520 | ||||
| bet104 | 64 | Burkholderia pseudomallei MSHR5848 | ||||
| bet105 | 64 | Burkholderia pseudomallei MSHR5855 | ||||
| bet106 | 63 | Burkholderia pseudomallei MSHR5858 | ||||
| bet107 | 62 | Burkholderia pseudomallei MSHR62 | ||||
| bet108 | 64 | Burkholderia pseudomallei MSHR668 | ||||
| bet109 | 62 | Burkholderia pseudomallei MSHR840 | ||||
| bet110 | 65 | Burkholderia pseudomallei NAU20B-16 | ||||
| bet111 | 65 | Burkholderia pseudomallei NAU35A-3 | ||||
| bet112 | 63 | Burkholderia pseudomallei NCTC 13178 | ||||
| bet113 | 64 | Burkholderia pseudomallei NCTC 13179 | ||||
| bet114 | 70 | Burkholderia pseudomallei Pasteur 52237 | ||||
| bet115 | 63 | Burkholderia pseudomallei PB08298010 | ||||
| bet116 | 63 | Burkholderia pseudomallei TSV 48 | ||||
| bet117 | 67 | Burkholderia pseudomallei vgh07 | ||||
| 1 | bet118 | 51 | Burkholderia rhizoxinica HKI 454 | |||
| 1 | bet119 | 64 | Burkholderia sp. 2002721687 | |||
| 1 | bet120 | 64 | Burkholderia sp. BGK | |||
| 1 | bet121 | 65 | Burkholderia sp. CCGE1001 | |||
| 1 | bet122 | 75 | Burkholderia sp. CCGE1002 | |||
| 1 | bet123 | 65 | Burkholderia sp. CCGE1003 | |||
| 1 | bet124 | 70 | Burkholderia sp. KJ006 | |||
| 1 | bet125 | 63 | Burkholderia sp. RPE64 | |||
| 1 | bet126 | 67 | Burkholderia sp. RPE67 | |||
| 1 | bet127 | 63 | Burkholderia sp. TSV202 | |||
| 1 | bet128 | 67 | Burkholderia sp. YI23 | |||
| 1 | bet129 | 63 | Burkholderia thailandensis 2002721643 | |||
| bet130 | 63 | Burkholderia thailandensis 2002721723 | ||||
| bet131 | 63 | Burkholderia thailandensis 2003015869 | ||||
| bet132 | 65 | Burkholderia thailandensis 34 | ||||
| bet133 | 62 | Burkholderia thailandensis E254 | ||||
| bet134 | 63 | Burkholderia thailandensis E264 ATCC 700388 | ||||
| bet135 | 63 | Burkholderia thailandensis E444 | ||||
| bet136 | 61 | Burkholderia thailandensis H0587 | ||||
| bet137 | 60 | Burkholderia thailandensis MSMB121 | ||||
| bet138 | 60 | Burkholderia thailandensis MSMB59 | ||||
| bet139 | 62 | Burkholderia thailandensis USAMRU Malaysia #20 | ||||
| 1 | bet140 | 75 | Burkholderia ubonensis MSMB22 | |||
| 1 | bet141 | 71 | Burkholderia vietnamiensis G4 | |||
| bet142 | 75 | Burkholderia vietnamiensis LMG 10929 | ||||
| 1 | 2*68 | bet143 | 136 | Burkholderia xenovorans LB400 | ||
| 1 | bet144 | 48 | Burkholderiales bacterium GJ-E10 | |||
| 1 | bet145 | 50 | Candidatus Accumulibacter phosphatis clade IIA str. UW-1 | |||
| 1 | bet146 | 44 | Candidatus Kinetoplastibacterium blastocrithidii ex Strigomonas culicis | |||
| bet147 | 44 | Candidatus Kinetoplastibacterium blastocrithidii TCC012E | ||||
| 1 | bet148 | 45 | Candidatus Kinetoplastibacterium crithidii ex Angomonas deanei ATCC 30255 | |||
| bet149 | 45 | Candidatus Kinetoplastibacterium crithidii TCC036E | ||||
| 1 | bet150 | 44 | Candidatus Kinetoplastibacterium desouzaii TCC079E | |||
| 1 | bet151 | 44 | Candidatus Kinetoplastibacterium galatii TCC219 | |||
| 1 | bet152 | 44 | Candidatus Kinetoplastibacterium oncopeltii TCC290E | |||
| 1 | bet153 | 29 | Candidatus Nasuia deltocephalinicola str. NAS-ALF | |||
| 1 | bet154 | 34 | Candidatus Profftella armatura DC | |||
| 1 | bet155 | 45 | Candidatus Symbiobacter mobilis CR | |||
| 1 | bet156 | 31 | Candidatus Tremblaya phenacola PAVE | |||
| 1 | bet157 | 16 | Candidatus Tremblaya princeps PCIT | |||
| bet158 | 16 | Candidatus Tremblaya princeps PCVAL | ||||
| 1 | bet159 | 25 | Candidatus Zinderia insecticola CARI | |||
| 1 | 222 | 1 | bet160 | 46 | Castellaniella defragrans 65Phen | |
| 1 | 888 | 1 | bet161 | 101 | Chromobacterium violaceum ATCC 12472 | |
| 1 | bet162 | 60 | Collimonas arenae Cal35 | |||
| 1 | bet163 | 59 | Collimonas fungivorans Ter331 | |||
| 1 | bet164 | 45 | Comamonadaceae bacterium A1 | |||
| bet165 | 45 | Comamonadaceae bacterium B1 | ||||
| 1 | bet166 | 85 | Comamonas testosteroni CNB-2 CNB-1 substr. CNB-2 | |||
| 1 | 999 | 1 | bet167 | 105 | Comamonas testosteroni TK102 | |
| 1 | bet168 | 73 | Cupriavidus basilensis 4G11 | |||
| 1 | bet169 | 67 | Cupriavidus metallidurans CH34 | |||
| 1 | bet170 | 73 | Cupriavidus necator N-1 | |||
| 1 | bet171 | 66 | Cupriavidus taiwanensis LMG 19424 LMG19424 | |||
| 1 | bet172 | 65 | Dechloromonas aromatica RCB | |||
| 1 | 555 | 1 | bet173 | 85 | Delftia acidovorans SPH-1 | |
| 1 | bet174 | 83 | Delftia sp. Cs1-4 | |||
| 1 | bet175 | 53 | Gallionella capsiferriformans ES-2 | |||
| 1 | bet176 | 59 | Herbaspirillum seropedicae SmR1 | |||
| 1 | bet177 | 47 | Herminiimonas arsenicoxydans | |||
| 1 | bet178 | 76 | Janthinobacterium agaricidamnosum NBRC 102515 DSM 9628 | |||
| 1 | bet179 | 49 | Janthinobacterium sp. Marseille | |||
| 1 | bet180 | 80 | Laribacter hongkongensis HLHK9 | |||
| 1 | bet181 | 51 | Leptothrix cholodnii SP-6 | |||
| 1 | 111 | 1 | bet182 | 72 | Methylibium petroleiphilum PM1 | |
| 1 | 222 | 1 | bet183 | 47 | Methylobacillus flagellatus KT | |
| 1 | bet184 | 47 | Methylotenera mobilis JLW8 | |||
| 1 | bet185 | 48 | Methylotenera versatilis 301 | |||
| 1 | bet186 | 50 | Methylovorus glucosetrophus SIP3-4 | |||
| 1 | bet187 | 48 | Methylovorus sp. MP688 | |||
| 1 | 444 | 1 | bet188 | 66 | Neisseria elongata subsp. glycolytica ATCC 29315 | |
| 1 | bet189 | 56 | Neisseria gonorrhoeae FA 1090 | |||
| bet190 | 56 | Neisseria gonorrhoeae MS11 | ||||
| bet191 | 56 | Neisseria gonorrhoeae NCCP11945 | ||||
| 1 | bet192 | 60 | Neisseria lactamica 020-06 | |||
| 1 | bet193 | 61 | Neisseria meningitidis 053442 | |||
| bet194 | 61 | Neisseria meningitidis 510612 | ||||
| bet195 | 61 | Neisseria meningitidis 8013 | ||||
| bet196 | 60 | Neisseria meningitidis alpha14 | ||||
| bet197 | 58 | Neisseria meningitidis alpha710 | ||||
| bet198 | 60 | Neisseria meningitidis FAM18 | ||||
| bet199 | 61 | Neisseria meningitidis G2136 | ||||
| bet200 | 60 | Neisseria meningitidis H44/76 | ||||
| bet201 | 60 | Neisseria meningitidis LNP21362 | ||||
| bet202 | 61 | Neisseria meningitidis M01-240149 | ||||
| bet203 | 61 | Neisseria meningitidis M01-240355 | ||||
| bet204 | 60 | Neisseria meningitidis M04-240196 | ||||
| bet205 | 60 | Neisseria meningitidis M10208 | ||||
| bet206 | 62 | Neisseria meningitidis M7124 | ||||
| bet207 | 60 | Neisseria meningitidis MC58 | ||||
| bet208 | 60 | Neisseria meningitidis NM3682 | ||||
| bet209 | 62 | Neisseria meningitidis NM3683 | ||||
| bet210 | 60 | Neisseria meningitidis NM3686 | ||||
| bet211 | 61 | Neisseria meningitidis NZ-05/33 | ||||
| bet212 | 57 | Neisseria meningitidis WUE 2594 | ||||
| bet213 | 60 | Neisseria meningitidis Z2491 | ||||
| 1 | 111 | 1 | bet214 | 42 | Nitrosomonas europaea ATCC 19718 | |
| 1 | bet215 | 42 | Nitrosomonas eutropha C91 | |||
| 1 | bet216 | 43 | Nitrosomonas sp. AL212 | |||
| 1 | bet217 | 44 | Nitrosomonas sp. Is79A3 | |||
| 1 | bet218 | 43 | Nitrosospira multiformis ATCC 25196 | |||
| 1 | 333 | 1 | bet219 | 66 | Pandoraea apista TF81F4 | |
| 1 | bet220 | 69 | Pandoraea oxalativorans DSM 23570 | |||
| 1 | bet221 | 70 | Pandoraea pnomenusa 3kgm | |||
| bet222 | 69 | Pandoraea pnomenusa DSM 16536 | ||||
| bet223 | 71 | Pandoraea pnomenusa RB38 | ||||
| 1 | 444 | 1 | bet224 | 82 | Pandoraea pulmonicola DSM 16583 | |
| 1 | bet225 | 68 | Pandoraea sp. RB-44 | |||
| 1 | bet226 | 67 | Pandoraea sputorum DSM 21091 | |||
| 1 | bet227 | 68 | Pandoraea vervacti NS15 | |||
| 1 | 222 | 1 | bet228 | 53 | Polaromonas naphthalenivorans CJ2 | |
| 1 | bet229 | 46 | Polaromonas sp. JS666 | |||
| 1 | bet230 | 40 | Polynucleobacter necessarius subsp. asymbioticus MWH-MoK4 | |||
| bet231 | 42 | Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 | ||||
| bet232 | 37 | Polynucleobacter necessarius subsp. necessarius STIR1 | ||||
| 1 | bet233 | 90 | Pseudogulbenkiania sp. NH8B | |||
| 1 | bet234 | 49 | Pusillimonas sp. T7-7 | |||
| 1 | bet235 | 52 | Ralstonia mannitolilytica SN82F48 | |||
| 1 | 333 | 1 | bet236 | 58 | Ralstonia pickettii 12D | |
| bet237 | 58 | Ralstonia pickettii 12J | ||||
| bet238 | 70 | Ralstonia pickettii DTP0602 | ||||
| 1 | bet239 | 54 | Ralstonia solanacearum CFBP2957 | |||
| bet240 | 62 | Ralstonia solanacearum CMR15 | ||||
| bet241 | 55 | Ralstonia solanacearum FQY 4 | ||||
| bet242 | 60 | Ralstonia solanacearum GMI1000 | ||||
| bet243 | 55 | Ralstonia solanacearum Po82 | ||||
| bet244 | 58 | Ralstonia solanacearum PSI07 | ||||
| 1 | bet245 | 46 | Ramlibacter tataouinensis TTB310 | |||
| 1 | bet246 | 49 | Rhodocyclaceae bacterium PG1-Ca6 | |||
| 1 | bet247 | 48 | Rhodoferax ferrireducens T118 DSM 15236 | |||
| 1 | bet248 | 51 | Rubrivivax gelatinosus IL144 | |||
| 1 | bet249 | 46 | Sideroxydans lithotrophicus ES-1 | |||
| 1 | bet250 | 61 | Snodgrassella alvi wkB2 | |||
| 1 | bet251 | 46 | Sulfuricella denitrificans skB26 | |||
| 1 | bet252 | 48 | Sulfuritalea hydrogenivorans sk43H DSM22779 | |||
| 1 | bet253 | 39 | Taylorella asinigenitalis MCE3 | |||
| 1 | bet254 | 38 | Taylorella equigenitalis ATCC 35865 | |||
| bet255 | 38 | Taylorella equigenitalis MCE9 | ||||
| 1 | bet256 | 58 | Thauera sp. MZ1T | |||
| 1 | 222 | 1 | bet257 | 47 | Thiobacillus denitrificans ATCC 25259 | |
| 1 | bet258 | 49 | Thiomonas arsenitoxydans 3As | |||
| 1 | bet259 | 49 | Thiomonas intermedia K12 | |||
| 1 | bet260 | 50 | Variovorax paradoxus B4 | |||
| bet261 | 60 | Variovorax paradoxus EPS | ||||
| 222 | 1 | bet262 | 65 | Variovorax paradoxus S110 | ||
| 1 | bet263 | 49 | Verminephrobacter eiseniae EF01-2 | |||
| 130 | 44 |
Delta[modifier | modifier le wikicode]
delta blocs[modifier | modifier le wikicode]
- Lien tableur: delta blocs
- Légende:
| lien | blocs | 16s | total aas | avec | sans | total page | del001-62 | Notes | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| del01 | 2*16atcgca235 | 2 | 49 | 4 | 45 | 16s23s5s | 16-atcgca-35 | 16-gca-235 | 16-atc-235 | |||
| del03 | 2*16atcgca235 | 2 | 53 | 4 | 49 | sans | 17 | 40 | 1 | 2 | 1-3 | |
| 1-3 | 1 | 16atcgca235-atgj | ||||||||||
| del05 | 16s23s5s | 2 | 36 | 2 | 34 | 61 | total | 17 | 41 | 1 | 2 | |
| gca-16-atc-235 | avant | |||||||||||
| gca-16-atc-235 | ||||||||||||
| del11 | 3*16atcgca235 | 3 | 61 | 6 | 55 | |||||||
| del13 | 2*16atcgca235 | 2 | 62 | 4 | 58 | incomplets | ||||||
| 16s-23s | ||||||||||||
| del15 | 4*16s23s5s | 6 | 55 | 0 | 55 | 16-atc | ||||||
| 16s23s5s-5s | 16atcgca-23-23-5s | |||||||||||
| 16atccga235 | ||||||||||||
| 5s | 5s de trop | |||||||||||
| 16atcgca2355 | ||||||||||||
| del19 | 16s23s5s | 1 | 54 | 0 | 54 | 16s23s5s-5s | ||||||
| 16atcgca235-5s-5s | ||||||||||||
| del23 | 5*16s23s5s | 7 | 68 | 4 | 64 | 3*5s | ||||||
| 2*16atcgca235 | ||||||||||||
| 5s | ||||||||||||
| del26 | 4*16s23s5s | 4 | 72 | 0 | 72 | |||||||
| del30 | 5*16atcgca235 | 5 | 79 | 10 | 69 | |||||||
| del33 | 5*16atcgca235 | 5 | 92 | 10 | 82 | |||||||
| del34 | 4*16atcgca235 | 5 | 72 | 8 | 64 | |||||||
| 16atcgca2355 | 2 | -2 | ||||||||||
| del41 | 4*16atcgca235 | 4 | 61 | 8 | 53 | |||||||
| del46 | 4*16atcgca235 | 4 | 65 | 8 | 57 | |||||||
| del52 | 16-atc-235 | 2 | 49 | 2 | 47 | |||||||
| 16-gca-235 | ||||||||||||
| del53 | 16atcgca235 | 2 | 49 | 5 | 44 | |||||||
| 16atcgca235-atgj | ||||||||||||
| del56 | 16atcgca235 | 3 | 87 | 5 | 82 | |||||||
| 16-atc-235 | ||||||||||||
| 16atcgca-23-23-5s | ||||||||||||
| del59 | 2*16atcgca235 | 2 | 56 | 4 | 52 | |||||||
| del62 | 16atcgca235-5s-5s | 4 | 66 | 3 | 63 | |||||||
| 16s23s5s | ||||||||||||
| 16s-23s | ||||||||||||
| 16-atc | ||||||||||||
| 5s | 65 | |||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Total | Notes | ||||
| 19 | 16s23s5s | 16-atcgca-35 | 16-gca-235 | 16-atc-235 | ||||||||
| Total | 1186 | 89 | 1097 | sans | 17 | 40 | 1 | 2 | 1-3 | |||
| Moyenne | 62 | 5 | 58 | 1-3 | 1 | 16atcgca235-atgj | ||||||
| ecartype | 14 | 3 | 12 | 61 | total | 17 | 41 | 1 | 2 | |||
| max | 92 | 10 | 82 | avant | ||||||||
| min | 36 | 0 | 34 | gca-16-atc-235 | ||||||||
| incomplets | ||||||||||||
| 16s-23s | ||||||||||||
| 16-atc | ||||||||||||
| 16atcgca-23-23-5s | ||||||||||||
| 65 blocs | 19 génomes | 0 cds | ||||||||||
| 5s de trop | ||||||||||||
| 16atcgca2355 | ||||||||||||
| 16s23s5s-5s | ||||||||||||
| 16atcgca235-5s-5s | ||||||||||||
| 3*5s |
delta notes[modifier | modifier le wikicode]
delta typage[modifier | modifier le wikicode]
delta type 16-y-235 après 16s[modifier | modifier le wikicode]
- Type
Type tableau avant 16s incomplet total % 16s23s5s 17 1 18 28 atcgca 41 1 42 66 gca 1 1 2 atc 2 1 3 5 total 61 1 2 64
delta type 16235-z après 5s[modifier | modifier le wikicode]
- Type
sans 63 atgj 1 5s 4 total 68
delta type x-16235 avant 16s[modifier | modifier le wikicode]
- Type: gca.
Tableau des noms delta[modifier | modifier le wikicode]
- Lien tableur: Tableau des noms delta
- Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
- Légende
- - notes:45+41, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
- - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
- - rupture, sélection des génomes sur les 2 premiers attributs
- - fait, dans génomes delta
- - code, utilisé dans les génomes "fait"
- - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs total 3635 génomes ruptures faits total total 55 19 65
- Construction de la liste des noms
| ruptures | notes | rRNAs | fait | code | tRNAs | génomes |
|---|---|---|---|---|---|---|
| 1 | 222 | 1 | del01 | 49 | Anaeromyxobacter dehalogenans 2CP-1 | |
| del02 | 49 | Anaeromyxobacter dehalogenans 2CP-C | ||||
| 1 | 222 | 1 | del03 | 53 | Anaeromyxobacter sp. Fw109-5 | |
| 1 | del04 | 51 | Anaeromyxobacter sp. K | |||
| 1 | 222 | 1 | del05 | 36 | Bacteriovorax marinus SJ | |
| 1 | del06 | 37 | Bdellovibrio bacteriovorus 109J | |||
| del07 | 37 | Bdellovibrio bacteriovorus str. Tiberius | ||||
| del08 | 35 | Bdellovibrio bacteriovorus W | ||||
| 1 | del09 | 34 | Bdellovibrio exovorus JSS | |||
| 1 | del10 | 38 | Candidatus Babela massiliensis 673862 | |||
| 1 | 333 | 1 | del11 | 61 | Corallococcus coralloides DSM 2259 | |
| 1 | del12 | 48 | Desulfarculus baarsii DSM 2075 | |||
| 1 | 222 | 1 | del13 | 62 | Desulfatibacillum alkenivorans AK-01 | |
| 1 | del14 | 49 | Desulfobacca acetoxidans DSM 11109 | |||
| 1 | 866 | 1 | del15 | 55 | Desulfobacterium autotrophicum HRM2 | |
| 1 | del16 | 52 | Desulfobacula toluolica Tol2 | |||
| 1 | del17 | 54 | Desulfobulbus propionicus DSM 2032 | |||
| 1 | del18 | 47 | Desulfocapsa sulfexigens DSM 10523 | |||
| 1 | 111 | 1 | del19 | 54 | Desulfococcus oleovorans Hxd3 | |
| 1 | del20 | 50 | Desulfohalobium retbaense DSM 5692 | |||
| 1 | del21 | 66 | Desulfomicrobium baculatum DSM 4028 | |||
| 1 | del22 | 61 | Desulfomonile tiedjei DSM 6799 | |||
| 1 | 877 | 1 | del23 | 68 | Desulfotalea psychrophila LSv54 | |
| 1 | del24 | 56 | Desulfovibrio aespoeensis Aspo-2 | |||
| 1 | del25 | 62 | Desulfovibrio africanus str. Walvis Bay | |||
| 1 | 444 | 1 | del26 | 72 | Desulfovibrio alaskensis G20 | |
| 1 | del27 | 58 | Desulfovibrio desulfuricans ND132 | |||
| 1 | del28 | 54 | Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 | |||
| 1 | del29 | 49 | Desulfovibrio gigas DSM 1382 ATCC 19364 | |||
| 1 | 555 | 1 | del30 | 79 | Desulfovibrio hydrothermalis AM13 DSM 14728 | |
| 1 | del31 | 61 | Desulfovibrio magneticus RS-1 | |||
| 1 | del32 | 64 | Desulfovibrio piezophilus C1TLV30 | |||
| 1 | 555 | 1 | del33 | 92 | Desulfovibrio salexigens DSM 2638 | |
| 1 | 655 | 1 | del34 | 72 | Desulfovibrio vulgaris DP4 | |
| del35 | 71 | Desulfovibrio vulgaris RCH1 | ||||
| del36 | 72 | Desulfovibrio vulgaris str. Hildenborough | ||||
| del37 | 66 | Desulfovibrio vulgaris str. Miyazaki F | ||||
| 1 | del38 | 49 | Desulfurella acetivorans A63 | |||
| 1 | del39 | 49 | Desulfurivibrio alkaliphilus AHT2 | |||
| 1 | del40 | 55 | Geoalkalibacter subterraneus Red1 | |||
| 1 | 444 | 1 | del41 | 61 | Geobacter bemidjiensis Bem | |
| 1 | del42 | 50 | Geobacter daltonii FRC-32 | |||
| 1 | del43 | 45 | Geobacter lovleyi SZ | |||
| 1 | del44 | 51 | Geobacter metallireducens GS-15 | |||
| 1 | del45 | 53 | Geobacter pickeringii G13 | |||
| 1 | 444 | 1 | del46 | 65 | Geobacter sp. M18 | |
| 1 | del47 | 60 | Geobacter sp. M21 | |||
| 1 | del48 | 56 | Geobacter sulfurreducens AM-1 | |||
| del49 | 49 | Geobacter sulfurreducens KN400 | ||||
| del50 | 51 | Geobacter sulfurreducens PCA | ||||
| 1 | del51 | 50 | Geobacter uraniireducens Rf4 | |||
| 1 | 222 | 1 | del52 | 49 | Haliangium ochraceum DSM 14365 | |
| 1 | 222 | 1 | del53 | 49 | Hippea maritima DSM 10411 | |
| 1 | del54 | 46 | Lawsonia intracellularis N343 | |||
| del55 | 46 | Lawsonia intracellularis PHE/MN1-00 | ||||
| 1 | 334 | 1 | del56 | 70 | Myxococcus fulvus HW-1 | |
| 1 | - | del57 | 87 | Myxococcus stipitatus DSM 14675 | ||
| 1 | del58 | 69 | Myxococcus xanthus DK 1622 | |||
| 1 | 222 | 1 | del59 | 56 | Pelobacter carbinolicus DSM 2380 | |
| 1 | del60 | 55 | Pelobacter propionicus DSM 2379 | |||
| 1 | del61 | 66 | Sorangium cellulosum So ce56 So ce 56 | |||
| 543 | 1 | del62 | 66 | Sorangium cellulosum So0157-2 | ||
| 1 | del63 | 54 | Stigmatella aurantiaca DW4/3-1 | |||
| 1 | del64 | 54 | Syntrophobacter fumaroxidans MPOB | |||
| 1 | del65 | 50 | Syntrophus aciditrophicus SB | |||
| 55 | 19 |
Epsilon[modifier | modifier le wikicode]
epsilon blocs[modifier | modifier le wikicode]
- Lien tableur: epsilon blocs
- Légende:
- - 23s': possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 23s°: 23S ribosomal RNA rRNA prediction is too short
- - 16s': possible 16S ribosomal RNA but does not have good blast hits on one or both of the ends.
- - 16s°: 16S ribosomal RNA rRNA prediction is too short
- notes:
- - 11 blocs cassés, (16s,235), pour 6 génomes
- - zéro blocs 16235
- - Les s° sont considérés comme des intercalaires
| lien | blocs | 16s | total aas | avec | sans | total page | ep001-23 | Notes | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ep001 | 4*16atcgca235 | 5 | 54 | 11 | 43 | 16-atcgca-35 | 16-gcaatc-35 | 16-gca-35 | 16-atc-35 | avant | |||
| aac-16atcgca235 | sans | 12 | 9 | 8 | 4 | 3 | 1-3 | ||||||
| 1-3 | 3 | 3*16atcgca235-acc | |||||||||||
| ep004 | 2*16atcgca235 | 4 | 56 | 9 | 47 | ||||||||
| 2*16atcgca235-acc | 39 | total | 15 | 9 | 8 | 4 | 3 | avant | |||||
| aac-16atcgca235 | |||||||||||||
| ep005 | 3*16atcgca235 | 5 | 56 | 13 | 43 | aac-aac-16atcgca235 | |||||||
| aac-aac-16atcgca235 | aag-caa-atgf-16s-cds-235 | ||||||||||||
| 16atcgca235-acc | |||||||||||||
| incomplets | |||||||||||||
| ep006 | 3*16-gca-atc-235 | 3 | 45 | 6 | 39 | 2*16s-gca-atc-cds | |||||||
| ep007 | 2*16-gca-atc-235 | 3 | 41 | 6 | 35 | autres incomplets | |||||||
| 16-gca-atc-2355 | 2*235 | ||||||||||||
| 3*16-16s°-gca-atc-235 | |||||||||||||
| ep013 | 3*16atcgca235 | 3 | 47 | 6 | 41 | 4*16-gca-23-23s°-5s | |||||||
| 2*16-atc-23-23s°-5s | |||||||||||||
| ep014 | 3*16-16s°-gca-atc-235 | 3 | 47 | 6 | 41 | ||||||||
| 5s de trop | |||||||||||||
| ep015 | 2*16-gca-23-23s°-5s | 3 | 45 | 3 | 42 | 16-gca-atc-2355 | |||||||
| 16-atc-23-23s°-5s | |||||||||||||
| ep018 | 2*16-gca-235 | 3 | 44 | 3 | 41 | ||||||||
| 16-atc-235 | |||||||||||||
| ep019 | 2*16-gca-23-23s°-5s | 3 | 44 | 3 | 41 | ||||||||
| 16-atc-23-23s°-5s | |||||||||||||
| ep022 | aag-caa-atgf-16s-cds-235 | 3 | 44 | 7 | 37 | ||||||||
| 2*16s-gca-atc-cds | |||||||||||||
| 2*235 | |||||||||||||
| ep023 | 2*16-gca-235 | 3 | 44 | 3 | 41 | ||||||||
| 16-atc-235 | 41 | ||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | ep024-151 | Notes | |||||
| ep024 | 3*16-gca-atc-235 | 3 | 43 | 6 | 37 | 16-atcgca-35 | 16-gcaatc-35 | 16-gca-35 | 16-atc-35 | avant | |||
| ep025 | 3*16-gca-atc-235 | 3 | 45 | 6 | 39 | sans | 17 | 20 | 1 | avant | |||
| 1-3 | 8aas-16-gca-atc-235-cds | ||||||||||||
| ep057 | 2*16-gca-atc-235 | 3 | 47 | 14 | 33 | ||||||||
| 8aas-16-gca-atc-235-cds | 38 | total | 17 | 20 | 0 | 0 | 1 | exception | |||||
| 16-gca-atc-235-cds | |||||||||||||
| ep063 | 3*16-gca-atc-235 | 3 | 47 | 6 | 41 | ||||||||
| ep064 | 3*16-gca-atc-235 | 3 | 46 | 6 | 40 | incomplets | |||||||
| ep065 | 3*16-gca-atc-235 | 3 | 47 | 6 | 41 | 9*16s, 235 | |||||||
| 2*16s, 235, 5 | |||||||||||||
| ep067 | 2*16-gca-atc-235 | 3 | 44 | 6 | 38 | 16s | |||||||
| 16-gca-atc-235-cds | |||||||||||||
| autres incomplets | |||||||||||||
| ep068 | 2*16s, 235 | 2 | 37 | 0 | 37 | 23s-23s’-23s°-5s | |||||||
| ep069 | 2*16s, 235 | 2 | 37 | 0 | 37 | 23s°-23s’-5s | |||||||
| ep070 | 2*16s, 235 | 2 | 39 | 0 | 39 | 23s5s | |||||||
| ep072 | 2*16atcgca235 | 2 | 40 | 2 | 38 | 5s de trop | |||||||
| 2*16s, 235, 5s | |||||||||||||
| ep074 | 2*16s, 235, 5s | 2 | 37 | 0 | 37 | ||||||||
| ep057 | |||||||||||||
| ep075 | 16s | 1 | 42 | 0 | 42 | aaa | |||||||
| 23s-23s’-23s°-5s | gta | ||||||||||||
| 23s°-23s’-5s | gac | ||||||||||||
| aaa | |||||||||||||
| ep076 | 16atcgca235 | 1 | 38 | 2 | 36 | gta | |||||||
| ep077 | 2*16atcgca235 | 2 | 39 | 4 | 35 | gac | |||||||
| aaa | |||||||||||||
| ep078 | 16s, 235 | 1 | 36 | 0 | 36 | gag | |||||||
| 16s | |||||||||||||
| ep146 | 2*16s, 235 | 2 | 37 | 0 | 37 | ||||||||
| ep148 | 4*16atcgca235 | 4 | 49 | 8 | 41 | ||||||||
| ep149 | 2*16atcgca235 | 2 | 45 | 4 | 41 | ||||||||
| ep150 | 3*16atcgca235 | 3 | 45 | 6 | 39 | ||||||||
| ep151 | 3*16atcgca235 | 3 | 51 | 6 | 45 | ||||||||
| 50 | |||||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | ep152-158 | Notes | |||||
| ep152 | 2*16-gca-235 | 4 | 44 | 4 | 40 | 16-atcgca-35 | 16-gcaatc-35 | 16-gca-35 | 16-atc-35 | avant | |||
| 2*16-atc-235 | sans | 6 | 10 | 5 | 1-3 | ||||||||
| 1-3 | 1 | 16atcgca235-cgc | |||||||||||
| ep153 | 3*16-gca-235 | 4 | 46 | 4 | 42 | ||||||||
| 16-atc-235 | 22 | total | 7 | 0 | 10 | 5 | 0 | ||||||
| ep154 | 3*16-gca-235 | 4 | 50 | 4 | 46 | ||||||||
| 16-atc-235 | |||||||||||||
| Total Notes | |||||||||||||
| ep155 | 2*16atcgca235 | 2 | 42 | 4 | 38 | 1-3 | |||||||
| 16atcgca235-cgc | |||||||||||||
| ep156 | 2*16atcgca235 | 3 | 44 | 7 | 37 | 3*16atcgca235-acc | |||||||
| 16atcgca235-cgc | |||||||||||||
| avant | |||||||||||||
| ep157 | 2*16atcgca235 | 2 | 47 | 4 | 43 | aac-16atcgca235 | |||||||
| aac-aac-16atcgca235 | |||||||||||||
| ep158 | 2*16-gca-235 | 3 | 45 | 3 | 42 | aag-caa-atgf-16s-cds-235 | |||||||
| 16-atc-235 | 22 | 8aas-16-gca-atc-235-cds | |||||||||||
| lien | blocs | 16s | total aas | avec | sans | total page | Total | ||||||
| 40 | 16-atcgca-35 | 16-gcaatc-35 | 16-gca-35 | 16-atc-35 | avant | incomplets | |||||||
| Total | 1776 | 188 | 1588 | sans | 35 | 29 | 18 | 9 | 4 | 9*16s, 235 | |||
| Moyenne | 44 | 5 | 40 | 1-3 | 4 | 0 | 0 | 0 | 0 | 2*16s, 235, 5 | |||
| ecartype | 5 | 3 | 3 | 16s | |||||||||
| max | 56 | 14 | 47 | 99 | total | 39 | 29 | 18 | 9 | 4 | 2*16s-gca-atc-cds | ||
| min | 36 | 0 | 33 | ||||||||||
| autres incomplets | |||||||||||||
| 3*16-16s°-gca-atc-235 | |||||||||||||
| 4*16-gca-23-23s°-5s | |||||||||||||
| 2*16-atc-23-23s°-5s | |||||||||||||
| 23s-23s’-23s°-5s | |||||||||||||
| 23s°-23s’-5s | |||||||||||||
| 3*235 | |||||||||||||
| exception | |||||||||||||
| 16-gca-atc-235-cds | |||||||||||||
| 113 blocs | 40 génomes | ||||||||||||
| 5s de trop | |||||||||||||
| 1 cds | zéro blocs 16235 | 16-gca-atc-2355 | |||||||||||
| 2*16s, 235, 5 |
epsilon notes[modifier | modifier le wikicode]
- Le cds de ep057 8aas-16-gca-atc-235-cds. Les 8 tRNAs sont aaa gta gac aaa gta gac aaa gag. J'ai noté le 20.8.19 ce cds parce qu'il présentait une répétition de 19 FLL. A la date du 8.1.20 de NCBI la traduction n'est plus la même (adresse 494395..494628), mais il y a toujours une répétition de 19, mais KEI. Je reproduis ici les différences. Apparemment ils ont corrigé une erreur sur Met (CAT), lors de mon prélèvement du 20.8.19 c'était CAT et le 8.1.20 c'est devenu CAA (voitr ici " erreur sur CAT ".
- Mon prélèvement à la date du 20.8.19 qui n'est pas NCBI et j'avais copié la séquence d'aas
MFYNLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLFLLVRS
à l'envers A TGATCGCAC SRV TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA LLF LLF LLF LLF LLF LLF TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA LLF LLF LLF LLF LLF LLF TAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAA LLF LLF LLF LLF LLF LLF TAAAAGAAA LLF TAAATTATAAAA LNYF CAA erreur sur CAT TAAAAACTATCTCTAAAGAAAAACAAATAATAAACTAA reste du 8.1.20
- Prélèvement à la date NCBI du 8.1.20 la séquence d'aas est
MIALKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEIKEINYKTIKTISKEKQIIN
à l'endroit ATGATCGCACTA MIAL AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA KEI KEI KEI KEI KEI KEI AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA KEI KEI KEI KEI KEI KEI AAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATAAAAGAAATA KEI KEI KEI KEI KEI KEI AAAGAAATA KEI AATTATAAAACAATAAAAACTATCTCTAAAGAAAAACAAATAATAAACTAA NYKTIKTISKEKQIIN
epsilon typage[modifier | modifier le wikicode]
epsilon type 16-y-235 après 16s[modifier | modifier le wikicode]
- Lien tableur: epsilon type 16-y-235 après 16s
| types | tableau | décompte | avant 16s | incomplets | total | % |
|---|---|---|---|---|---|---|
| atcgca | 39 | 39 | 2 | 41 | 37 | |
| gcaatc | 29 | 26 | 1 | 27 | 24 | |
| gca | 18 | 14 | 14 | 13 | ||
| atc | 9 | 7 | 7 | 6 | ||
| 16s-16s°-gcaatc-235 | 3 | 3 | 3 | |||
| 16s-gca-23-23s°-5s | 4 | 4 | 4 | |||
| 16s-atc-23-23s°-5s | 2 | 2 | 2 | |||
| 16s-cds-235 | 1 | 1 | 1 | |||
| 16s, 235 | 9 | 9 | 8 | |||
| 16s, 235, 5s | 2 | 2 | 2 | |||
| 16s, - | 1 | 1 | 1 | |||
| 23s°-23s’-5s | ||||||
| 23s-23s’-23s°-5s | ||||||
| total | 111 | 100 | ||||
| atc, gca | 95 | 95 | 3 | 98 | 88 | |
| tRNA | total | % | ||||
| atc | 74 | 40 | ||||
| gca | 89 | 48 | ||||
| cds | 12 | 6 | ||||
| 16s | 11 | 6 | ||||
| total | 186 | 100 |
epsilon type 16235-z après 5s[modifier | modifier le wikicode]
- Lien tableur: epsilon type 16235-z après 5s
- Type
cgc 1 acc 3 5s 3 sans 104 total 111
epsilon type x-16235 avant 16s[modifier | modifier le wikicode]
- Lien tableur: epsilon type x-16235 avant 16s
- Type
aag-caa-atgf 1 aac 1 aac-aac 1 2*(aaa-gta-gac)-aaa-gag 1 sans 107 total 111
Tableau des noms epsilon[modifier | modifier le wikicode]
- Lien tableur: Tableau des noms epsilon
- Prélèvement: fait vers le 20.8.19 et mise en forme le 1.9.19 Paris.
- Légende
- - notes:45+41, à partir de gtRNAdb et la méthode de construction de la liste des noms, le même noms peut regrouper quelques échantillons ayant le même nombre de tRNAs.
- - rRNAs, 666 ou "10,10,10", sous la forme indiquée par NCBI, (5S, 16S, 23S).
- - rupture, sélection des génomes sur les 2 premiers attributs
- - fait, dans génomes epsilon
- - code, utilisé dans les génomes "fait"
- - tRNAs, nombre de tRNAs tel qu'il est déduit de la de la construction des noms.
tRNAs total 6638 génomes ruptures faits total total 36 38 158
- Construction de la liste des noms
| ruptures | notes | rRNAs | fait | code | tRNAs | génomes |
|---|---|---|---|---|---|---|
| 1 | 555 | 1 | ep001 | 54 | Arcobacter butzleri 7h1h | |
| ep002 | 54 | Arcobacter butzleri ED-1 | ||||
| ep003 | 54 | Arcobacter butzleri RM4018 | ||||
| 1 | 444 | 1 | ep004 | 56 | Arcobacter nitrofigilis DSM 7299 | |
| 1 | 555 | 1 | ep005 | 56 | Arcobacter sp. L | |
| 1 | 333 | 1 | ep006 | 45 | Campylobacter coli 15-537360 | |
| 433 | 1 | ep007 | 41 | Campylobacter coli 76339 | ||
| ep008 | 45 | Campylobacter coli CVM N29710 | ||||
| ep009 | 45 | Campylobacter coli FB1 | ||||
| ep010 | 45 | Campylobacter coli RM1875 | ||||
| ep011 | 41 | Campylobacter coli RM4661 | ||||
| ep012 | 45 | Campylobacter coli RM5611 | ||||
| 1 | 333 | 1 | ep013 | 47 | Campylobacter concisus 13826 | |
| 1 | 333 | 1 | ep014 | 47 | Campylobacter curvus 525.92 | |
| 1 | 333 | 1 | ep015 | 45 | Campylobacter fetus subsp. fetus 04/554 | |
| ep016 | 44 | Campylobacter fetus subsp. fetus 82-40 | ||||
| ep017 | 44 | Campylobacter fetus subsp. testudinum 03-427 | ||||
| 333 | 1 | ep018 | 44 | Campylobacter fetus subsp. testudinum pet-3 | ||
| 333 | 1 | ep019 | 44 | Campylobacter fetus subsp. venerealis 97/608 | ||
| ep020 | 44 | Campylobacter fetus subsp. venerealis cfvi03/293 | ||||
| ep021 | 44 | Campylobacter fetus subsp. venerealis str. 84-112 | ||||
| 1 | 333 | 1 | ep022 | 44 | Campylobacter hominis ATCC BAA-381 | |
| 1 | 333 | 1 | ep023 | 44 | Campylobacter iguaniorum 1485E | |
| 1 | 333 | 1 | ep024 | 43 | Campylobacter insulaenigrae NCTC 12927 | |
| 1 | 333 | 1 | ep025 | 45 | Campylobacter jejuni 32488 | |
| ep026 | 45 | Campylobacter jejuni 4031 | ||||
| ep027 | 45 | Campylobacter jejuni RM1221 | ||||
| ep028 | 45 | Campylobacter jejuni subsp. doylei 269.97 | ||||
| ep029 | 45 | Campylobacter jejuni subsp. jejuni 00-0949 | ||||
| ep030 | 45 | Campylobacter jejuni subsp. jejuni 00-1597 | ||||
| ep031 | 41 | Campylobacter jejuni subsp. jejuni 00-2425 | ||||
| ep032 | 45 | Campylobacter jejuni subsp. jejuni 00-2426 | ||||
| ep033 | 45 | Campylobacter jejuni subsp. jejuni 00-2538 | ||||
| ep034 | 45 | Campylobacter jejuni subsp. jejuni 00-2544 | ||||
| ep035 | 45 | Campylobacter jejuni subsp. jejuni 00-6200 | ||||
| ep036 | 45 | Campylobacter jejuni subsp. jejuni 01-1512 | ||||
| ep037 | 45 | Campylobacter jejuni subsp. jejuni 35925B2 | ||||
| 45+41 | ep038 | 86 | Campylobacter jejuni subsp. jejuni 81-176 | |||
| ep039 | 45 | Campylobacter jejuni subsp. jejuni 81116 NCTC 11828 | ||||
| ep040 | 45 | Campylobacter jejuni subsp. jejuni CG8421 | ||||
| ep041 | 47 | Campylobacter jejuni subsp. jejuni F38011 | ||||
| ep042 | 45 | Campylobacter jejuni subsp. jejuni IA3902 | ||||
| ep043 | 45 | Campylobacter jejuni subsp. jejuni ICDCCJ07001 | ||||
| ep044 | 45 | Campylobacter jejuni subsp. jejuni M1 | ||||
| ep045 | 45 | Campylobacter jejuni subsp. jejuni MTVDSCj20 | ||||
| ep046 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168 ATCC 700819 | ||||
| ep047 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-BN148 | ||||
| ep048 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-GSv NCTC 11168-rNRC | ||||
| ep049 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-K12E5 | ||||
| ep050 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-Kf1 | ||||
| ep051 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-mcK12E5 | ||||
| ep052 | 45 | Campylobacter jejuni subsp. jejuni NCTC 11168-mfK12E5 | ||||
| ep053 | 42 | Campylobacter jejuni subsp. jejuni PT14 | ||||
| ep054 | 45 | Campylobacter jejuni subsp. jejuni R14 | ||||
| ep055 | 45 | Campylobacter jejuni subsp. jejuni S3 | ||||
| ep056 | 45 | Campylobacter jejuni subsp. jejuni YH001 | ||||
| 1 | 333 | 1 | ep057 | 47 | Campylobacter lari CCUG 22395 | |
| ep058 | 47 | Campylobacter lari NCTC 11845 | ||||
| ep059 | 44 | Campylobacter lari RM16701 | ||||
| ep060 | 44 | Campylobacter lari RM16712 | ||||
| ep061 | 47 | Campylobacter lari RM2100 ATCC BAA-1060D | ||||
| ep062 | 44 | Campylobacter lari subsp. concheus LMG 11760 | ||||
| 1 | 333 | 1 | ep063 | 47 | Campylobacter peloridis LMG 23910 | |
| 1 | 333 | 1 | ep064 | 46 | Campylobacter sp. RM16704 | |
| 1 | 333 | 1 | ep065 | 47 | Campylobacter subantarcticus LMG 24374 | |
| ep066 | 48 | Campylobacter subantarcticus LMG 24377 | ||||
| 1 | 333 | 1 | ep067 | 44 | Campylobacter volucris LMG 24379 | |
| 1 | 222 | 1 | ep068 | 37 | Helicobacter acinonychis str. Sheeba | |
| 1 | 222 | 1 | ep069 | 37 | Helicobacter bizzozeronii CIII-1 | |
| 1 | 222 | 1 | ep070 | 39 | Helicobacter cetorum MIT 00-7128 | |
| ep071 | 38 | Helicobacter cetorum MIT 99-5656 | ||||
| 1 | 222 | 1 | ep072 | 40 | Helicobacter cinaedi ATCC BAA-847 | |
| ep073 | 40 | Helicobacter cinaedi PAGU611 | ||||
| 1 | 221 | 1 | ep074 | 37 | Helicobacter felis ATCC 49179 | |
| 1 | 213 | 1 | ep075 | 42 | Helicobacter heilmannii ASB1.4 | |
| 1 | 111 | 1 | ep076 | 38 | Helicobacter hepaticus ATCC 51449 | |
| 1 | 222 | ep077 | 39 | Helicobacter mustelae 12198 | ||
| 1 | 111 | ep078 | 36 | Helicobacter pylori 2017 | ||
| ep079 | 36 | Helicobacter pylori 2018 | ||||
| ep080 | 74 | Helicobacter pylori 26695 | ||||
| ep081 | 74 | Helicobacter pylori 26695-1 | ||||
| ep082 | 37 | Helicobacter pylori 26695-1CH | ||||
| ep083 | 37 | Helicobacter pylori 26695-1CL | ||||
| ep084 | 37 | Helicobacter pylori 26695-1MET | ||||
| ep085 | 37 | Helicobacter pylori 35A | ||||
| ep086 | 37 | Helicobacter pylori 51 | ||||
| ep087 | 37 | Helicobacter pylori 52 | ||||
| ep088 | 36 | Helicobacter pylori 83 | ||||
| ep089 | 36 | Helicobacter pylori 908 | ||||
| ep090 | 37 | Helicobacter pylori Aklavik117 | ||||
| ep091 | 37 | Helicobacter pylori Aklavik86 | ||||
| ep092 | 37 | Helicobacter pylori B38 | ||||
| ep093 | 37 | Helicobacter pylori B8 | ||||
| ep094 | 37 | Helicobacter pylori BM012A | ||||
| ep095 | 37 | Helicobacter pylori BM012B | ||||
| ep096 | 37 | Helicobacter pylori BM012S | ||||
| ep097 | 36 | Helicobacter pylori BM013A | ||||
| ep098 | 36 | Helicobacter pylori BM013B | ||||
| ep099 | 38 | Helicobacter pylori Cuz20 | ||||
| ep100 | 37 | Helicobacter pylori ELS37 | ||||
| ep101 | 37 | Helicobacter pylori F16 | ||||
| ep102 | 37 | Helicobacter pylori F30 | ||||
| ep103 | 37 | Helicobacter pylori F32 | ||||
| ep104 | 36 | Helicobacter pylori F57 | ||||
| ep105 | 36 | Helicobacter pylori G27 | ||||
| ep106 | 36 | Helicobacter pylori Gambia94/24 | ||||
| ep107 | 36 | Helicobacter pylori Hp238 | ||||
| ep108 | 36 | Helicobacter pylori HPAG1 | ||||
| ep109 | 36 | Helicobacter pylori HUP-B14 | ||||
| ep110 | 37 | Helicobacter pylori India7 | ||||
| ep111 | 37 | Helicobacter pylori J166 | ||||
| ep112 | 36 | Helicobacter pylori J99 | ||||
| ep113 | 37 | Helicobacter pylori Lithuania75 | ||||
| ep114 | 37 | Helicobacter pylori NY40 | ||||
| ep115 | 37 | Helicobacter pylori OK113 | ||||
| ep116 | 36 | Helicobacter pylori OK310 | ||||
| ep117 | 37 | Helicobacter pylori oki102 | ||||
| ep118 | 37 | Helicobacter pylori oki112 | ||||
| ep119 | 36 | Helicobacter pylori oki128 | ||||
| ep120 | 37 | Helicobacter pylori oki154 | ||||
| ep121 | 37 | Helicobacter pylori oki422 | ||||
| ep122 | 37 | Helicobacter pylori oki673 | ||||
| ep123 | 37 | Helicobacter pylori oki828 | ||||
| ep124 | 37 | Helicobacter pylori oki898 | ||||
| ep125 | 36 | Helicobacter pylori P12 | ||||
| ep126 | 37 | Helicobacter pylori PeCan18 | ||||
| ep127 | 37 | Helicobacter pylori PeCan4 | ||||
| ep128 | 37 | Helicobacter pylori Puno120 | ||||
| ep129 | 37 | Helicobacter pylori Puno135 | ||||
| ep130 | 37 | Helicobacter pylori Rif1 | ||||
| ep131 | 37 | Helicobacter pylori Rif2 | ||||
| ep132 | 37 | Helicobacter pylori Sat464 | ||||
| ep133 | 38 | Helicobacter pylori Shi112 | ||||
| ep134 | 37 | Helicobacter pylori Shi169 | ||||
| ep135 | 37 | Helicobacter pylori Shi417 | ||||
| ep136 | 37 | Helicobacter pylori Shi470 | ||||
| ep137 | 36 | Helicobacter pylori SJM180 | ||||
| ep138 | 36 | Helicobacter pylori SNT49 Santal49 | ||||
| ep139 | 36 | Helicobacter pylori SouthAfrica20 | ||||
| ep140 | 37 | Helicobacter pylori SouthAfrica7 | ||||
| ep141 | 37 | Helicobacter pylori UM032 | ||||
| ep142 | 37 | Helicobacter pylori UM037 | ||||
| ep143 | 37 | Helicobacter pylori UM066 | ||||
| ep144 | 37 | Helicobacter pylori UM298 | ||||
| ep145 | 37 | Helicobacter pylori UM299 | ||||
| 222 | 1 | ep146 | 37 | Helicobacter pylori v225d | ||
| ep147 | 37 | Helicobacter pylori XZ274 | ||||
| 1 | 444 | 1 | ep148 | 49 | Nautilia profundicola AmH | |
| 1 | 222 | 1 | ep149 | 45 | Nitratifractor salsuginis DSM 16511 | |
| 1 | 333 | 1 | ep150 | 45 | Nitratiruptor sp. SB155-2 | |
| 1 | 333 | 1 | ep151 | 51 | Sulfuricurvum kujiense DSM 16994 | |
| 1 | 444 | 1 | ep152 | 44 | Sulfurimonas autotrophica DSM 16294 | |
| 1 | 444 | 1 | ep153 | 46 | Sulfurimonas denitrificans DSM 1251 | |
| 1 | 444 | 1 | ep154 | 50 | Sulfurimonas gotlandica GD1 | |
| 1 | 222 | 1 | ep155 | 42 | Sulfurospirillum barnesii SES-3 | |
| 1 | 333 | 1 | ep156 | 44 | Sulfurospirillum deleyianum DSM 6946 | |
| 1 | 222 | 1 | ep157 | 47 | Sulfurospirillum multivorans DSM 12446 | |
| 1 | 333 | 1 | ep158 | 45 | Sulfurovum sp. NBC37-1 | |
| 36 | 38 |