Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Ftableur

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Fiche mémoire sur Ftableur
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Fiche : Ftableur
Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Ftableur
 », n'a pu être restituée correctement ci-dessus.


  • fiche en préparation

Tanger le 2.11.19

Firmicutes[modifier | modifier le wikicode]

bacilli[modifier | modifier le wikicode]

bacilli blocs[modifier | modifier le wikicode]

lien;blocs;16s;total aas;avec;sans;total page;Bc001-25;;;;;Notes
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
bc001;16s23s5s;4;60;40;20;;'’’sans;19;4;;;'''avant
;16atcgca235-aac-acc;;;;;;'’’1-3;3;2;;3;3*cgt gga 16s23s5s atgf gac
;16atcgca235-22aas;;;;;;'’’4-8;3;;;;
;16s23s5s-12aas;;;;;;'’’9-23;13;2;;;'''1-3
;;;;;;;'’’24-43;;;;;2*16atcgca235-aac-acc
bc002;16s23s5s-tca;6;65;1;64;49;'’’total;38;8;0;3;2*16s23s5s-atgf-gac
;5*16s23s5s;;;;;;;;;;;16s23s5s-tca
;;;;;;;;;;;;
bc004;2*16s23s5s;6;56;28;28;;;;;;;'''autres incomplets
;16atcgca235-aac-acc;;;;;;;;;;;16s°atcgca235
;16s23s5s-atgf-gac;;;;;;;;;;;16s°23s5s-16 aas 
;2*16s23s5s-13,9 aas;;;;;;;;;;;16s°atcgca235
;;;;;;;;;;;;
bc008;2*16atcgca235;10;95;68;27;;;;;;;
;2*16s23s5s;;;;;;;;;;;
;5*16s23s5s-21,16,9,9,5 aas;;;;;;;;;;;
;cgt gga 16s23s5s atgf gac;;;;;;;;;;;
;;;;;;;;;;;;
bc014;4*16s23s5s;8;89;59;30;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-9,7 aas ;;;;;;;;;;;
;16atcgca235-21 aas;;;;;;;;;;;
;16s°atcgca235;;;;;;;;;;;
;16s°23s5s-16 aas ;;;;;;;;;;;
;;;;;;;;;;;;
bc015;3*16s23s5s;9;89;52;37;;;;;;;
;16atcgca235;;;;;;;;;;;
;4*16s23s5s-21,16,9,7 aas  ;;;;;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;16s°atcgca235;;;;;;;;;;;
;;;;;;;;;;;;
bc025;2*16s23s5s;6;70;41;29;;;;;;;
;16atcgca235;;;;;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-21,16 aas;49;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc029-74;;;;;Notes
bc029;4*16s23s5s;11;112;98;14;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;2*16atcgca235;;;;;;'’’sans;33;6;;1;'''avant
;4*16s23s5s-20,19,11,9 aas;;;;;;'’’1-3;5;;;3;3*33,12,11aas-16s23s5s-atgf-gac
;33aas-16s23s5s-atgf-gac;;;;;;'’’4-8;1;;;;13aas-16s23s5s
;;;;;;;'’’9-23;22;2;;;
bc034;5*16s23s5s;10;94;81;13;;'’’24-43;;;;;'''1-3
;16atcgca235-15aas;;;;;73;'’’total;61;8;0;4;3*16s23s5s-atgf-gac
;3*16s23s5s-22,20,9aas;;;;;;;;;;;2*16s23s5s-aac-acc
;11aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc063;16s23s5s;7;75;45;30;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-21,16 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc065;3*16s23s5s;8;80;50;30;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;3*16s23s5s-21,16,9 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc066;8*16s23s5s;13;95;68;27;;;;;;;
;4*16s23s5s-22,19,15,8 aas;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc067;7*16s23s5s;10;83;43;40;;;;;;;
;16atcgca235-9aas;;;;;;;;;;;
;2*16s23s5s-16,16aas;;;;;;;;;;;
;;;;;;;;;;;;
bc074;5*16s23s5s;14;118;94;24;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9 aas;;;;;;;;;;;
;13aas-16s23s5s;73;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc090-244;;;;;Notes
bc090;7*16s23s5s;13;95;83;12;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;16atcgca235;;;;;;'’’sans;35;13;;;'''avant
;4*16s23s5s-22,20,15,9 aas;;;;;;'’’1-3;1;;;6;5*(3*12),11,10aas-16s23s5s-atgf-gac
;11aas-16s23s5s-atgf-gac;;;;;;'’’4-8;3;1;;;cgt-gga-16s23s5s-atgf-gac
;;;;;;;'’’9-23;26;;;;
bc097;5*16s23s5s;13;107;93;14;;'’’24-43;;;;;'''1-3
;2*16atcgca235;;;;;85;'’’total;65;14;0;6;16s23s5s-gaa
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;
;;;;;;;;;;;;
bc125;16s23s5s;12;123;107;16;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;suite3-16s23s5s;;;;;;;;;;;
;10aas-16s23s5s-atgf-gac;;;;;;;;;;;
;7*16s23s5s-21,16,14,12,10,9,9;;;;;;;;;;;
;;;;;;;;;;;;
bc147;3*16s23s5s   encadrés;9;86;60;26;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;3*16s23s5s-21, 16, 9, 6aas;;;;;;;;;;;
;;;;;;;;;;;;
bc158;5*16s23s5s;14;142;93;49;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;suite2-16s23s5s;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc165;10*16s23s5s;15;78;59;19;;;;;;;
;16s23s5s-gaa;;;;;;;;;;;
;3*16s23s5s-20,15,9;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc244;4*16atcgca235;9;98;26;72;;;;;;;
;16atcgca235-5aas;;;;;;;;;;;
;2*16s23s5s dont un encadré ici;;;;;;;;;;;
;2*16s23s5s-6, 5aas;85;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc328-656;;;;;Notes
bc328;2*16s23s5s dont un encadré ici;;67;50;17;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;2*16s23s5s-21,9;6;;;;;'’’sans;18;2;1;2;'''avant
;16atcgca235-14aas;;;;;;'’’1-3;1;1;4;1;5s-8aas-16s-atc-235
;16atcgca235-aac-acc;;;;;;'’’4-8;1;1;2;;ctc-gga-16s23s5s
;;;;;;;'’’9-23;15;2;6;;11aas-16s23s5s-atgf-gac
bc384;5*16s23s5s;14;175;138;37;;'’’24-43;;1;;;
;9*16s23s5s-23  22  19  17  ;;;;;58;'’’total;35;7;13;3;'''1-3
;16  12  11  9  9 aas;;;;;;;;;;;16atcgca235-aac-acc
;;;;;;;;;;;;16s23s5s-aac-acc
bc393;7*16s23s5s;13;165;73;92;;;;;;;2*16-gca-235-aac
;16s-gca-235;;;;;;;;;;;2*16-gca-235-aac-cgt
;16s-5s-atcgca-23s-8aas;;;;;;;;;;;
;16s-5s-atcgca-23s-5s-11aas;;;;;;;;;;;'''autres
;3*16s23s5s-11, 17, 21 aas;;;;;;;;;;;16s-gca-235
;;;;;;;;;;;;16s-5s-atcgca-23s-8aas
bc413;16atcgca235;5;63;47;16;;;;;;;16s-5s-atcgca-23s-5s-11aas
;16atcgca-235-26aas;;;;;;;;;;;
;16s23s5s-6aas;;;;;;;;;;;2*16-gca-235-aac
;5s-8aas-16s-atc-235;;;;;;;;;;;5*16-gca-235-17,15,12,9,4 aas
;ctc-gga-16s23s5s;;;;;;;;;;;2*16-gca-235-aac-cgt
;23s°5s;;;;;;;;;;;3*16s-gca-235-17, 12, 7 aas
;;;;;;;;;;;;
bc499;2*16-gca-235-aac;7;80;66;14;;;;;;;'''5s en trop
;5*16-gca-235-17,15,12,9,4 aas;;;;;;;;;;;16s-5s-atcgca-23s-5s-11aas
;;;;;;;;;;;;23s°5s
bc655;2*16-gca-235-aac-cgt;5;59;45;14;;;;;;;5s-8aas-16s-atc-235
;3*16s-gca-235-17, 12, 7 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc656;4*16s23s5s;8;56;30;26;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;
;11aas-16s23s5s-atgf-gac;;;;;;;;;;;
;16s23s5s-13aas;58;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc657-660;;;;;Notes
bc657;16s23s5s;5;62;36;26;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;16s23s5s-aac;;;;;;'’’sans;7;1;;;'''avant
;2*16s-gca-235-25, 8aas ;;;;;;'’’1-3;2;1;;2;12aas-16s23s5s-atgf-gac
;16s23s5s-12aas;;;;;;'’’4-8;1;2;1;;gga-16atcgca235-gta
;;;;;;;'’’9-23;3;2;;;
bc658;16s-5s-23s;5;61;58;3;;'’’24-43;;;1;;'''1-3
;16s-5s-23s-atgf-ctc-ctg;;;;;23;'’’total;13;6;2;2;16s23s5s-aac
;2*16s-5s-atcgca-23s-9,5aas;;;;;;;;;;;16s-5s-23s-atgf-ctc-ctg
;16s-5s-23s-14aas;;;;;;;;;;;16atcgca235-aac-acc
;;;;;;;;;;;;
bc659;4*16s23s5s;7;54;32;22;;;;;;;'''autres
;16atcgca235-aac-acc;;;;;;;;;;;16s-5s-23s-14aas
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;2*16s-5s-atcgca-23s-9,5aas
;16s23s5s-14aas;;;;;;;;;;;2*16s-gca-235-25, 8aas 
;;;;;;;;;;;;
bc660;16atcgca235;6;75;38;37;;;;;;;'''5s en trop
;16s23s5s;;;;;;;;;;;16atcgca235-4aas-5s-aac
;16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca;;;;;;;;;;;
;2*16atcgca235-17aas, 4aas-5s-aac;;;;;;;;;;;
;gga-16atcgca235-gta;;;;;;;;;;;
;;23;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
lien;blocs;aas;total aas;avec;sans;total pages;Total;;;;;
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;;;;;;;'’’sans;112;26;1;3;
;;;;;;;'’’1-3;12;4;4;15;
;'’’Moyenne;;88;59;29;;'’’4-8;9;4;3;0;
;'’’ecartype;;30;28;19;;'’’9-23;79;8;6;0;
;'’’max;;175;138;92;;'’’24-43;0;1;1;0;
;'’’min;;54;1;3;288;'’’total;212;43;15;18;

bacilli notes[modifier | modifier le wikicode]

avant::1-3
33,5*12,3*11,10aas-16s23s5s-atgf-gac::4*16atcgca235-aac-acc
4*cgt-gga-16s23s5s-atgf-gac::2*16-gca-235-aac
13aas-16s23s5s::2*16-gca-235-aac-cgt
5s-8aas-16s-atc-235::
ctc-gga-16s23s5s::5*16s23s5s-atgf-gac
::3*16s23s5s-aac-acc
gga-16atcgca235-gta::16s23s5s-gaa
::16s23s5s-tca
autres::16s23s5s-aac
16s-gca-235::16s-5s-23s-atgf-ctc-ctg
2*16-gca-235-aac::
2*16-gca-235-aac-cgt::autres incomplets
9*16-gca-235-2*17,15,2*12,9,8,7,4 aas::16s°atcgca235
16s-gca-235-25aas::16s°23s5s-16 aas 
3*16s-5s-atcgca-23s-9,8,5aas::16s°atcgca235
16s-5s-atcgca-23s-5s-11aas::
16s-5s-23s-14aas::5s en trop
::16atcgca235-4aas-5s-aac
zéro cds::16s-5s-atcgca-23s-5s-11aas
::5s-8aas-16s-atc-235
incomplets::23s°5s

Bacilli typage[modifier | modifier le wikicode]

bacilli blocs intégrés[modifier | modifier le wikicode]
avant inversé;Total intégré;;;;;;
16s23s5s;;16s23s5s;atcgca;gca;autres;atc;total
0;sans;112;26;1;*0;;139
1;1-3;13;5;4;*0;;22
4;4-8;13;4;3;*2;1;21
10;9-23;89;8;6;*3;;103
1;24-43;1;1;1;*0;;3
16;total;228;44;15;*5;1;288
0;Dont 16s5s-*-23s;1;4;0;*5;;5
bacilli blocs 1-3[modifier | modifier le wikicode]
bacilli;;;
1-3 après/ap;Total;‰;
aac;12;333;
acc;7;194;
atgf;6;167;
gac;5;139;833
cgt;2;56;
ctc;1;28;
ctg;1;;
gaa;1;;
tca;1;;
;36;;
aac-acc;7;;
atgf-gac;5;;
;;;
1-3 avant/ap;;;avant inversé
atgf;14;;ctc-gga
gac;14;;gta-gga
gta;1;;
atgf-gac;14;;
bacilli blocs 4-8[modifier | modifier le wikicode]
bc499;bc008;bc244;bc244;bc658;bc660;bc147;bc244;bc413;bc014;bc015;bc655;bc066;bc393;bc657
4;5;5;5;5;5;6;6;6;7;7;7;8;8;8
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
gca;23s;atc;23s;5s;other;23s;23s;23s;23s;23s;gca;23s;5s;gca
23s;5s;gca;5s;atc;gca;5s;5s;5s;5s;5s;23s;5s;atc;23s
5s;;23s;;gca;23s;;;;;;5s;;gca;5s
;;5s;;23s;5s;;;;;;;;23s;
gta;aac;aac;ggc;atgj;aac;aac;aac;aac;aac;aac;gta;aac;agc;gta
gga;acc;tcc;cgt;gta;acg;acc;cca;gaa;acc;acc;gac;acc;atgj;aaa
atc;ggc;atgj;gta;gac;gta;ggc;ggc;gta;ggc;ggc;aaa;gaa;gta;cta
gaa;cgt;gaa;gaa;ttc;aca;cgt;cgt;tac;cgt;cgt;cta;gta;aca;aca
;cca;gta;gac;tac;5s;cca;gta;caa;cca;cca;aca;tac;gac;ggc
;;;;;aac;gca;gac;aaa;gca;gca;atc;caa;ttc;tta
;;;;;;16s;;;atgj;atgj;gaa;aaa;tac;cgt
;;;;;;23s;;;;;;gca;aaa;cca
;;;;;;5s;;;;;;;;
bacilli blocs 9-23[modifier | modifier le wikicode]
bc004;bc008;bc008;bc014;bc015;bc029;bc034;bc065;bc067;bc074;bc074;bc090;bc097;bc097;bc125;bc125;bc147;bc158;bc158;bc165;bc328;bc384;bc384;bc499;bc658;bc125;bc029;bc384;bc393;bc393;bc001;bc125;bc384;bc499;bc655;bc657;bc004;bc656;bc125;bc328;bc658;bc659;bc034;bc066;bc074;bc090;bc097;bc158;bc165;bc499;bc008;bc014;bc015;bc025;bc063;bc065;bc067;bc067;bc125;bc147;bc384;bc384;bc393;bc499;bc655;bc660;bc029;bc066;bc384;bc029;bc034;bc074;bc090;bc097;bc158;bc165;bc008;bc014;bc015;bc025;bc063;bc065;bc125;bc147;bc328;bc393;bc001;bc034;bc066;bc074;bc090;bc097;bc158;bc384;bc384;bc657;bc413
9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;10;11;11;11;11;12;12;12;12;12;12;13;13;14;14;14;14;15;15;15;15;15;15;15;15;16;16;16;16;16;16;16;16;16;16;16;17;17;17;17;17;19;19;19;20;20;20;20;20;20;20;21;21;21;21;21;21;21;21;21;21;22;22;22;22;22;22;22;22;23;25;26
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s°;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;gca;5s;23s;23s;23s;23s;5s;23s;23s;23s;gca;gca;23s;23s;23s;23s;atc;5s;23s;atc;23s;23s;23s;23s;23s;23s;gca;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;gca;gca;atc;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;gca;atc
5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;23s;atc;5s;5s;5s;5s;atc;5s;5s;5s;23s;23s;5s;5s;5s;5s;gca;23s;5s;gca;5s;5s;5s;5s;5s;5s;23s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;23s;23s;gca;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;23s;gca
;;;;;;;;23s;;;;;;;;;;;;;;;5s;gca;;;;;gca;;;;5s;5s;;;;;23s;;;23s;;;;;;;5s;;;;;;;;;;;;;;5s;5s;23s;;;;;;;;;;;;23s;;;;;;;;;23s;;;;;;;;;5s;23s
;;;;;;;;5s;;;;;;;;;;;;;;;;23s;;;;;23s;;;;;;;;;;5s;;;5s;;;;;;;;;;;;;;;;;;;;;;;5s;;;;;;;;;;;;5s;;;;;;;;;5s;;;;;;;;;;5s
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
gta;gta;gta;gta;gta;aac;aac;gta;gta;aac;gta;aac;aac;gta;gta;gta;gta;aac;gta;aac;gta;ttc;agc;gta;aac;aac;aac;atc;aac;aac;aac;aca;atc;gta;gta;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;gta;aac;aac;aac;aac;aac;acc;aac;gca;gaa;aac;aac;aac;gca;gta;gta;gta;gta;gta;atc;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;atc;gta;gta;gta;gta;gta;gta;gta;atc;atc;gta;gta
aca;aca;aca;aca;aca;acc;acc;aca;aca;acc;aca;acc;acc;aca;aca;aca;aca;acc;aca;acc;aca;tac;atgj;gac;acc;acc;acc;gaa;tcc;acc;tcc;cta;gaa;gga;gga;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;gac;tcc;tcc;tcc;tcc;tcc;tcc;tcc;atgj;gta;tcc;tcc;tcc;aac;gac;gac;aaa;aca;aca;gca;aca;tac;tac;tac;tac;tac;tac;aca;aca;aca;aca;aca;aca;aca;aca;aca;gca;aaa;aca;aca;aca;aca;aca;aca;gca;gcc;aaa;aca
aaa;aaa;aaa;aaa;aaa;gaa;gaa;aaa;aaa;gaa;aaa;gaa;gaa;aaa;aaa;aaa;aaa;gaa;aaa;gaa;aaa;aaa;gta;aaa;gaa;gaa;gaa;gtc;gaa;gaa;gaa;ggc;gtc;atc;atc;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;aaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;tca;aca;gaa;gaa;gaa;tcc;aaa;aaa;aca;cac;cac;gaa;cac;caa;caa;caa;caa;caa;caa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aac;cta;cac;cac;cac;cac;cac;cac;gaa;gaa;cta;aaa
cta;cta;cta;cta;cta;gta;gta;cta;cta;gta;cta;gta;gta;cta;cta;cta;cta;gta;cta;gta;cta;ctc;atgf;cta;caa;gta;gta;atgf;gta;gta;gta;tta;atgf;gaa;caa;gta;atgf;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;cta;gta;gta;gta;gta;gta;gta;gta;gac;aaa;gta;gta;gta;gaa;cta;cta;tta;cta;cta;gta;cta;aaa;aaa;aaa;aaa;aaa;aaa;ctg;ctg;ctg;ctg;cta;cta;cta;ctg;cta;atgj;aca;cta;cta;cta;cta;cta;cta;tac;aca;aca;cta
ggc;ggc;ggc;ggc;ggc;tac;tac;ggc;ggc;tac;ggc;tac;tac;ggc;ggc;ggc;ggc;tac;ggc;tac;ggc;ctg;gac;aca;aaa;aca;tac;tgg;atgf;caa;gac;cca;tgg;tca;tca;gac;gac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;aca;atgf;atgf;atgf;atgf;atgf;atgf;atgf;tac;ggc;atgf;atgf;atgf;gta;aca;aca;cgt;ggc;ggc;aca;ggc;cta;cta;cta;cta;cta;cta;ggc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;agc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;aac;tac;ggc;ggc
tta;tta;tta;tta;tta;caa;caa;tta;tta;caa;tta;caa;caa;tta;tta;tta;tta;caa;tta;caa;tta;ggc;ttc;ggc;cta;tac;tgg;caa;gac;aaa;ttc;gca;caa;atgf;atgf;ttc;ttc;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;atc;gac;gac;gac;gac;gac;gac;gac;tgg;cgt;gac;gac;gac;atgf;ggc;ggc;cca;tta;tta;tac;tta;ggc;ggc;ggc;ggc;ggc;ggc;tta;tta;tta;tta;tta;tta;tta;tta;tta;gaa;tta;tta;tta;tta;tta;tta;tta;gta;aac;tta;tta
cgt;cgt;cgt;cgt;cgt;aaa;aaa;cgt;cgt;aaa;cgt;aaa;aaa;cgt;cgt;cgt;cgt;aaa;cgt;aaa;cgt;cgt;aca;tta;ggc;caa;cac;aaa;aaa;cta;tac;atgj;aaa;ttc;ttc;tac;tac;ttc;ttc;ttc;aca;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;gaa;ttc;ttc;ttc;ttc;ttc;ttc;ttc;cac;cca;ttc;acg;ttc;gac;tta;tta;atgj;cgt;cgt;aac;cgt;tta;tta;tta;tta;tta;tta;cgt;cgt;cgt;cgt;cgt;cgt;cgt;cgt;cgt;gta;cgt;cgt;cgt;cgt;cgt;cgt;cgt;gac;gta;cgt;cgt
cca;cca;cca;cca;cca;ggc;ggc;cca;cca;ggc;cca;ggc;ggc;cca;cca;cca;cca;ggc;cca;ggc;cca;cca;tac;cgt;cgt;aaa;caa;ctg;ggc;ggc;tgg;tca;cta;tac;tac;tgg;tgg;tac;tac;tac;tgg;tac;aca;aca;aca;aca;aca;aca;aca;tca;aca;aca;aca;aca;aca;aca;aca;caa;atgj;aca;cac;aca;aca;cgt;cgt;tca;cca;cca;gta;cca;cgt;cgt;cgt;cgt;cgt;cgt;cca;cca;cca;cca;cca;cca;cca;cca;cca;atgf;cca;cca;cca;cca;cca;cca;cca;ttc;gac;cca;cca
gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;ggg;aaa;cca;gga;ggc;ggc;ggc;cgt;cgt;cac;tac;ggc;tgg;tgg;cac;cac;tgg;tgg;tgg;cac;tgg;tac;tac;tac;tac;tac;tac;tac;atgf;tac;tac;tac;tac;tac;tac;tac;ggc;tca;tac;caa;tac;tac;cca;cca;atgf;gca;gca;atgf;gca;cca;cca;cca;cca;cca;cca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gac;gca;gca;gca;gca;gca;gca;gca;aaa;cac;gca;gca
;;;;;;;;;;;;;;;;16s;;;;16s;;;;;gca;tgc;cgt;ttg;cca;caa;tgg;cgt;cac;cac;caa;caa;cac;cac;cac;caa;cac;tgg;tgg;tgg;tgg;tgg;tgg;tgg;ttc;tgg;tgg;tgg;tgg;tgg;tgg;tgg;cgt;gac;tgg;aaa;tgg;caa;atgj;atgj;gac;tca;tca;gac;tca;gca;gca;gca;gca;gca;gca;atgj;atgj;atgj;atgj;atgj;atgj;atgj;atgj;atgj;ttc;atgj;atgj;atgj;atgj;atgj;atgj;atgj;ctg;caa;atgj;atgj
;;;;;;;;;;;;;;;;23s;;;;23s;;;;;;ttg;cca;cca;gga;tgc;gga;cca;caa;caa;tgc;ggc;ggc;caa;caa;ggc;caa;cac;cac;cac;cac;cac;cac;cac;tac;cac;cac;cac;cac;cac;cac;cac;gga;tac;cac;ggc;cac;aaa;atgi;atgi;ttc;tca;tca;cac;cta;tca;tca;tca;tca;tca;tca;atgi;atgi;atgi;atgi;atgi;atgi;atgi;atgi;atgi;aca;atgi;atgi;atgi;atgi;atgi;atgi;atgi;ggc;aaa;atgi;atgi
;;;;;;;;;;;;;;;;5s;;;;5s;;;;;;;;;;ttg;atc;gga;ttg;ttg;ttg;tgc;tgc;ggc;ggc;tgc;ggc;caa;caa;caa;caa;caa;caa;caa;tgg;caa;caa;caa;caa;caa;caa;caa;atc;cac;caa;ggc;caa;cta;tca;tca;gga;atgf;atgf;caa;atgf;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tac;tca;tca;tca;tca;tca;tca;tca;tgc;ctg;tca;tca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;tgc;tgc;cgt;tgc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;cac;ggc;ggc;ggc;ggc;ggc;ggc;ggc;aac;caa;ggc;ttg;ggc;ggc;atgf;atgf;gga;gac;gac;aaa;gac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;cac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;cgt;ggc;atgf;gac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;tgc;tgc;tgc;tgc;tgc;tgc;tgc;caa;tgc;tgc;tgc;tgc;tgc;tgc;tgc;agc;tgc;tgc;cca;tgc;cgt;ttc;ttc;gga;ttc;ttc;ctc;ttc;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;caa;gac;gac;gac;gac;gac;gac;gac;cca;cgt;gac;tca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;ttg;ttg;ttg;ttg;tta;tta;tta;tta;tta;tta;tta;gaa;atc;tta;gga;tta;ttg;gga;gga;gga;aca;aca;ctg;aca;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;aaa;gga;ttc;ttc;ttc;ttc;ttc;ttc;gca;cca;gga;atgf
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;ttg;ttg;ttg;aaa;aac;ttg;aga;cgt;cca;atc;atc;atc;tgg;tgg;ggc;aaa;aca;aca;aca;aca;aca;aca;cac;cac;cac;cac;cac;cac;cac;cac;cac;ctg;atc;aca;aca;aca;aca;aca;aca;acc;ncRNA;atc;gac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;gga;agc;agc;agc;atc;atc;tgc;gga;tgg;tgg;tgg;tgg;tgg;tgg;gga;gga;gga;gga;gga;gga;gga;gga;gga;ggc;agc;aaa;aaa;aaa;aaa;aaa;aaa;tcg;gca;gaa;ttc
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;aac;aac;cgt;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;tgc;gaa;gga;gga;gga;gga;gga;gga;agc;acc;tca;aca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;cca;aac;aac;aac;acc;caa;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;cgt;atgf;atc;atc;atc;atc;atc;atc;gtc;tcg;atgf;tac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;agc;gaa;gaa;gaa;gaa;gaa;gaa;agc;agc;agc;agc;agc;agc;agc;agc;agc;cca;gac;aac;aac;aac;aac;aac;aac;acg;agc;gac;tgg
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gga;ttc;agc;agc;agc;agc;agc;agc;tcc;atgj;ttc;cac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;gaa;gaa;gaa;gaa;gaa;ctc;atgf;gga;caa
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;tcc;atc;tgc
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ctc;agc;gga
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gga
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg
bacilli blocs avant[modifier | modifier le wikicode]
bc147;bc008;bc413;bc125;bc034;bc074;bc090;bc656;bc066;bc097;bc158;bc165;bc659;bc029
4;4;9;12;13;13;13;13;14;14;14;14;14;35
;;5s;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac
;;gta;agc;agc;agc;agc;agc;agc;agc;agc;agc;agc;agc
;;aca;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa
;;aaa;;gta;gta;gta;;gta;gta;gta;gta;;gta
;;ggc;;gac;atgf;gac;gac;atgf;gac;atgf;atgf;gac;gac
;;tta;gac;caa;gac;caa;caa;gac;caa;gac;gac;caa;caa
;;cgt;caa;aaa;caa;aaa;aaa;caa;aaa;caa;caa;aaa;aaa
cgt;cgt;cca;cta;;aaa;;;aaa;cta;aaa;aaa;cta;cta
gga;gga;gca;ctc;ctc;cta;ctc;ctc;ctc;ctc;ctc;ctc;ctc;ggc
16s;16s;16s;cgt;cgt;ctc;cgt;cgt;cgt;cgt;cgt;cgt;cgt;tta
23s;23s;atc;cca;cca;cgt;cca;cca;cca;cca;cca;cca;cca;cgt
5s;5s;23s;gga;gga;cca;gga;gga;gga;gga;gga;gga;gga;cca
atgf;atgf;5s;;;gga;;atc;;;;;atc;gca
gac;gac;;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;tca
;;;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;tca
;;;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;atgf
;;;atgf;atgf;;atgf;atgf;atgf;atgf;atgf;atgf;atgf;gac
;;;gac;gac;;gac;gac;gac;gac;gac;gac;gac;ttc
;;;;;;;;;;;;;aca
;;;;;;;;;;;;;tgg
;;;;;;;;;;;;;atc
;;;;;;;;;;;;;aac
;;;;;;;;;;;;;gaa
;;;;;;;;;;;;;gta
;;;;;;;;;;;;;gac
;;;;;;;;;;;;;caa
;;;;;;;;;;;;;aaa
;;;;;;;;;;;;;cta
;;;;;;;;;;;;;ggc
;;;;;;;;;;;;;tta
;;;;;;;;;;;;;cgt
;;;;;;;;;;;;;cca
;;;;;;;;;;;;;gga
;;;;;;;;;;;;;16s
;;;;;;;;;;;;;23s
;;;;;;;;;;;;;5s
;;;;;;;;;;;;;atgf
;;;;;;;;;;;;;gac
bacilli total blocs longs[modifier | modifier le wikicode]
bacilli total blocs longs;;effectifs;;;;;;;bacilli total blocs longs;;Pour 1000;;;;;
tot;;1749;;atgf;;83;;;tot;;1000;;atgf;;47;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
atc;48;acc;20;aac;87;agc;38;;atc;27;acc;11;aac;50;agc;22
ctc;14;ccc;0;cac;53;cgt;82;;ctc;8;ccc;0;cac;30;cgt;47
gtc;3;gcc;1;gac;99;ggc;101;;gtc;2;gcc;1;gac;57;ggc;58
ttc;63;tcc;30;tac;56;tgc;30;;ttc;36;tcc;17;tac;32;tgc;17
atgi;20;aca;87;aaa;84;aga;1;;atgi;11;aca;50;aaa;48;aga;1
cta;54;cca;77;caa;69;cga;0;;cta;31;cca;44;caa;39;cga;0
gta;112;gca;63;gaa;93;gga;51;;gta;64;gca;36;gaa;53;gga;29
tta;59;tca;48;taa;0;tga;0;;tta;34;tca;27;taa;0;tga;0
atgj;32;acg;3;aag;0;agg;0;;atgj;18;acg;2;aag;0;agg;0
ctg;11;ccg;0;cag;0;cgg;0;;ctg;6;ccg;0;cag;0;cgg;0
gtg;0;gcg;0;gag;0;ggg;1;;gtg;0;gcg;0;gag;0;ggg;1
ttg;32;tcg;2;tag;0;tgg;42;;ttg;18;tcg;1;tag;0;tgg;24

clostridia[modifier | modifier le wikicode]

clostridia blocs[modifier | modifier le wikicode]

28.11.19 Tanger;;Ftableur;;;;;;;;;;;;;
clostridia;blocs;;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd001-32;;;;;;;;Notes 1
cd001;3*16s23s5s;5;62;21;41;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s-gcaatc-235-6aas;;;;;;'’’sans;15;1;2;2;2;;;'’’avant
;5aas-16s-gcaatc-235-6aas;;;;;;'’’1-3;7;;1;1;1;;;5aas-16s-gcaatc-235-6aas
;5s;;;;;;'’’4-8;1;1;1;;;;3;'’’agc-16s5s23s-6aas
;;;;;;;'’’9-23;5;;;2;;;;'’’tca-tcc-16s5s23s-5aas
cd002;16atcgca235;5;67;34;33;;'’’24-43;;;;;;;;
;16atcgca235-6aas;;;;;45;'’’total;28;2;4;5;3;0;3;'’’autres
;3*16s23s5s-12,9,4 aas;;;;;;;;;;;;;;'’’16s5s-atc-23s
;;;;;;;;;;;;;;;'’’16s5s-gca-23-aac-gaa-tgc
cd003;3*16s23s5s;10;110;83;27;;;;;;;;;;'’’16s5s23s-gac-aca
;16-gca-2355;;;;;;;;;;;;;;'’’16s5s23s
;16-atc-235;;;;;;;;;;;;;;
;3*16s23s5s-22,13,9aas;;;;;;;;;;;;;;'’’1-3
;2*16-gca-235-22,13aas;;;;;;;;;;;;;;16s-atc-23s-aac
;;;;;;;;;;;;;;;16s-gcaatc-23s5s-ttc-tgc
cd011;'’’16s5s23s;6;51;21;30;;;;;;;;;;'’’16s5s-gca-23-aac-gaa-tgc
;'’’16s5s23s-gac-aca;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;'’’16s5s-atc-23s;;;;;;;;;;;;;;'’’16s5s23s-gac-aca
;'’’agc-16s5s23s-6aas;;;;;;;;;;;;;;2*16s23s5s-atgi-gca
;'’’tca-tcc-16s5s23s-5aas;;;;;;;;;;;;;;16s23s5s-ttc-gac-gaa
;'’’16s5s-gca-23-aac-gaa-tgc;;;;;;;;;;;;;;2*16s23s-aac-5s
;;;;;;;;;;;;;;;
cd013;16s23s5s;3;52;4;48;;;;;;;;;;'’’différents
;2*16-gca-atc-235;;;;;;;;;;;;;;2*16s23s-aac-5s
;;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
cd032;'’’NCBI # gtRNAdb;;93;18;75;;;;;;;;;;
;7*16s23s5s;16;;;;;;;;;;;;;'’’cds
;2*16s23s5s-atgi-gca;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;16s23s5s-ttc-gac-gaa;;;;;;;;;;;;;;
;2*16s23s-aac-5s;;;;;;;;;;;;;;'’’5s en trop
;16s-atc-23s-aac;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;16s-gca-23s5s;;;;;;;;;;;;;;16-gca-2355
;16235-aaa-cds-5s-aaa;;;;;;;;;;;;;;5s-ttc
;16s-gcaatc-23s5s-ttc-tgc;;;;;;;;;;;;;;5s
;5s-ttc;45;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd045-59;;;;;;;;Notes 2
cd045;3*16s23s5s;10;87;22;65;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-atgi-gca;;;;;;'’’sans;8;;;4;2;;1;'’’avant
;16s23s5s-aaa;;;;;;'’’1-3;15;;1;2;1;;1;gca-atc-gga-16s23s5s
;16s23s-aac-5s-aac;;;;;;'’’4-8;;;1;;;;;5s-atgi-gca-16-gca-atc-235-aac-aac
;16s23s5s-ttc-5s-ttc-aaa;;;;;;'’’9-23;;;;;;;;
;16s-gca-atc-235-6aas;;;;;;'’’24-43;;;;;;;;'’’1-3
;gca-atc-gga-16s23s5s;;;;;36;'’’total;23;0;2;6;3;0;2;3*16s23s5s-aaa
;16s-gca-atc-23s-aac;;;;;;;;;;;;;;3*16s23s5s-aac
;;;;;;;;;;;;;;;2*16s23s5s-ttc
cd047;16s23s5s;5;53;6;47;;;;;;;;;;16s23s5s-ggc
;16s23s5s-aac;;;;;;;;;;;;;;16s23s5s-ttc-tgc
;16s23s5s-ttc;;;;;;;;;;;;;;16s23s5s-aac-aac
;16s23s5s-aac-aac;;;;;;;;;;;;;;2*16s23s5s-atgi-gca
;16s5s-atgi-gca;;;;;;;;;;;;;;16s23s-aac-5s-aac
;;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
cd055;3*16-gca-235;8;65;9;56;;;;;;;;;;2*16-gca-235-aac
;16-gca-235-aac;;;;;;;;;;;;;;16-atc-235-tgg
;16-atc-235-tgg;;;;;;;;;;;;;;16-gca-atc-235-aac
;16-atc-235;;;;;;;;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;;;'’’incomplets
;16s23s5s;;;;;;;;;;;;;;16s5s-atgi-gca
;;;;;;;;;;;;;;;16s-gca-atc-23s-aac
cd057;16s23s5s;9;80;17;63;;;;;;;;;;
;16s23s5s-atgi-gca;;;;;;;;;;;;;;'’’différents
;16s23s5s-ggc;;;;;;;;;;;;;;16s23s-aac-5s-aac
;2*16s23s5s-aaa;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-ttc;;;;;;;;;;;;;;
;16s23s5s-ttc-tgc;;;;;;;;;;;;;;'’’5s en trop
;16-gca-atc-235-aac;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;5s-atgi-gca-16 –;;;;;;;;;;;;;;5s-atgi-gca-16-gca-atc-235-aac-aac
;gca-atc-235-aac-aac;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;
cd059;2*16s23s5s;6;59;5;54;;;;;;;;;;
;16-atc-235;;;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;;;
;16-gca-235-aac;38;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd060-64;;;;;;;;Notes 3
cd060;16s23s5s;7;63;10;53;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-atgi-gca;;;;;;'’’sans;8;;;;;;1;'’’avant
;16-gca-atc-235-atgi-gca;;;;;;'’’1-3;16;;2;;2;;1;atgf-16s23s5s
;16-atc-235-ttc;;;;;;'’’4-8;1;;1;;;;;atgi-gca-16s23s5s-aac
;16s23s5s-aac;;;;;;'’’9-23;;;;;;;;
;16s23s5s-aaa;;;;;;'’’24-43;;;;;;;;'’’1-3
;16s23s;;;;;32;'’’total;25;0;3;0;2;0;2;16s23s5s-atgi
;;;;;;;;;;;;;;;2*16s23s5s-aac
cd062;2*16s23s5s;9;74;13;61;;;;;;;;;;2*16s23s5s-ttc
;16s23s5s-atgi;;;;;;;;;;;;;;5*16s23s5s-aaa
;16s23s5s-aaa;;;;;;;;;;;;;;3*16s23s5s-atgi-gca
;16s23s5s-ttc;;;;;;;;;;;;;;16s23s-aac-5s-aac
;16-gca-atc-235-aac;;;;;;;;;;;;;;16s23s5s-atgi-gca-aac
;atgf-16s23s5s;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-atgi-gca-aac;;;;;;;;;;;;;;16-atc-235-ttc
;16-gca-atc-23s;;;;;;;;;;;;;;16-atc-235-ttc-tgc
;5s-ttc;;;;;;;;;;;;;;16-gca-atc-235-aac
;;;;;;;;;;;;;;;16-gca-atc-235-atgi-gca
cd063;4*16s23s5s;10;81;18;63;;;;;;;;;;
;16s23s-aac-5s-aac;;;;;;;;;;;;;;'’’incomplets
;16-gca-atc-23-aac;;;;;;;;;;;;;;16s23s
;16s23s5s-ttc-5s-ttc-aaa;;;;;;;;;;;;;;16-gca-atc-23s
;16s23s5s-aaa;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;16-gca-atc-235-6 aas;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
cd064;16s23s5s;9;77;17;60;;;;;;;;;;16s23s-aac-5s-aac
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;2*16s23s5s-aaa;;;;;;;;;;;;;;'’’5s en trop
;16s23s5s-ttc;;;;;;;;;;;;;;5s-ttc
;16-atc-235-ttc-tgc;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-aac;;;;;;;;;;;;;;
;atgi-gca-16s23s5s-aac;;;;;;;;;;;;;;
;16s23s5s-5aas;35;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd067-92;;;;;;;;Notes 4
cd067;2*16s23s5s-atc-gca;10;96;16;80;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-gaa, aaa, aac, ttc;;;;;;'’’sans;9;5;0;5;;1;;'’’1-3
;16-gca-atc-235-ttc, aaa;;;;;;'’’1-3;16;;4;;;;;3*16s23s5s-aaa
;16-gca-atc-23-aac;;;;;;'’’4-8;;;;;;;;3*16s23s5s-ttc
;16-gca-atc-235 –;;;;;;'’’9-23;;;;;;;;4*16s23s5s-aac
;aac-5s-ttc-tgc;;;;;;'’’24-43;;;;;;;;16s23s5s-gaa
;;;;;;40;'’’total;25;5;4;5;0;1;0;2*16s23s5s-atgi-gca
cd071;3*16s23s5s-aac;9;66;12;64;;;;;;;;;;3*16s23s5s-atc-gca
;16-gca-atc-235-ttc;;;;;;;;;;;;;;16-gca-atc-235-aaa
;16s23s5s-ttc, aaa;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s23s5s;;;;;;;;;;;;;;2*16-gca-atc-235-ttc
;16s23s5s-atc-gca;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’incomplets
cd079;16s23s5s-atgi-gca;4;53;9;44;;;;;;;;;;8aas-16s
;16s23s5s-aaa;;;;;;;;;;;;;;16s-atc-23s
;16s23s5s-ttc;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s-atc-23s;;;;;;;;;;;;;;
;16s°-atc-235-atgi-gca;;;;;;;;;;;;;;'’’autres incomplets
;23s5s-aaa;;;;;;;;;;;;;;23s5s-aaa
;;;;;;;;;;;;;;;16s°-atc-235-atgi-gca
cd083;16s23s5s;2;48;2;46;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
cd084;2*16-gca-235;4;54;4;50;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;'’’cds
;16atcgca-cds-235;;;;;;;;;;;;;;16atcgca-cds-235
;;;;;;;;;;;;;;;
cd089;2*16atcgca235;5;76;6;70;;;;;;;;;;'’’5s en trop
;2*16-gca-235;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
;16s23s5s;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'''autres
cd092;5*16s23s5s;9;68;13;55;;;;;;;;;;16atcgca-cds-235
;2*16atcgca235;;;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;;;
;8aas-16s;43;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd095-118;;;;;;;;Notes 5
cd095;'’’3*16-5s-23s;10;70;16;54;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;'’’16s-5s-atcgca-23s-gta-tta;;;;;;'’’sans;6;1;;2;1;5;2;'’’avant
;'’’16-5s-atcgca-23-aac;;;;;;'’’1-3;2;6;;;1;1;1;'’’gac-ttc-ggc-16s-5s-23s
;'’’2*16-5s-atgf-23s;;;;;;'’’4-8;4;;;;;1;1;'’’15aas-16s5s-atcgca-23s
;16-gcc-235-gta;;;;;;'’’9-23;2;;;4;;1;2;'’’cgg-tgg-16s5s-gcc-23s-5aas
;'’’gac-ttc-ggc-16s-5s-23s;;;;;;'’’24-43;;;;;;;;'’’ttc-cds-16s5s-atc-23s-aac-atgf
;16s-23s;;;;;43;'’’total;14;7;0;6;2;8;6;tcc-16s-cds-235-19aas
;;;;;;;;;;;;;;;tcg-16s23s-gca-5s-12aas
cd102;2*16-gca-235;7;69;55;14;;;;;;;;;;
;2*16s23s5s;;;;;;;;;;;;;;'’’autres
;2*16-gca-235-22,21aas;;;;;;;;;;;;;;16-gcc-235-gta
;16s23s5s-8aas;;;;;;;;;;;;;;'’’2*16s5s-gcc-23s
;;;;;;;;;;;;;;;'’’2*16s5s-gcc-23s-19, 5aas
cd112;16s23s-gca-5s-gta-tac-gga-cga;;;;;;;;;;;;;;'’’2*16-5s-atgf-23s
;tcc-16s-cds-235-19aas;;;;;;;;;;;;;;16s-cds-235
;16s-cds-235;4;48;39;9;;;;;;;;;;'’’3*16-5s-23s
;tcg-16s23s-gca-5s-12aas;;;;;;;;;;;;;;'’’16s-5s-atcgca-23s-gta-tta
;;;;;;;;;;;;;;;'’’16-5s-atcgca-23-aac
cd113;16s-atc-235;4;48;32;16;;;;;;;;;;'’’16s5s-atcgca-23s-aac-atgf
;16s23s5s;;;;;;;;;;;;;;'’’16s5s-atc-23s-aac
;16s-gca-235-11 aas;;;;;;;;;;;;;;
;16s-gca-235-18 aas;;;;;;;;;;;;;;'’’1-3
;;;;;;;;;;;;;;;16-gcc-235-gta
cd114;16atcgca235;4;59;21;38;;;;;;;;;;'’’16s5s-atc-23s-aac
;2*16atcgca235-acc;;;;;;;;;;;;;;'’’16-5s-atcgca-23-aac
;16s23s5s-13 aas;;;;;;;;;;;;;;3*16atcgca235-acc
;;;;;;;;;;;;;;;'’’16s-5s-atcgca-23s-gta-tta
cd116;16s23s5s-aac;5;78;35;43;;;;;;;;;;'’’16s5s-atcgca-23s-aac-atgf
;16s23s5s-caa-gaa-tac-ggc;;;;;;;;;;;;;;16s23s5s-aac
;16atcgca235-acc;;;;;;;;;;;;;;'’’16s5s23s-aaa-acc-ctc
;16s23s5s-8 aas;;;;;;;;;;;;;;
;16s23s5s-21 aas;;;;;;;;;;;;;;'’’incomplets
;;;;;;;;;;;;;;;16s-23s
cd118;'’’2*16s5s-gcc-23s;10;109;67;42;;;;;;;;;;
;'’’16s5s-gcc-23s-19aas;;;;;;;;;;;;;;'’’cds
;'’’16s5s-gcc-23s-5aas;;;;;;;;;;;;;;16s-cds-235
;'’’16s5s23s-aaa-acc-ctc;;;;;;;;;;;;;;tcc-16s-cds-235-19aas
;'’’16s5s-atc-23s-aac;;;;;;;;;;;;;;'’’ttc-cds-16s5s-atc-23s-aac-atgf
;'’’16s5s-atcgca-23s-aac-atgf;;;;;;;;;;;;;;
;'’’15aas-16s5s-atcgca-23s;44;;;;;;;;;;;;;'’’différents
;'’’cgg-tgg-16s5s-gcc-23s-5aas;;;;;;;;;;;;;;16s23s-gca-5s-gta-tac-gga-cga
;'’’ttc-cds-16s5s-atc-23s-aac-atgf;;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd133-153;;;;;;;;Notes 6
cd133;3*16s23s5s;10;85;75;10;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;2*16s-gca-235;;;;;;'’’sans;9;;;2;;;;'’’1-3
;16s23s-gga-5s;;;;;;'’’1-3;4;;;1;;;;16’-gca-235-tta-atgi
;16s23s5s-43aas;;;;;;'’’4-8;;;;;;;;2*16s23s-gga-5s
;16s23s5s-18aas;;;;;;'’’9-23;5;;;1;;;;16s23s5s-tta-atgi
;16s-gca-235-9aas;;;;;;'’’24-43;1;;;;;;;16s23s5s-gtg-gaa-cgg
;16s23s-aca;;;;;23;'’’total;19;0;0;4;0;0;0;
;;;;;;;;;;;;;;;'’’incomplets
cd136;3*16s23s5s;16;110;99;11;;;;;;;;;;2*16s23s-aca
;16s’-gca-23s°-16s°-23s    ;;;;;;;;;;;;;;16s’-gca-23s°-16s°-23s    
;16s°-gca-23s’;;;;;;;;;;;;;;16s-cds-23s°-5s-43aas
;16s23s-gga-5s;;;;;;;;;;;;;;16s23s°-cds
;16s23s-aca;;;;;;;;;;;;;;3*16s-23s°
;16s-cds-23s°-5s-43aas;;;;;;;;;;;;;;16s
;cds-cds-23s°-5s-18aas;;;;;;;;;;;;;;
;16s°-23s°-5s-9aas;;;;;;;;;;;;;;'’’autres incomplets
;;;;;;;;;;;;;;;16s°-gca-23s’
;16s23s5s-19aas;;;;;;;;;;;;;;23s5s
;16s23s5s-tta-atgi;;;;;;;;;;;;;;16s°-23s°-23s’-5s
;16s23s5s;;;;;;;;;;;;;;16s°gca-23s°
;16’-gca-235-tta-atgi;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’cds
;23s5s;;;;;;;;;;;;;;16s-cds-23s°-5s-43aas
;16s;;;;;;;;;;;;;;cds-cds-23s°-5s-18aas
;;;;;;;;;;;;;;;16s23s°-cds
;16s23s°-cds;;;;;;;;;;;;;;
;3*16s-23s°;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;2*16s23s-gga-5s
;16s°-23s°-23s’-5s;;;;;;;;;;;;;;
;23s°-5s;;;;;;;;;;;;;;'’’5s en trop
;16s°gca-23s°;;;;;;;;;;;;;;cds-cds-23s°-5s-18aas
;;;;;;;;;;;;;;;16s°-23s°-5s-9aas
cd153;2*16s23s5s;6;98;40;58;;;;;;;;;;23s°-5s
;16s23s5s-gtg-gaa-cgg;;;;;;;;;;;;;;
;2*16s23s5s-12aas;;;;;;;;;;;;;;
;16s23s5s-13aas;32;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd154-174;;;;;;;;Notes 7
cd154;2*16s-gcc-235;4;55;6;49;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;2*16atcgca235;;;;;;'’’sans;13;7;;;;5;;'’’avant
;;;;;;;'’’1-3;3;1;2;;;1;1;cag-gag-16atcgca235-aac
cd155;16atcgca235;4;48;2;46;;'’’4-8;;;1;;;1;;
;16s23s5s;;;;;;'’’9-23;;;;;;;;'’’autres
;16s23s°23s5s;;;;;;'’’24-43;;;;;;;;2*16s-gcc-235
;16s23s°23s5s-5s-5s;;;;;35;'’’total;16;8;3;0;0;7;1;2*16-cds-atcgca-23s16s°5s
;;;;;;;;;;;;;;;16s-cds-16s°-23s-cds-5s
cd156;16s23s5s;2;47;2;45;;;;;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;16atcgca235;;;;;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
;;;;;;;;;;;;;;;
cd157;16s23s5s-aac;2;106;4;102;;;;;;;;;;'’’1-3
;16-gcaatc-235-aac;;;;;;;;;;;;;;16s23s5s-aac
;;;;;;;;;;;;;;;16s23s5s-aac-ggg
cd158;2*16s23s5s;3;53;3;50;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
;16atcgca235-aac;;;;;;;;;;;;;;16atcgca235-aac
;;;;;;;;;;;;;;;2*16-gcaatc-235-aac
cd159;16atcgca235;2;51;7;44;;;;;;;;;;
;cag-gag-16atcgca235-aac;;;;;;;;;;;;;;'’’cds
;;;;;;;;;;;;;;;2*16-cds-atcgca-23s16s°5s
cd160;2*16-cds-atcgca-23s16s°5s;;53;4;49;;;;;;;;;;16s-cds-16s°-23s-cds-5s
;16s-cds-16s°-23s-cds-5s;3;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’différents
cd161;2*16s23s5s;4;57;10;47;;;;;;;;;;16s23s°23s5s
;16s-23s°-gca-atc-23s-16s°-5s-6aas;;;;;;;;;;;;;;16s23s°23s5s-5s-5s
;23s°-16s-16s°-23s-5s-aac-ggg;;;;;;;;;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;;;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
cd170;3*16s23s5s;5;58;10;48;;;;;;;;;;
;16s23s5s-aac-ggg;;;;;;;;;;;;;;'’’5s en trop
;16-gcaatc-235-6aas;;;;;;;;;;;;;;16s23s°23s5s-5s-5s
;;;;;;;;;;;;;;;
cd173;2*16atcgca235;2;48;4;44;;;;;;;;;;
;;;;;;;;;;;;;;;
cd174;2*16s23s5s;3;53;3;50;;;;;;;;;;
;16-gcaatc-235-aac;34;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Total;;;;;;;;
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;;;;;;;'’’sans;68;14;2;15;5;11;4;
;;;;;;;'’’1-3;63;7;10;4;5;2;4;
;'’’Moyenne;;68;21;48;;'’’4-8;6;1;4;0;0;2;4;
;'’’ecartype;;19;23;19;;'’’9-23;12;0;0;7;0;1;2;
;'’’max;;110;99;102;;'’’24-43;1;0;0;0;0;0;0;
;'’’min;;47;2;9;254;'’’total;150;22;16;26;10;16;14;
;;;;;;;Dont 16s5s-*-23s;5;3;0;1;2;6;6;

clostridia notes[modifier | modifier le wikicode]

Liens aux notes[modifier | modifier le wikicode]
1-3;1-3;1-3;1-3;1-3;1-3;1-3
16s-atc-23s-aac;3*16s23s5s-aaa;16s23s5s-atgi;3*16s23s5s-aaa;16-gcc-235-gta;16’-gca-235-tta-atgi;16s23s5s-aac
16s-gcaatc-23s5s-ttc-tgc;3*16s23s5s-aac;2*16s23s5s-aac;3*16s23s5s-ttc;16s5s-atc-23s-aac;2*16s23s-gga-5s;16s23s5s-aac-ggg
16s5s-gca-23-aac-gaa-tgc;2*16s23s5s-ttc;2*16s23s5s-ttc;4*16s23s5s-aac;16-5s-atcgca-23-aac;16s23s5s-tta-atgi;23s°-16s-16s°-23s-5s-aac-ggg
16235-aaa-cds-5s-aaa;16s23s5s-ggc;5*16s23s5s-aaa;16s23s5s-gaa;3*16atcgca235-acc;16s23s5s-gtg-gaa-cgg;16atcgca235-aac
16s5s23s-gac-aca;16s23s5s-ttc-tgc;3*16s23s5s-atgi-gca;2*16s23s5s-atgi-gca;16s-5s-atcgca-23s-gta-tta;;2*16-gcaatc-235-aac
2*16s23s5s-atgi-gca;16s23s5s-aac-aac;16s23s-aac-5s-aac;3*16s23s5s-atc-gca;16s5s-atcgca-23s-aac-atgf;;
16s23s5s-ttc-gac-gaa;2*16s23s5s-atgi-gca;16s23s5s-atgi-gca-aac;16-gca-atc-235-aaa;16s23s5s-aac;;
2*16s23s-aac-5s;16s23s-aac-5s-aac;16s23s5s-ttc-5s-ttc-aaa;16-gca-atc-23-aac;16s5s23s-aaa-acc-ctc;;
;16s23s5s-ttc-5s-ttc-aaa;16-atc-235-ttc;2*16-gca-atc-235-ttc;;;
;2*16-gca-235-aac;16-atc-235-ttc-tgc;16-gca-atc-235-aac-5s-ttc-tgc ;;;
;16-atc-235-tgg;16-gca-atc-235-aac;;;;
;16-gca-atc-235-aac;16-gca-atc-235-atgi-gca;;;;
avant;avant;avant;avant;avant;avant;avant
5aas-16s-gcaatc-235-6aas;gca-atc-gga-16s23s5s;atgf-16s23s5s;;gac-ttc-ggc-16s-5s-23s;;cag-gag-16atcgca235-aac
agc-16s5s23s-6aas;5s-atgi-gca-16-gca-atc-235-aac-aac;atgi-gca-16s23s5s-aac;;15aas-16s5s-atcgca-23s;;
tca-tcc-16s5s23s-5aas;;;;cgg-tgg-16s5s-gcc-23s-5aas;;
;;;;ttc-cds-16s5s-atc-23s-aac-atgf;;
;;;;tcc-16s-cds-235-19aas;;
;;;;tcg-16s23s-gca-5s-12aas;;
autres;autres;autres;autres;autres;autres;autres
16s5s-atc-23s;;;16atcgca-cds-235;16-gcc-235-gta;;2*16s-gcc-235
16s5s-gca-23-aac-gaa-tgc;;;;2*16s5s-gcc-23s;;2*16-cds-atcgca-23s16s°5s
16s5s23s-gac-aca;;;;2*16s5s-gcc-23s-19, 5aas;;16s-cds-16s°-23s-cds-5s
16s5s23s;;;;2*16-5s-atgf-23s;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;16s-cds-235;;23s°-16s-16s°-23s-5s-aac-ggg
;;;;3*16-5s-23s;;
;;;;16s-5s-atcgca-23s-gta-tta;;
;;;;16-5s-atcgca-23-aac;;
;;;;16s5s-atcgca-23s-aac-atgf;;
;;;;16s5s-atc-23s-aac;;
différents;différents;différents;différents;différents;différents;différents
2*16s23s-aac-5s;16s23s-aac-5s-aac;16s23s5s-ttc-5s-ttc-aaa;16-gca-atc-235-aac-5s-ttc-tgc ;16s23s-gca-5s-gta-tac-gga-cga;2*16s23s-gga-5s;16s23s°23s5s
16235-aaa-cds-5s-aaa;16s23s5s-ttc-5s-ttc-aaa;16s23s-aac-5s-aac;;;;16s23s°23s5s-5s-5s
;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
incomplets;incomplets;incomplets;incomplets;incomplets;incomplets;incomplets
;16s5s-atgi-gca;16s23s;8aas-16s;16s-23s;2*16s23s-aca;
;16s-gca-atc-23s-aac;16-gca-atc-23s;16s-atc-23s;;16s’-gca-23s°-16s°-23s    ;
;;16-gca-atc-23-aac;16-gca-atc-23-aac;;16s-cds-23s°-5s-43aas;
;;;;;16s23s°-cds;
;;;;;3*16s-23s°;
;;;;;16s;
autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets
;;;23s5s-aaa;;16s°-gca-23s’;
;;;16s°-atc-235-atgi-gca;;23s5s;
;;;;;16s°-23s°-23s’-5s;
;;;;;16s°gca-23s°;
cds;cds;cds;cds;cds;cds;cds
16235-aaa-cds-5s-aaa;;;16atcgca-cds-235;16s-cds-235;16s-cds-23s°-5s-43aas;2*16-cds-atcgca-23s16s°5s
;;;;tcc-16s-cds-235-19aas;cds-cds-23s°-5s-18aas;16s-cds-16s°-23s-cds-5s
;;;;ttc-cds-16s5s-atc-23s-aac-atgf;16s23s°-cds;
5s en trop;5s en trop;5s en trop;5s en trop;5s en trop;5s en trop;5s en trop
16235-aaa-cds-5s-aaa;16s23s5s-ttc-5s-ttc-aaa;5s-ttc;16-gca-atc-235-aac-5s-ttc-tgc ;;cds-cds-23s°-5s-18aas;16s23s°23s5s-5s-5s
16-gca-2355;5s-atgi-gca-16-gca-atc-235-aac-aac;16s23s5s-ttc-5s-ttc-aaa;;;16s°-23s°-5s-9aas;
5s-ttc;;;;;23s°-5s;
5s;;;;;;
Cumuls notes[modifier | modifier le wikicode]
30.11.19 Tanger;;;;;;;;;
cumuls Notes;;;;;;;;;
;;;;;;;;;
avant;;;incomplets;;;Type 1-3;;tRNAs;nbre
atgf-16s23s5s;;;16s23s*2;;;16s23s5s;;aaa;11
gca-atc-gga-16s23s5s;;;16s23s-aca*2;;;;;aac;11
atgi-gca-16s23s5s-aac;;;16-gcaatc-23s;;;;;ttc;7
;;;16s-gcaatc-23s-aac*3;;;;;ggc;1
cag-gag-16-atcgca-235-aac;;;16s-atc-23s;;;;;atgi;1
5aas-16s-gcaatc-235-6aas;;;16s’-gca-23s°-16s°-23s    ;;;;;gaa;1
5s-atgi-gca-16-gcaatc-235-aac-aac;;;;;;;;atgi-gca;9
tcg-16s23s-gca-5s-12aas;;;16s5s-atgi-gca;;;;;atc-gca;3
;;;16s-cds-23s°-5s-43aas;;;;;ttc-tgc;1
tcc-16s-cds-235-19aas;;;;;;;;aac-aac;1
;;;16s;;;;;tta-atgi;1
gac-ttc-ggc-16s5s23s;;;8aas-16s;;;;;aac-ggg;1
tca-tcc-16s5s23s-5aas;;;16s-23s° *3;;;;;gac-aca;1
agc-16s5s23s-6aas;;;16s23s°-cds;;;;;aaa-cds-5s-aaa;1
15aas-16s5s-atcgca-23s;;;;;;;;atgi-gca-aac;1
ttc-cds-16s5s-atc-23s-aac-atgf;;;autres incomplets;;;;;gtg-gaa-cgg;1
cgg-tgg-16s5s-gcc-23s-5aas;;;23s5s-aaa;;;;;ttc-gac-gaa;1
;;;23s5s;;;;;ttc-5s-ttc-aaa;2
autres;;;16s°-23s°-23s’-5s;;;;;aaa-acc-ctc;1
16s5s23s*4;;;16s°-atc-235-atgi-gca;;;;;;
16s5s23s-gac-aca;;;16s°-gca-23s’;;;16s23s-gga-5s;;gga;2
16-5s-atcgca-23-aac;;;16s°gca-23s°;;;;;aac;2
16s-5s-atcgca-23s-gta-tta;;;;;;16s23s-aac-5s-aac;;aac-aac;2
16s5s-atcgca-23s-aac-atgf;;;cds;;;23s°-16s-16s°-23s5s;;aac-ggg;1
16s5s-gca-23-aac-gaa-tgc;;;16s-cds-235;;;;;;
16s5s-atc-23s;;;tcc-16s-cds-235-19aas;;;;;;
16s5s-atc-23s-aac;;;16-atcgca-cds-235;;;16-atcgca-235;;aac;4
;;;;;;;;aac;1
16s-gcc-235*2;;;16s-cds-23s°-5s-43aas;;;;;gta-tta;1
16-gcc-235-gta;;;16s-cds-16s°-23s-cds-5s;;;;;aac-atgf;1
16s5s-gcc-23s*2;;;16-cds-atcgca-23s16s°5s*2;;;;;;
16s5s-gcc-23s-19, 5aas*2;;;;;;16-gcaatc-235;;aac;4
16-5s-atgf-23s*2;;;16235-aaa-cds-5s-aaa;;;;;ttc;2
;;;ttc-cds-16s5s-atc-23s-aac-atgf;;;;;aaa;1
16s-cds-235;;;;;;;;atgi-gca;1
16-atcgca-cds-235;;;16s23s°-cds;;;;;ttc-tgc;1
16-cds-atcgca-23s16s°5s*2;;;cds-cds-23s°-5s-18aas;;;;;aac-5s-ttc-tgc ;1
16s-cds-16s°-23s-cds-5s;;;;;;16-gcaatc-23-aac;;aac;1
23s°-16s-16s°-23s-5s-aac-ggg;;;5s en trop;;;;;;
16s-23s°-gca-atc-23s-16s°-5s-6aas;;;16s23s5s-ttc-5s-ttc-aaa*2;;;16s-atc-235;;aac;1
;;;16-gca-2355;;;;;tgg;1
différents;;;16-gca-atc-235-aac-5s-ttc-tgc ;;;;;ttc;1
16s23s-gga-5s*2;;;5s-atgi-gca-16-gca-atc-235-aac-aac;;;;;ttc-tgc;1
16s23s-aac-5s*2;;;;;;16s-atc-23-aac;;aac;1
16s23s-aac-5s-aac*2;;;16s°-23s°-5s-9aas;;;;;;
16s23s5s-ttc-5s-ttc-aaa*2;;;16s23s°23s5s-5s-5s;;;16-gca-235;;aac;2
16s23s-gca-5s-gta-tac-gga-cga;;;;;;;;aac-gaa-tgc;1
;;;cds-cds-23s°-5s-18aas;;;16s’-gca-235;;tta-atgi;1
16-gcaatc-235-aac-5s-ttc-tgc ;;;16235-aaa-cds-5s-aaa;;;;;;
16s-23s°-gcaatc-23s-16s°-5s-6aas;;;;;;16-gcc-235;;gta;1
;;;23s°-5s;;;;;;
16s23s°23s5s;;;2*5s-ttc;;;total;;;91
16s23s°23s5s-5s-5s;;;5s;;;;;;
23s°-16s-16s°-23s5s-aac-ggg;;;;;;;;;
16235-aaa-cds-5s-aaa;;;;;;;;;

clostridia typage[modifier | modifier le wikicode]

clostridia blocs intégrés[modifier | modifier le wikicode]
avant inversé;;16s23s5s;atcgca;gcaatc;gca;atc;gcc;atgf;autres-cds;total
-;'’’sans;68;14;2;15;5;4;2;5;115
5;'’’1-3;63;7;10;4;5;1;0;1;91
5;'’’4-8;6;1;4;0;;1;;1;13
4;'’’9-23;12;;;7;;1;;;20
;'’’24-43;1;;;;;;;;1
14;'’’total;150;22;16;26;10;7;2;7;240
6;Dont 16s5s-*-23s;5;3;0;1;2;4;2;0;17
clostridia blocs 1-3[modifier | modifier le wikicode]
total 1-3;;16s23s5s;;16s-*-23s5s;
aac;39;aac;22;aac;17
ttc;19;aaa;16;ttc;6
aaa;17;gca;13;tgc;4
gca;14;ttc;13;atgi;2
atgi;13;atgi;11;gta;2
tgc;5;5s;3;tta;2
5s;4;atc;3;5s;1
gaa;4;gaa;3;aaa;1
atc;3;ggg;3;atgf;1
ggg;3;gac;2;gaa;1
tta;3;gga;2;gca;1
gac;2;aca;1;tgg;1
gga;2;acc;1;total;39
gta;2;cds;1;;
aca;1;cgg;1;;
acc;1;ctc;1;;
atgf;1;ggc;1;;
cds;1;gtg;1;;
cgg;1;tgc;1;;
ctc;1;tta;1;;
ggc;1;total;100;;
gtg;1;;;;
tgg;1;;;;
total;139;;;;
clostridia blocs 4-8[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs 4-8
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
cd002;cd064;cd118;cd001;cd002;cd045;cd063;cd161;cd170;cd092;cd102;cd116
4;5;5;6;6;6;6;6;6;8;8;8
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;5s;gca;atc;gca;gca;23s°;gca;;23s;23s
5s;5s;gcc;atc;gca;atc;atc;gca;atc;;5s;5s
;;23s;23s;23s;23s;23s;atc;23s;;;
;;;5s;5s;5s;5s;23s;5s;;;
;;;;;;;16s°;;;;
;;;;;;;5s;;;;
caa;gaa;caa;aac;aac;gaa;gaa;aac;aac;gac;gaa;caa
gaa;cta;aaa;gaa;caa;cta;cta;gaa;gaa;tca;gta;gaa
tac;ggc;gaa;gac;gta;gga;gga;atgi;atgi;acc;gac;gta
ggc;gga;gta;aca;gac;aga;aga;gac;gac;agc;aca;gac
;aga;gac;tac;aca;caa;caa;ttc;ttc;aac;tac;aca
;;;aaa;aaa;gag;gag;acg;acg;gga;cta;aaa
;;;;;;;;;tgc;ggc;gga
;;;;;;;;;tta;gga;cca
clostridia blocs 9-23[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs 9-23
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
cd002;cd003;cd133;cd136;cd113;cd002;cd153;cd153;cd003;cd003;cd114;cd153;cd113;cd133;cd136;cd118;cd136;cd102;cd116;cd003;cd003;cd102;cd133;cd136
9;9;9;9;11;12;12;12;13;13;13;13;18;18;18;19;19;21;21;22;22;22;43;43
16s;16s;16s;16s°;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;cds;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;gca;23s°;gca;23s;23s;23s;gca;23s;23s;23s;gca;23s;23s°;5s;23s;gca;23s;23s;gca;gca;23s;cds
5s;5s;23s;5s;23s;5s;5s;5s;23s;5s;5s;5s;23s;5s;5s;gcc;5s;23s;5s;5s;23s;23s;5s;23s°
;;5s;;5s;;;;5s;;;;5s;;;23s;;5s;;;5s;5s;;5s
;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;
caa;gaa;aac;aac;aac;caa;aac;cag;aac;aac;caa;aag;aac;aac;aac;tcc;aac;aac;caa;atgf;aac;aac;aac;aac
gaa;gta;tta;tta;tta;gaa;ggc;gag;tta;tta;aaa;gag;tta;gaa;gaa;ccg;tta;atgf;gaa;gaa;tta;tta;tta;tta
gta;aca;atgf;atgf;atgf;gta;atgj;ctc;atgf;atgf;atgf;atgj;atgf;gta;gta;gga;atgf;gaa;gta;gta;atgf;atgf;atgf;atgf
gac;gga;gaa;gaa;atgj;gac;ttc;ctg;atgj;gaa;gga;ttc;gaa;gac;gac;cac;gaa;gta;gac;gac;gaa;gaa;gaa;gaa
aca;aga;gga;gga;gaa;aca;tac;acc;gaa;gta;atgj;tac;gta;aca;aca;tgc;gga;gac;aca;aca;gta;gta;gga;gga
aaa;caa;gta;gta;gta;aaa;ggc;cgt;gta;gac;agc;ggc;gac;tac;tac;gtc;gta;aca;aaa;gga;gac;gac;gta;gta
atgf;aaa;gac;gac;gac;atgf;gtc;cgg;gac;aca;gaa;gcc;aca;gga;gga;ttc;gac;tac;atgf;aga;aca;aca;gac;gac
gga;atc;ggc;ggc;aca;ttc;gac;tgg;tac;tac;gta;gtc;tac;aga;aga;tac;aca;gga;ttc;caa;tac;cta;aca;aca
cca;ttc;aga;aga;tac;cta;ctg;cac;cta;cta;gac;gac;gga;caa;caa;caa;tac;aga;cta;aaa;cta;ggc;tac;tac
;;;;ggc;gga;atc;gcc;ggc;ggc;acc;ctg;aga;aaa;aaa;aaa;cta;caa;gga;tca;ggc;aga;cta;cta
;;;;cgt;aga;acg;ccc;cac;aaa;gcc;acc;gaa;tca;tca;gaa;aga;aaa;aga;agc;aaa;caa;aga;aga
;;;;;cac;tcg;ccg;tgc;atc;tac;atc;aaa;agc;agc;gta;caa;tca;cac;cca;cta;aaa;caa;caa
;;;;;;;;cgt;ttc;ggc;atgf;tca;cca;cca;gac;tca;ttc;gaa;atgi;agc;tca;tca;tca
;;;;;;;;;;;;agc;tgg;tgg;agc;ttc;atgj;gta;tgg;cca;agc;ttc;ttc
;;;;;;;;;;;;atgi;cca;cca;ccc;atgj;atgi;gcc;cca;atgi;cca;atgj;atgj
;;;;;;;;;;;;ttc;atc;atc;ctg;atgi;cca;aaa;atc;tgg;atc;atgi;atgi
;;;;;;;;;;;;tgg;ttc;ttc;ggc;cca;cac;atgf;ttc;cca;atgi;cca;cca
;;;;;;;;;;;;cgg;atg;atgj;cgt;cac;aaa;ttc;atgj;atc;tgg;cac;aca
;;;;;;;;;;;;;;;acc;aaa;tgc;gga;atgf;ttc;cca;aaa;aaa
;;;;;;;;;;;;;;;;;cta;aga;gac;atgf;atgi;tgc;tgc
;;;;;;;;;;;;;;;;;cgt;cac;aca;atgj;ttc;aac;aac
;;;;;;;;;;;;;;;;;;;gga;gga;atgj;tta;tta
;;;;;;;;;;;;;;;;;;;;;;atgf;atgf
;;;;;;;;;;;;;;;;;;;;;;gaa;gaa
;;;;;;;;;;;;;;;;;;;;;;gga;gga
;;;;;;;;;;;;;;;;;;;;;;gta;gta
;;;;;;;;;;;;;;;;;;;;;;gac;gac
;;;;;;;;;;;;;;;;;;;;;;aca;aca
;;;;;;;;;;;;;;;;;;;;;;tac;tac
;;;;;;;;;;;;;;;;;;;;;;cta;cta
;;;;;;;;;;;;;;;;;;;;;;ggc;ggc
;;;;;;;;;;;;;;;;;;;;;;aga;aga
;;;;;;;;;;;;;;;;;;;;;;caa;caa
;;;;;;;;;;;;;;;;;;;;;;aaa;aaa
;;;;;;;;;;;;;;;;;;;;;;tca;tca
;;;;;;;;;;;;;;;;;;;;;;ttc;ttc
;;;;;;;;;;;;;;;;;;;;;;atgj;atgj
;;;;;;;;;;;;;;;;;;;;;;atgi;atgi
;;;;;;;;;;;;;;;;;;;;;;cac;cac
;;;;;;;;;;;;;;;;;;;;;;aaa;aaa
;;;;;;;;;;;;;;;;;;;;;;tgc;tgc
;;;;;;;;;;;;;;;;;;;;;;cgt;cgt
;;;;;;;;;;;;;;;;;;;;;;gta;gta
clostridia blocs avant[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs avant
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
;;;;;;cd112;;;cd112
cd011;cd011;cd118;cd001;;;14;;;20
7;7;17;13;;cd002;tcg;;cd136;tcc
agc;tca;tgc;gta;;12;16s;;19;16s
16s;tcc;gtc;gac;;16s;23s;;16s;cds
5s;16s;tac;ttc;;23s;gca;;23s;23s
23s;5s;caa;ggc;;5s;5s;;5s;5s
gac;23s;aaa;tgc;;caa;gaa;;aac;aac
gta;aac;gaa;16s;;gaa;gta;;tta;tta
aca;gaa;aac;gca;;gta;gac;;atgf;atgf
tac;atgi;atgf;atc;;gac;aca;;gaa;gaa
atgf;gta;agc;23s;;aca;tac;;gga;gta
ttc;tta;atgj;5s;;aaa;gga;;gta;gac
;;ggc;aac;;atgf;aaa;;gac;aca
;;cgt;gaa;;ttc;aag;;aca;cta
;;ccc;gac;;cta;agc;;tac;ggc
;;ctg;aca;;gga;cca;;cta;aga
;;ggc;tac;;aga;atc;;aga;caa
;;16s;aaa;;cac;tgg;;caa;aaa
;;5s;;;;;;tca;tca
;;atc;;;;;;ttc;ttc
;;gca;;;;;;atgj;atgj
;;23s;;;;;;atgi;atgi
;;;;;;;;cca;cac
;;;;;;;;cac;tgc
;;;;;;;;aaa;agg
clostridia total blocs longs[modifier | modifier le wikicode]
clostridia total blocs longs;;effectifs;;;;;;;clostridia total blocs longs;;Pour 1000;;;;;
tot;;568;;atgf;;26;;;tot;;1000;;atgf;;46;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
atc;10;acc;5;aac;26;agc;12;;atc;18;acc;9;aac;46;agc;21
ctc;1;ccc;3;cac;12;cgt;8;;ctc;2;ccc;5;cac;21;cgt;14
gtc;4;gcc;4;gac;38;ggc;21;;gtc;7;gcc;7;gac;67;ggc;37
ttc;25;tcc;3;tac;24;tgc;11;;ttc;44;tcc;5;tac;42;tgc;19
atgi;15;aca;28;aaa;31;aga;21;;atgi;26;aca;49;aaa;55;aga;37
cta;18;cca;17;caa;24;cga;0;;cta;32;cca;30;caa;42;cga;0
gta;35;gca;0;gaa;40;gga;28;;gta;62;gca;0;gaa;70;gga;49
tta;16;tca;14;taa;0;tga;0;;tta;28;tca;25;taa;0;tga;0
atgj;18;acg;3;aag;2;agg;1;;atgj;32;acg;5;aag;4;agg;2
ctg;5;ccg;2;cag;1;cgg;2;;ctg;9;ccg;4;cag;2;cgg;4
gtg;0;gcg;0;gag;4;ggg;0;;gtg;0;gcg;0;gag;7;ggg;0
ttg;0;tcg;2;tag;0;tgg;8;;ttg;0;tcg;4;tag;0;tgg;14

bacilli-clostridia[modifier | modifier le wikicode]

B-C total blocs longs[modifier | modifier le wikicode]

+ grande variation du pour 1000;;;Bacilli-clostridia;;atgf;4;
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;
;;;;;;;
atc;56;acc;30;aac;9;agc;3
ctc;355;ccc;-5;cac;43;cgt;233
gtc;-5;gcc;-6;gac;-18;ggc;56
ttc;-22;tcc;225;tac;-32;tgc;-13
;;;;;;;
atgi;-131;aca;1;aaa;-14;aga;-6366
cta;-3;cca;47;caa;-7;cga;0
gta;4;gca;3602;gaa;-32;gga;-69
tta;20;tca;11;taa;0;tga;0
;;;;;;;
atgj;-73;acg;-4;aag;-4;agg;-2
ctg;-40;ccg;-4;cag;-2;cgg;-4
gtg;0;gcg;0;gag;-7;ggg;1
ttg;1830;tcg;-2;tag;0;tgg;70

Autres firmicutes[modifier | modifier le wikicode]

Autres firmicutes blocs[modifier | modifier le wikicode]

autres firmicutes blocs;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;en004-9;;;;;Notes
en002;3*16s23s5s;;3;53;0;53;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;5s;;;;;;;'''sans;19;4;;3;'''1-3
;;;;;;;;'''1-3;4;2;;;16s23s5s-cds-tgc-taa 
;;;;;;;;'''4-8;;;;;16s23s5s-cds-tac-caa
en003;16s23s5s-CDS-tgc-taa ;;;40;2;38;;'''9-23;1;3;;;16235-aac-gaa-acg
;;;1;;;;;'''24-43;;;;;16atcgca235-tgg-cgt
;;;;;;;36;'''total;24;9;0;3;16atcgca235-aac
en004;16s23s5s;;7;77;63;14;;;;;;;
;16atcgca235-9aas;;;;;;;;;;;;'''cds
;2*16atcgca235-12aas;;;;;;;;;;;;16s23s5s-cds-tgc-taa 
;16235-19aas;;;;;;;;;;;;16s23s5s-cds-tac-caa
;16s23s5s-cds-tac-caa;;;;;;;;;;;;
;16235-aac-gaa-acg;;;;;;;;;;;;'''5s en trop
;;;;;;;;;;;;;16s23s5s-5s
;;;;;;;;;;;;;5s
en005;4*16s23s5s;;6;60;4;56;;;;;;;
;2*16atcgca235;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en006;3*16s23s5s;;3;53;0;53;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en008;4*16s23s5s;;7;65;6;59;;;;;;;
;2*16-gca-235;;;;;;;;;;;;
;16atcgca235-tgg-cgt;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en009;3*16s23s5s;;9;77;9;68;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;
;16atcgca235-aac;;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;
;16s23s5s-5s;;;;;;;;;;;;
;;;36;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;en010-13;;;;;Notes
en010;6*16s23s5s;;15;99;28;71;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;3*16atcgca235;;;;;;;'''sans;15;4;1;1;'''1-3
;16-gca-235;;;;;;;'''1-3;2;2;1;1;16-gca-235-aac
;16s23s5s-5s;;;;;;;'''4-8;;;;;16-gcaatc-235-cac-tgg-agc
;16-gca-235-aac;;;;;;;'''9-23;1;;1;;16atcgca235-aac
;16atcgca235-aac;;;;;;;'''24-43;;;;;16atcgca235-tgg-cgt
;16s23s5s-acc;;;;;;29;'''total;18;6;3;2;16s23s5s-acc
;16s-23s°;;;;;;;;;;;;16s23s5s-cac-tgg
;gga-5s-5aas-ncRNA-9aas;;;;;;;;;;;;
;;;;;;;;;;;;;'''incomplets
en011;4*16s23s5s;;7;73;20;53;;;;;;;16s23s
;16-gcaatc-235-cac-tgg-agc;;;;;;;;;;;;16s-23s°
;16-gcaatc-2355-13 aas;;;;;;;;;;;;
;16s23s;;;;;;;;;;;;'''5s en trop
;;;;;;;;;;;;;16s23s5s-5s
en012;16s23s5s;;4;55;16;39;;;;;;;gga-5s-5aas-ncRNA-9aas
;16-gca-atc-235;;;;;;;;;;;;16-gcaatc-2355-13 aas
;16s23s5s-cac-tgg;;;;;;;;;;;;
;16s23s5s-12aas;;;;;;;;;;;;
;;;;;;;;;;;;;
en013;2*16s23s5s;;4;49;6;43;;;;;;;
;16atcgca235;;;;;;;;;;;;
;16atcgca235-tgg-cgt;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;30;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total pages;total;;;;;Notes
;;;;701;154;547;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;;;;;;;;'''sans;34;8;1;4;
;;;;;;;;'''1-3;6;4;1;1;
;'''Moyenne;;;64;14;50;;'''4-8;0;0;0;0;
;'''ecartype;;;17;19;16;;'''9-23;2;3;1;0;
;'''max;;;99;63;71;;'''24-43;;;;;
;'''min;;;40;0;14;65;'''total;42;15;3;5;

Noms firmicutes[modifier | modifier le wikicode]

;2.9.19 Paris;fait vers le 20.8.19;;;;;;
Firmicutes;;;;;génomes;ruptures;faits;total
NCBI 1;https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009902;;;;total;324;86;850
NCBI 2;https://www.ncbi.nlm.nih.gov/nuccore/NC_000964.3;;;;bacilli;189;32;663
;;;;;clostridia;123;43;174
notes;x*y;KEGG;;;autres;12;11;13
rRNAs;(5S, 16S, 23S);;;;total tRNAs;61644;;
;;;;;;;;
ruptures;notes;rRNAs;fait;code;tRNAs;génomes;;
1;;444;1;bc001;60;Aerococcus urinae ACS-120-V-Col10a ;;
1;;666;1;bc002;65;Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ;;
;;;;bc003;64;Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1 ;;
1;;666;1;bc004;56;Amphibacillus xylanus NBRC 15112 ;;
1;;;;bc005;77;Anoxybacillus flavithermus WK1 ;;
1;;;;bc006;87;Bacillus amyloliquefaciens CC178 ;;
;;;;bc007;94;Bacillus amyloliquefaciens DSM 7 ;;
;;10,10,10;1;bc008;95;Bacillus amyloliquefaciens IT-45 ;;
;;;;bc009;85;Bacillus amyloliquefaciens L-H15 ;;
;;;;bc010;92;Bacillus amyloliquefaciens L-S60 ;;
;;;;bc011;94;Bacillus amyloliquefaciens LFB112 ;;
;;;;bc012;72;Bacillus amyloliquefaciens LL3 ;;
;;;;bc013;72;Bacillus amyloliquefaciens SQR9 ;;
1;;10,8,10;1;bc014;89;Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19 ;;
1;;10,9,10;1;bc015;89;Bacillus amyloliquefaciens subsp. plantarum AS43.3 ;;
;;;;bc016;95;Bacillus amyloliquefaciens subsp. plantarum CAU B946 ;;
;;;;bc017;90;Bacillus amyloliquefaciens subsp. plantarum FZB42 ;;
;;;;bc018;92;Bacillus amyloliquefaciens subsp. plantarum NAU-B3 ;;
;;;;bc019;81;Bacillus amyloliquefaciens subsp. plantarum NJN6 ;;
;;;;bc020;77;Bacillus amyloliquefaciens subsp. plantarum TrigoCor1448 ;;
;;;;bc021;86;Bacillus amyloliquefaciens subsp. plantarum UCMB5033 UCMB-5033 ;;
;;;;bc022;89;Bacillus amyloliquefaciens subsp. plantarum UCMB5036 ;;
;;;;bc023;89;Bacillus amyloliquefaciens subsp. plantarum UCMB5113 ;;
;;;;bc024;92;Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2 ;;
;;666;1;bc025;70;Bacillus amyloliquefaciens TA208 ;;
;;;;bc026;75;Bacillus amyloliquefaciens XH7 ;;
;;;;bc027;88;Bacillus amyloliquefaciens Y2 ;;
1;;;;bc028;96;Bacillus anthracis 2000031021 ;;
;NCBI 1;11,11,11;1;bc029;112;Bacillus anthracis 2002013094 ;;
;;;;bc030;95;Bacillus anthracis A0157 ;;
;;;;bc031;96;Bacillus anthracis A1144 ;;
;;;;bc032;95;Bacillus anthracis Ames A0462 ;;
;;;;bc033;98;Bacillus anthracis Ames BA1004 ;;
1;;10,10,10;1;bc034;94;Bacillus anthracis BA1015 ;;
;;;;bc035;96;Bacillus anthracis BA1035 ;;
;;;;bc036;95;Bacillus anthracis BFV ;;
;;;;bc037;83;Bacillus anthracis Canadian bison ;;
;;;;bc038;95;Bacillus anthracis Cvac02 ;;
;;;;bc039;107;Bacillus anthracis delta Sterne ;;
;;;;bc040;95;Bacillus anthracis Han ;;
;;;;bc041;96;Bacillus anthracis HYU01 ;;
;;;;bc042;96;Bacillus anthracis K3 ;;
;;;;bc043;101;Bacillus anthracis Ohio ACB ;;
;;;;bc044;98;Bacillus anthracis PAK-1 ;;
;;;;bc045;96;Bacillus anthracis Pasteur ;;
;;;;bc046;95;Bacillus anthracis Pollino ;;
;;;;bc047;94;Bacillus anthracis RA3 ;;
;;;;bc048;97;Bacillus anthracis SK-102 ;;
;;;;bc049;95;Bacillus anthracis str. A0248 ;;
;;;;bc050;93;Bacillus anthracis str. A16 ;;
;;;;bc051;93;Bacillus anthracis str. A16R ;;
;;;;bc052;33;Bacillus anthracis str. A2012 ;;
;;;;bc053;95;Bacillus anthracis str. Ames ;;
;;;;bc054;95;Bacillus anthracis str. Ames Ancestor A2084 ;;
;;;;bc055;97;Bacillus anthracis str. CDC 684 ;;
;;;;bc056;96;Bacillus anthracis str. H9401 ;;
;2*95;;;bc057;190;Bacillus anthracis str. Sterne ;;
;;;;bc058;96;Bacillus anthracis str. SVA11 ;;
;;;;bc059;99;Bacillus anthracis str. Turkey32 ;;
;;;;bc060;96;Bacillus anthracis str. V770-NP-1R ;;
;;;;bc061;95;Bacillus anthracis str. Vollum ;;
;;;;bc062;95;Bacillus anthracis Vollum 1B ;;
1;;777;1;bc063;75;Bacillus atrophaeus 1942 ;;
;;;;bc064;81;Bacillus atrophaeus NRS 1221A ;;
;;888;1;bc065;80;Bacillus atrophaeus subsp. globigii BSS ;;
1;;13,13,13;1;bc066;95;Bacillus bombysepticus str. Wang ;;
1;;10,10,10;1;bc067;83;Bacillus cellulosilyticus DSM 2522 ;;
1;2*106;;;bc068;212;Bacillus cereus 03BB102 ;;
;;;;bc069;105;Bacillus cereus 03BB108 ;;
;;;;bc070;107;Bacillus cereus 03BB87 ;;
;;;;bc071;108;Bacillus cereus 3a ;;
;;;;bc072;106;Bacillus cereus AH187 ;;
;;;;bc073;97;Bacillus cereus AH820 ;;
;;14,14,14;1;bc074;118;Bacillus cereus Al Hakam ;;
;;;;bc075;99;Bacillus cereus ATCC 10987 ;;
;;;;bc076;108;Bacillus cereus ATCC 14579 ;;
;;;;bc077;107;Bacillus cereus ATCC 4342 ;;
;;;;bc078;108;Bacillus cereus B4264 ;;
;;;;bc079;102;Bacillus cereus biovar anthracis str. CI ;;
;;;;bc080;105;Bacillus cereus D17 ;;
;96+103;;;bc081;199;Bacillus cereus E33L ;;
;;;;bc082;105;Bacillus cereus F837/76 ;;
;;;;bc083;102;Bacillus cereus FM1 ;;
;;;;bc084;106;Bacillus cereus FORC 005 ;;
;;;;bc085;107;Bacillus cereus FRI-35 ;;
;;;;bc086;92;Bacillus cereus FT9 ;;
;;;;bc087;105;Bacillus cereus G9241 ;;
;;;;bc088;99;Bacillus cereus G9842 ;;
;;;;bc089;106;Bacillus cereus NC7401 ;;
;;13,13,13;1;bc090;95;Bacillus cereus Q1 ;;
;;;;bc091;106;Bacillus cereus S2-8 ;;
1;;;;bc092;75;Bacillus clausii KSM-K16 ;;
1;;;;bc093;73;Bacillus coagulans 2-6 ;;
;;;;bc094;85;Bacillus coagulans 36D1 ;;
;;;;bc095;86;Bacillus coagulans DSM 1 ATCC 7050 ;;
;;;;bc096;85;Bacillus coagulans HM-08 ;;
1;;13,13,13;1;bc097;107;Bacillus cytotoxicus NVH 391-98 ;;
1;;;;bc098;78;Bacillus halodurans C-125 ;;
1;;;;bc099;88;Bacillus infantis NRRL B-14911 ;;
1;;;;bc100;69;Bacillus lehensis G1 ;;
1;;;;bc101;73;Bacillus licheniformis 9945A ;;
;;;;bc102;73;Bacillus licheniformis BL-09 ;;
;74*2;;;bc103;148;Bacillus licheniformis DSM 13 ATCC 14580 ;;
1;;;;bc104;116;Bacillus megaterium DSM 319 ;;
;;;;bc105;128;Bacillus megaterium NBRC 15308 ATCC 14581 ;;
;bmq;;;bc106;142;Bacillus megaterium QM B1551 ;;
;;;;bc107;119;Bacillus megaterium WSH-002 ;;
1;;;;bc108;92;Bacillus methanolicus MGA3 ;;
1;;;;bc109;82;Bacillus methylotrophicus JS25R ;;
1;bmyc;;;bc110;118;Bacillus mycoides 219298 ;;
;;;;bc111;107;Bacillus mycoides ATCC 6462 ;;
1;;;;bc112;78;Bacillus pseudofirmus OF4 ;;
1;;;;bc113;81;Bacillus pumilus MTCC B6033 ;;
;;;;bc114;70;Bacillus pumilus SAFR-032 ;;
;;;;bc115;70;Bacillus pumilus W3 ;;
1;;;;bc116;69;Bacillus selenitireducens MLS10 ;;
1;;;;bc117;91;Bacillus sp. 1NLA3E ;;
1;;;;bc118;87;Bacillus sp. BH072 ;;
1;;;;bc119;86;Bacillus sp. BS34A ;;
1;;;;bc120;86;Bacillus sp. JS ;;
1;;;;bc121;86;Bacillus sp. LM 4-2 ;;
1;;;;bc122;83;Bacillus sp. OxB-1 ;;
1;;;;bc123;84;Bacillus sp. Pc3 ;;
1;;;;bc124;81;Bacillus sp. WP8 ;;
1;gst;12,12,12;1;bc125;123;Bacillus sp. X12014 ;;
1;;;;bc126;87;Bacillus sp. YP1 ;;
1;;;;bc127;72;Bacillus subtilis ATCC 13952 ;;
;;;;bc128;72;Bacillus subtilis ATCC 19217 ;;
;;;;bc129;59;Bacillus subtilis B-1 ;;
;;;;bc130;92;Bacillus subtilis BEST7003 ;;
;NCBI 2;;;bc131;130;Bacillus subtilis BEST7613 ;;
;;;;bc132;86;Bacillus subtilis Bs-916 ;;
;;;;bc133;86;Bacillus subtilis BS49 ;;
;;;;bc134;83;Bacillus subtilis BSn5 ;;
;;;;bc135;71;Bacillus subtilis HJ5 ;;
;;;;bc136;86;Bacillus subtilis KCTC 1028 ;;
;;;;bc137;86;Bacillus subtilis PS832 ;;
;;;;bc138;86;Bacillus subtilis PY79 ;;
;;;;bc139;86;Bacillus subtilis QB928 ;;
;;;;bc140;84;Bacillus subtilis SG6 ;;
;;;;bc141;88;Bacillus subtilis subsp. natto BEST195 ;;
;;;;bc142;77;Bacillus subtilis subsp. spizizenii NRS 231 ;;
;;;;bc143;77;Bacillus subtilis subsp. spizizenii str. W23 ;;
;;;;bc144;92;Bacillus subtilis subsp. spizizenii TU-B-10 ;;
;;;;bc145;86;Bacillus subtilis subsp. subtilis 3NA ;;
;;;;bc146;86;Bacillus subtilis subsp. subtilis 6051-HGW ;;
;2*86;10,10,10;1;bc147;172;Bacillus subtilis subsp. subtilis str. 168 ;;
;;;;bc148;86;Bacillus subtilis subsp. subtilis str. AG1839 ;;
;;;;bc149;89;Bacillus subtilis subsp. subtilis str. BAB-1 ;;
;;;;bc150;86;Bacillus subtilis subsp. subtilis str. BSP1 ;;
;;;;bc151;86;Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 ;;
;;;;bc152;80;Bacillus subtilis subsp. subtilis str. OH 131.1 ;;
;;;;bc153;86;Bacillus subtilis subsp. subtilis str. RO-NN-1 ;;
;;;;bc154;77;Bacillus subtilis T30 ;;
;;;;bc155;77;Bacillus subtilis XF-1 ;;
1;;;;bc156;105;Bacillus thuringiensis 97-27 ;;
;;;;bc157;104;Bacillus thuringiensis BMB171 ;;
;btg;14,14,14;1;bc158;142;Bacillus thuringiensis Bt407 ;;
;;;;bc159;99;Bacillus thuringiensis HD-771 ;;
;;;;bc160;122;Bacillus thuringiensis HD-789 ;;
;;;;bc161;134;Bacillus thuringiensis HD1002 ;;
;;;;bc162;104;Bacillus thuringiensis HD1011 ;;
;;;;bc163;104;Bacillus thuringiensis HD571 ;;
;;;;bc164;105;Bacillus thuringiensis HD682 ;;
;;15,15,15;1;bc165;78;Bacillus thuringiensis MC28 ;;
;;;;bc166;86;Bacillus thuringiensis serovar chinensis CT-43 ;;
;;;;bc167;108;Bacillus thuringiensis serovar finitimus YBT-020 ;;
;;;;bc168;115;Bacillus thuringiensis serovar galleriae HD-29 ;;
;;;;bc169;105;Bacillus thuringiensis serovar konkukian str. 97-27 ;;
;;;;bc170;108;Bacillus thuringiensis serovar kurstaki HD 1 ;;
;;;;bc171;98;Bacillus thuringiensis serovar kurstaki str. HD-1 ;;
;;;;bc172;104;Bacillus thuringiensis serovar kurstaki str. HD73 ;;
;99+108;;;bc173;207;Bacillus thuringiensis serovar kurstaki str. YBT-1520 ;;
;;;;bc174;98;Bacillus thuringiensis serovar morrisoni BGSC 4AA1 ;;
;;;;bc175;86;Bacillus thuringiensis serovar thuringiensis str. IS5056 ;;
;;;;bc176;104;Bacillus thuringiensis str. Al Hakam ;;
;;;;bc177;95;Bacillus thuringiensis YBT-1518 ;;
1;;;;bc178;98;Bacillus toyonensis BCT-7112 ;;
1;;;;bc179;108;Bacillus weihenstephanensis KBAB4 ;;
;;;;bc180;79;Bacillus weihenstephanensis WSBC 10204 ;;
1;bbe;;;bc181;127;Brevibacillus brevis NBRC 100599 NBRC 100599 47 ;;
1;blr;;;bc182;113;Brevibacillus laterosporus LMG 15441 ;;
1;;;;bc183;59;Carnobacterium maltaromaticum LMA28 ;;
1;;;;bc184;67;Carnobacterium sp. 17-4 ;;
1;;;;bc185;74;Carnobacterium sp. WN1359 ;;
1;;;;bc186;60;Enterococcus casseliflavus EC20 ;;
1;;;;bc187;57;Enterococcus faecalis 62 ;;
;;;;bc188;63;Enterococcus faecalis ATCC 29212 ;;
;;;;bc189;65;Enterococcus faecalis D32 ;;
;;;;bc190;64;Enterococcus faecalis DENG1 ;;
;;;;bc191;60;Enterococcus faecalis OG1RF ;;
;;;;bc192;65;Enterococcus faecalis str. Symbioflor 1 ;;
;;;;bc193;71;Enterococcus faecalis V583 ;;
1;;;;bc194;47;Enterococcus faecium Aus0004 ;;
;;;;bc195;76;Enterococcus faecium Aus0085 AUS0085 ;;
;;;;bc196;64;Enterococcus faecium DO ;;
;;;;bc197;48;Enterococcus faecium NRRL B-2354 ;;
;;;;bc198;65;Enterococcus faecium T110 ;;
1;;;;bc199;72;Enterococcus hirae ATCC 9790 ;;
1;;;;bc200;66;Enterococcus mundtii QU 25 QU25 ;;
1;;;;bc201;33;Enterococcus sp. 7L76 ;;
1;;;;bc202;67;Exiguobacterium antarcticum B7 Eab7 ;;
1;;;;bc203;69;Exiguobacterium sibiricum 255-15 ;;
1;;;;bc204;68;Exiguobacterium sp. AT1b ;;
1;;;;bc205;61;Exiguobacterium sp. MH3 ;;
1;;;;bc206;88;Geobacillus kaustophilus HTA426 ;;
1;;;;bc207;89;Geobacillus sp. C56-T3 ;;
1;;;;bc208;88;Geobacillus sp. GHH01 ;;
1;;;;bc209;89;Geobacillus sp. JF8 ;;
1;;;;bc210;93;Geobacillus sp. WCH70 ;;
1;;;;bc211;92;Geobacillus sp. Y4.1MC1 ;;
1;;;;bc212;89;Geobacillus sp. Y412MC52 ;;
1;;;;bc213;89;Geobacillus sp. Y412MC61 ;;
1;;;;bc214;88;Geobacillus thermodenitrificans NG80-2 ;;
1;;;;bc215;91;Geobacillus thermoglucosidasius C56-YS93 ;;
1;;;;bc216;89;Geobacillus thermoleovorans CCB US3 UF5 ;;
1;;;;bc217;69;Halobacillus halophilus DSM 2266 ;;
1;jeo;;;bc218;124;Jeotgalibacillus sp. D5 ;;
1;;;;bc219;56;Jeotgalicoccus sp. 13MG44 air ;;
1;;;;bc220;60;Kyrpidia tusciae DSM 2912 ;;
1;;;;bc221;63;Lactobacillus acidophilus 30SC ;;
;;;;bc222;61;Lactobacillus acidophilus FSI4 ;;
;;;;bc223;61;Lactobacillus acidophilus La-14 ;;
;;;;bc224;61;Lactobacillus acidophilus NCFM ;;
1;;;;bc225;60;Lactobacillus amylovorus GRL 1112 ;;
;;;;bc226;62;Lactobacillus amylovorus GRL1118 ;;
1;;;;bc227;65;Lactobacillus brevis ATCC 367 ;;
;;;;bc228;49;Lactobacillus brevis BSO 464 ;;
;;;;bc229;64;Lactobacillus brevis KB290 ;;
1;;;;bc230;61;Lactobacillus buchneri CD034 ;;
;;;;bc231;63;Lactobacillus buchneri NRRL B-30929 ;;
1;;;;bc232;57;Lactobacillus casei 12A ;;
;;;;bc233;59;Lactobacillus casei ATCC 334 ;;
;;;;bc234;61;Lactobacillus casei BD-II ;;
;;;;bc235;61;Lactobacillus casei BL23 ;;
;;;;bc236;59;Lactobacillus casei LC2W ;;
;;;;bc237;61;Lactobacillus casei LOCK919 ;;
;;;;bc238;60;Lactobacillus casei str. Zhang ;;
;;;;bc239;59;Lactobacillus casei subsp. casei ATCC 393 ;;
;;;;bc240;61;Lactobacillus casei W56 ;;
1;;;;bc241;64;Lactobacillus crispatus ST1 ;;
1;;;;bc242;89;Lactobacillus delbrueckii subsp. bulgaricus 2038 ;;
;;;;bc243;95;Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 JCM 1002 ;;
;;999;1;bc244;98;Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;
;;;;bc245;98;Lactobacillus delbrueckii subsp. bulgaricus ND02 ;;
1;;;;bc246;58;Lactobacillus fermentum CECT 5716 ;;
;;;;bc247;58;Lactobacillus fermentum F-6 ;;
;;;;bc248;58;Lactobacillus fermentum IFO 3956 ;;
1;;;;bc249;75;Lactobacillus gasseri ATCC 33323 JCM 1131 ;;
1;;;;bc250;64;Lactobacillus helveticus CNRZ32 ;;
;;;;bc251;61;Lactobacillus helveticus DPC 4571 ;;
;;;;bc252;63;Lactobacillus helveticus H10 ;;
;;;;bc253;61;Lactobacillus helveticus H9 ;;
;;;;bc254;61;Lactobacillus helveticus KLDS1.8701 ;;
;;;;bc255;61;Lactobacillus helveticus R0052 ;;
1;;;;bc256;56;Lactobacillus hokkaidonensis LOOC260 ;;
1;;;;bc257;55;Lactobacillus johnsonii DPC 6026 ;;
;;;;bc258;54;Lactobacillus johnsonii FI9785 ;;
;;;;bc259;54;Lactobacillus johnsonii N6.2 ;;
;;;;bc260;78;Lactobacillus johnsonii NCC 533 ;;
1;;;;bc261;60;Lactobacillus kefiranofaciens ZW3 ;;
1;;;;bc262;92;Lactobacillus mucosae LM1 ;;
1;;;;bc263;61;Lactobacillus paracasei N1115 ;;
;;;;bc264;59;Lactobacillus paracasei subsp. paracasei 8700 2 ;;
;;;;bc265;61;Lactobacillus paracasei subsp. paracasei JCM 8130 ;;
1;;;;bc266;69;Lactobacillus plantarum 16 ;;
;;;;bc267;67;Lactobacillus plantarum B21 ;;
;;;;bc268;62;Lactobacillus plantarum JDM1 ;;
;;;;bc269;72;Lactobacillus plantarum subsp. plantarum P-8 ;;
;;;;bc270;71;Lactobacillus plantarum subsp. plantarum ST-III ;;
;;;;bc271;74;Lactobacillus plantarum WCFS1 ;;
;;;;bc272;65;Lactobacillus plantarum ZJ316 ;;
1;;;;bc273;68;Lactobacillus reuteri DSM 20016 ;;
;;;;bc274;70;Lactobacillus reuteri I5007 ;;
;;;;bc275;65;Lactobacillus reuteri JCM 1112 ;;
;;;;bc276;70;Lactobacillus reuteri SD2112 ;;
;;;;bc277;70;Lactobacillus reuteri TD1 ;;
1;;;;bc278;60;Lactobacillus rhamnosus ATCC 8530 ;;
;;;;bc279;59;Lactobacillus rhamnosus GG ATCC 53103 ;;
;;;;bc280;57;Lactobacillus rhamnosus GG GG ATCC 53103 ;;
;;;;bc281;61;Lactobacillus rhamnosus Lc 705 ;;
;;;;bc282;59;Lactobacillus rhamnosus LOCK900 ;;
;;;;bc283;62;Lactobacillus rhamnosus LOCK908 ;;
1;;;;bc284;67;Lactobacillus ruminis ATCC 27782 ;;
1;;;;bc285;65;Lactobacillus sakei subsp. sakei 23K ;;
1;;;;bc286;77;Lactobacillus salivarius CECT 5713 ;;
;;;;bc287;77;Lactobacillus salivarius JCM1046 ;;
1;;;;bc288;61;Lactobacillus sanfranciscensis TMW 1.1304 ;;
1;;;;bc289;56;Lactobacillus sp. wkB8 ;;
1;;;;bc290;63;Lactococcus garvieae ATCC 49156 ;;
;;;;bc291;63;Lactococcus garvieae Lg2 ;;
1;;;;bc292;62;Lactococcus lactis AI06 ;;
1;;;;bc293;64;Lactococcus lactis subsp. cremoris A76 ;;
;;;;bc294;62;Lactococcus lactis subsp. cremoris KW2 ;;
;;;;bc295;64;Lactococcus lactis subsp. cremoris MG1363 ;;
;;;;bc296;64;Lactococcus lactis subsp. cremoris NZ9000 ;;
;;;;bc297;62;Lactococcus lactis subsp. cremoris SK11 ;;
;;;;bc298;61;Lactococcus lactis subsp. cremoris UC509.9 ;;
1;;;;bc299;66;Lactococcus lactis subsp. lactis CV56 ;;
;;;;bc300;63;Lactococcus lactis subsp. lactis Il1403 IL1403 ;;
;;;;bc301;65;Lactococcus lactis subsp. lactis IO-1 ;;
;;;;bc302;69;Lactococcus lactis subsp. lactis KF147 ;;
;;;;bc303;66;Lactococcus lactis subsp. lactis KLDS 4.0325 ;;
;;;;bc304;69;Lactococcus lactis subsp. lactis NCDO 2118 ;;
;;;;bc305;64;Lactococcus lactis subsp. lactis S0 ;;
1;;;;bc306;65;Leuconostoc carnosum JB16 ;;
1;;;;bc307;70;Leuconostoc citreum KM20 ;;
1;;;;bc308;67;Leuconostoc gelidum JB7 ;;
;;;;bc309;67;Leuconostoc gelidum subsp. gasicomitatum LMG 18811 ;;
1;;;;bc310;68;Leuconostoc kimchii IMSNU 11154 ;;
1;;;;bc311;69;Leuconostoc mesenteroides KFRI-MG ;;
;;;;bc312;71;Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ;;
;;;;bc313;71;Leuconostoc mesenteroides subsp. mesenteroides J18 ;;
1;;;;bc314;67;Leuconostoc sp. C2 ;;
1;;;;bc315;67;Listeria ivanovii subsp. ivanovii PAM 55 ;;
;;;;bc316;67;Listeria ivanovii subsp. ivanovii WSLC 3010 ;;
;;;;bc317;67;Listeria ivanovii subsp. londoniensis WSLC 30151 ;;
;;;;bc318;67;Listeria ivanovii subsp. londoniensis WSLC 30167 ;;
;;;;bc319;67;Listeria ivanovii WSLC3009 ;;
1;;;;bc320;67;Listeria monocytogenes 07PF0776 ;;
;;;;bc321;58;Listeria monocytogenes 08-5578 ;;
;;;;bc322;58;Listeria monocytogenes 08-5923 ;;
;;;;bc323;67;Listeria monocytogenes 10403S ;;
;;;;bc324;49;Listeria monocytogenes 6179 ;;
;;;;bc325;67;Listeria monocytogenes ATCC 19117 ;;
;;;;bc326;67;Listeria monocytogenes C1-387 ;;
;;;;bc327;67;Listeria monocytogenes CFSAN006122 ;;
;;666;1;bc328;67;Listeria monocytogenes EGD ;;
;;;;bc329;67;Listeria monocytogenes Finland 1998 Finland 1988 ;;
;;;;bc330;67;Listeria monocytogenes FSL R2-561 ;;
;;;;bc331;67;Listeria monocytogenes HCC23 ;;
;;;;bc332;65;Listeria monocytogenes IZSAM Lm hs2008 ;;
;;;;bc333;59;Listeria monocytogenes J0161 ;;
;;;;bc334;67;Listeria monocytogenes J1-220 ;;
;;;;bc335;67;Listeria monocytogenes J1776 ;;
;;;;bc336;58;Listeria monocytogenes J1816 ;;
;;;;bc337;67;Listeria monocytogenes J1817 ;;
;;;;bc338;67;Listeria monocytogenes J1926 ;;
;;;;bc339;67;Listeria monocytogenes J2-031 ;;
;;;;bc340;58;Listeria monocytogenes J2-064 ;;
;;;;bc341;67;Listeria monocytogenes J2-1091 ;;
;;;;bc342;67;Listeria monocytogenes L312 ;;
;;;;bc343;67;Listeria monocytogenes L99 ;;
;;;;bc344;67;Listeria monocytogenes La111 ;;
;;;;bc345;67;Listeria monocytogenes Lm60 ;;
;;;;bc346;67;Listeria monocytogenes M7 ;;
;;;;bc347;67;Listeria monocytogenes N1-011A ;;
;;;;bc348;67;Listeria monocytogenes N2306 ;;
;;;;bc349;67;Listeria monocytogenes N53-1 ;;
;;;;bc350;67;Listeria monocytogenes NE dc2014 ;;
;;;;bc351;67;Listeria monocytogenes NTSN ;;
;;;;bc352;67;Listeria monocytogenes R2-502 ;;
;;;;bc353;58;Listeria monocytogenes R479a ;;
;;;;bc354;67;Listeria monocytogenes serotype 4b str. CLIP 80459 Clip80459 ;;
;;;;bc355;67;Listeria monocytogenes serotype 4b str. F2365 4b F2365 ;;
;;;;bc356;67;Listeria monocytogenes serotype 4b str. LL195 ;;
;;;;bc357;67;Listeria monocytogenes serotype 7 str. SLCC2482 ;;
;;;;bc358;67;Listeria monocytogenes SLCC2372 ;;
;;;;bc359;67;Listeria monocytogenes SLCC2376 ;;
;;;;bc360;67;Listeria monocytogenes SLCC2378 ;;
;;;;bc361;65;Listeria monocytogenes SLCC2479 ;;
;;;;bc362;67;Listeria monocytogenes SLCC2540 ;;
;;;;bc363;67;Listeria monocytogenes SLCC2755 ;;
;;;;bc364;67;Listeria monocytogenes SLCC5850 ;;
;;;;bc365;68;Listeria monocytogenes SLCC7179 ;;
;;;;bc366;67;Listeria monocytogenes WSLC1001 ;;
;;;;bc367;67;Listeria monocytogenes WSLC1042 ;;
1;;;;bc368;67;Listeria seeligeri serovar 1/2b str. SLCC3954 ;;
1;;;;bc369;66;Listeria welshimeri serovar 6b str. SLCC5334 ;;
1;;;;bc370;107;Lysinibacillus fusiformis RB-21 ;;
1;;;;bc371;86;Lysinibacillus sphaericus C3-41 ;;
1;;;;bc372;98;Lysinibacillus varians GY32 ;;
1;;;;bc373;50;Macrococcus caseolyticus JCSC5402 ;;
1;;;;bc374;61;Melissococcus plutonius ATCC 35311 ;;
;;;;bc375;55;Melissococcus plutonius DAT561 ;;
1;;;;bc376;71;Oceanobacillus iheyensis HTE831 ;;
1;;;;bc377;45;Oenococcus kitaharae DSM 17330 ;;
1;;;;bc378;46;Oenococcus oeni PSU-1 ;;
1;;;;bc379;90;Paenibacillus beijingensis DSM 24997 ;;
1;;;;bc380;86;Paenibacillus borealis DSM 13188 ;;
1;;;;bc381;87;Paenibacillus durus DSM 1735 ;;
1;;;;bc382;89;Paenibacillus graminis DSM 15220 ;;
1;;;;bc383;81;Paenibacillus larvae subsp. larvae DSM 25430 ;;
1;pmq;14,14,14;1;bc384;175;Paenibacillus mucilaginosus 3016 ;;
;pmw;;;bc385;152;Paenibacillus mucilaginosus K02 ;;
;;;;bc386;113;Paenibacillus mucilaginosus KNP414 ;;
1;;;;bc387;88;Paenibacillus odorifer DSM 15391 ;;
1;;;;bc388;107;Paenibacillus polymyxa CF05 ;;
;;;;bc389;90;Paenibacillus polymyxa CR1 ;;
;;;;bc390;91;Paenibacillus polymyxa E681 ;;
;;;;bc391;111;Paenibacillus polymyxa M1 ;;
;;;;bc392;109;Paenibacillus polymyxa Sb3-1 ;;
;ppm;14,13,13;1;bc393;165;Paenibacillus polymyxa SC2 ;;
;;;;bc394;112;Paenibacillus polymyxa SQR-21 SQR21 ;;
1;;;;bc395;82;Paenibacillus sabinae T27 ;;
1;;;;bc396;86;Paenibacillus sp. FSL H7-0357 ;;
1;;;;bc397;93;Paenibacillus sp. FSL H7-0737 ;;
1;;;;bc398;87;Paenibacillus sp. FSL P4-0081 ;;
1;;;;bc399;90;Paenibacillus sp. FSL R5-0345 ;;
1;;;;bc400;90;Paenibacillus sp. FSL R5-0912 ;;
1;;;;bc401;85;Paenibacillus sp. FSL R7-0273 ;;
1;;;;bc402;85;Paenibacillus sp. FSL R7-0331 ;;
1;;;;bc403;90;Paenibacillus sp. IHBB 10380 ;;
1;;;;bc404;89;Paenibacillus sp. JDR-2 ;;
1;;;;bc405;73;Paenibacillus sp. Y412MC10 ;;
1;;;;bc406;88;Paenibacillus stellifer DSM 14472 ;;
1;;;;bc407;90;Paenibacillus terrae HPL-003 ;;
1;;;;bc408;57;Pediococcus claussenii ATCC BAA-344 ;;
1;;;;bc409;55;Pediococcus pentosaceus ATCC 25745 ;;
1;;;;bc410;51;Pediococcus pentosaceus SL4 ;;
;;;;bc411;60;Planococcus sp. PAMC 21323 ;;
1;;;;bc412;97;Solibacillus silvestris StLB046 ;;
1;;755;1;bc413;63;Staphylococcus aureus 04-02981 ;;
;;;;bc414;58;Staphylococcus aureus 08BA02176 ;;
;;;;bc415;56;Staphylococcus aureus 144 S7 ;;
;;;;bc416;62;Staphylococcus aureus 2395 USA500 ;;
;;;;bc417;54;Staphylococcus aureus 25b MRSA ;;
;;;;bc418;54;Staphylococcus aureus 26b MRSA ;;
;;;;bc419;54;Staphylococcus aureus 27b MRSA ;;
;;;;bc420;54;Staphylococcus aureus 29b MRSA ;;
;;;;bc421;54;Staphylococcus aureus 31b MRSA ;;
;;;;bc422;54;Staphylococcus aureus 33b ;;
;;;;bc423;61;Staphylococcus aureus 502A ;;
;;;;bc424;31;Staphylococcus aureus 71A S11 ;;
;;;;bc425;58;Staphylococcus aureus 79 S10 ;;
;;;;bc426;31;Staphylococcus aureus 93b S9 ;;
;;;;bc427;62;Staphylococcus aureus Bmb9393 ;;
;;;;bc428;61;Staphylococcus aureus CA-347 ;;
;;;;bc429;58;Staphylococcus aureus FCFHV36 ;;
;;;;bc430;61;Staphylococcus aureus ILRI Eymole1/1 ;;
;;;;bc431;58;Staphylococcus aureus M1 ;;
;;;;bc432;53;Staphylococcus aureus NRS 100 ;;
;;;;bc433;61;Staphylococcus aureus RF122 ;;
;;;;bc434;52;Staphylococcus aureus SA17 S6 ;;
1;;;;bc435;60;Staphylococcus aureus subsp. aureus 11819-97 ;;
;;;;bc436;53;Staphylococcus aureus subsp. aureus 55/2053 ;;
;;;;bc437;58;Staphylococcus aureus subsp. aureus 6850 ;;
;;;;bc438;58;Staphylococcus aureus subsp. aureus 71193 ;;
;;;;bc439;60;Staphylococcus aureus subsp. aureus ATCC 25923 ;;
;;;;bc440;58;Staphylococcus aureus subsp. aureus CN1 ;;
;;;;bc441;53;Staphylococcus aureus subsp. aureus COL ;;
;;;;bc442;61;Staphylococcus aureus subsp. aureus ECT-R 2 ;;
;;;;bc443;60;Staphylococcus aureus subsp. aureus ED133 ;;
;;;;bc444;62;Staphylococcus aureus subsp. aureus ED98 ;;
;;;;bc445;60;Staphylococcus aureus subsp. aureus FORC 001 ;;
;;;;bc446;62;Staphylococcus aureus subsp. aureus Gv69 ;;
;;;;bc447;59;Staphylococcus aureus subsp. aureus H-EMRSA-15 ;;
;;;;bc448;61;Staphylococcus aureus subsp. aureus HO 5096 0412 ;;
;;;;bc449;61;Staphylococcus aureus subsp. aureus JH1 ;;
;;;;bc450;60;Staphylococcus aureus subsp. aureus JH9 ;;
;;;;bc451;58;Staphylococcus aureus subsp. aureus JKD6159 ;;
;;;;bc452;61;Staphylococcus aureus subsp. aureus LGA251 ;;
;;;;bc453;60;Staphylococcus aureus subsp. aureus M013 ;;
;;;;bc454;60;Staphylococcus aureus subsp. aureus MRSA252 ;;
;;;;bc455;59;Staphylococcus aureus subsp. aureus MSHR1132 ;;
;;;;bc456;60;Staphylococcus aureus subsp. aureus MSSA476 ;;
;;;;bc457;61;Staphylococcus aureus subsp. aureus Mu3 ;;
;;;;bc458;61;Staphylococcus aureus subsp. aureus Mu50 ;;
;;;;bc459;61;Staphylococcus aureus subsp. aureus MW2 ;;
;;;;bc460;63;Staphylococcus aureus subsp. aureus N315 ;;
;;;;bc461;61;Staphylococcus aureus subsp. aureus NCTC 8325 ;;
;;;;bc462;61;Staphylococcus aureus subsp. aureus SA268 ;;
;;;;bc463;61;Staphylococcus aureus subsp. aureus SA40 ;;
;;;;bc464;60;Staphylococcus aureus subsp. aureus SA957 ;;
;;;;bc465;506;Staphylococcus aureus subsp. aureus ST228 ;;
;;;;bc466;61;Staphylococcus aureus subsp. aureus ST398 ;;
;;;;bc467;61;Staphylococcus aureus subsp. aureus ST772-MRSA-V DAR4145 ;;
;;;;bc468;84;Staphylococcus aureus subsp. aureus str. JKD6008 ;;
;;;;bc469;61;Staphylococcus aureus subsp. aureus str. Newman ;;
;;;;bc470;55;Staphylococcus aureus subsp. aureus T0131 ;;
;;;;bc471;61;Staphylococcus aureus subsp. aureus TCH60 ;;
;;;;bc472;62;Staphylococcus aureus subsp. aureus TW20 ;;
;;;;bc473;54;Staphylococcus aureus subsp. aureus USA300 FPR3757 ;;
;;;;bc474;61;Staphylococcus aureus subsp. aureus USA300 TCH1516 ;;
;;;;bc475;61;Staphylococcus aureus subsp. aureus VC40 ;;
;;;;bc476;62;Staphylococcus aureus subsp. aureus Z172 ;;
;;;;bc477;61;Staphylococcus aureus UA-S391 USA300 ;;
;;;;bc478;61;Staphylococcus aureus USA300-ISMMS1 ;;
;;;;bc479;59;Staphylococcus aureus XN108 ;;
1;;;;bc480;61;Staphylococcus carnosus subsp. carnosus TM300 ;;
1;;;;bc481;58;Staphylococcus epidermidis 949 S8 ;;
;;;;bc482;61;Staphylococcus epidermidis ATCC 12228 ;;
;;;;bc483;61;Staphylococcus epidermidis PM221 ;;
;;;;bc484;61;Staphylococcus epidermidis RP62A ;;
;;;;bc485;60;Staphylococcus epidermidis SEI ;;
1;;;;bc486;62;Staphylococcus haemolyticus JCSC1435 ;;
;;;;bc487;62;Staphylococcus haemolyticus Sh29/312/L2 ;;
1;;;;bc488;59;Staphylococcus hyicus ATCC 11249 ;;
1;;;;bc489;61;Staphylococcus lugdunensis HKU09-01 ;;
;;;;bc490;56;Staphylococcus lugdunensis N920143 ;;
1;;;;bc491;49;Staphylococcus pasteuri SP1 ;;
1;;;;bc492;68;Staphylococcus pseudintermedius E140 ;;
;;;;bc493;58;Staphylococcus pseudintermedius ED99 ;;
;;;;bc494;59;Staphylococcus pseudintermedius HKU10-03 ;;
1;;;;bc495;60;Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ;;
1;;;;bc496;59;Staphylococcus warneri SG1 ;;
1;;;;bc497;55;Staphylococcus xylosus HKUOPL8 ;;
;;;;bc498;59;Staphylococcus xylosus SMQ-121 ;;
1;;777;1;bc499;80;Streptococcus agalactiae 09mas018883 ;;
;;;;bc500;72;Streptococcus agalactiae 138P ;;
;;;;bc501;71;Streptococcus agalactiae 138spar ;;
;;;;bc502;72;Streptococcus agalactiae 2-22 ;;
;;;;bc503;80;Streptococcus agalactiae 2603V/R ;;
;;;;bc504;80;Streptococcus agalactiae A909 ;;
;;;;bc505;80;Streptococcus agalactiae CNCTC 10/84 ;;
;;;;bc506;80;Streptococcus agalactiae COH1 ;;
;;;;bc507;82;Streptococcus agalactiae GBS1-NY ;;
;;;;bc508;80;Streptococcus agalactiae GBS2-NM ;;
;;;;bc509;80;Streptococcus agalactiae GBS6 ;;
;;;;bc510;77;Streptococcus agalactiae GD201008-001 ;;
;;;;bc511;81;Streptococcus agalactiae ILRI005 ;;
;;;;bc512;79;Streptococcus agalactiae ILRI112 ;;
;;;;bc513;81;Streptococcus agalactiae NGBS061 ;;
;;;;bc514;81;Streptococcus agalactiae NGBS572 ;;
;;;;bc515;80;Streptococcus agalactiae SA20-06 ;;
1;;;;bc516;58;Streptococcus anginosus C1051 ;;
;;;;bc517;58;Streptococcus anginosus C238 ;;
;;;;bc518;59;Streptococcus anginosus SA1 ;;
;;;;bc519;67;Streptococcus anginosus subsp. whileyi MAS624 ;;
1;;;;bc520;59;Streptococcus constellatus subsp. pharyngis C1050 ;;
;;;;bc521;59;Streptococcus constellatus subsp. pharyngis C232 ;;
;;;;bc522;59;Streptococcus constellatus subsp. pharyngis C818 ;;
1;;;;bc523;57;Streptococcus dysgalactiae subsp. equisimilis 167 ;;
;;;;bc524;57;Streptococcus dysgalactiae subsp. equisimilis AC-2713 ;;
;;;;bc525;57;Streptococcus dysgalactiae subsp. equisimilis ATCC 12394 ;;
;;;;bc526;57;Streptococcus dysgalactiae subsp. equisimilis GGS 124 ;;
;;;;bc527;57;Streptococcus dysgalactiae subsp. equisimilis RE378 ;;
1;;;;bc528;66;Streptococcus equi subsp. equi 4047 ;;
;;;;bc529;57;Streptococcus equi subsp. zooepidemicus ATCC 35246 ;;
;;;;bc530;51;Streptococcus equi subsp. zooepidemicus CY ;;
;;;;bc531;57;Streptococcus equi subsp. zooepidemicus H70 ;;
1;;;;bc532;57;Streptococcus equi subsp. zooepidemicus MGCS10565 ATCC BAA1716 ;;
;;;;bc533;61;Streptococcus gallolyticus subsp. gallolyticus ATCC 43143 ;;
;;;;bc534;81;Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069 ;;
;;;;bc535;72;Streptococcus gallolyticus UCN34 ;;
1;;;;bc536;60;Streptococcus gordonii str. Challis substr. CH1 ;;
1;;;;bc537;69;Streptococcus infantarius subsp. infantarius CJ18 ;;
1;;;;bc538;45;Streptococcus iniae ISET0901 ;;
;;;;bc539;45;Streptococcus iniae ISNO ;;
;;;;bc540;47;Streptococcus iniae SF1 ;;
;;;;bc541;58;Streptococcus iniae YSFST01-82 ;;
1;;;;bc542;60;Streptococcus intermedius B196 ;;
;;;;bc543;60;Streptococcus intermedius C270 ;;
;;;;bc544;67;Streptococcus intermedius JTH08 ;;
1;;;;bc545;60;Streptococcus lutetiensis 033 ;;
1;;;;bc546;71;Streptococcus macedonicus ACA-DC 198 ;;
1;;;;bc547;61;Streptococcus mitis B6 ;;
1;;;;bc548;65;Streptococcus mutans GS-5 ;;
;;;;bc549;65;Streptococcus mutans LJ23 ;;
;;;;bc550;65;Streptococcus mutans NN2025 ;;
;;;;bc551;65;Streptococcus mutans UA159 ;;
;;;;bc552;65;Streptococcus mutans UA159-FR ;;
1;;;;bc553;51;Streptococcus oligofermentans AS 1.3089 ;;
1;;;;bc554;61;Streptococcus oralis Uo5 ;;
1;;;;bc555;62;Streptococcus parasanguinis ATCC 15912 ;;
;;;;bc556;62;Streptococcus parasanguinis FW213 ;;
1;;;;bc557;60;Streptococcus parauberis KCTC 11537 ;;
;;;;bc558;58;Streptococcus parauberis NCFD 2020 ;;
1;;;;bc559;60;Streptococcus pasteurianus ATCC 43144 ;;
1;;;;bc560;60;Streptococcus pneumoniae 670-6B ;;
;;;;bc561;59;Streptococcus pneumoniae 70585 ;;
;;;;bc562;59;Streptococcus pneumoniae A026 ;;
;;;;bc563;58;Streptococcus pneumoniae AP200 ;;
;;;;bc564;58;Streptococcus pneumoniae ATCC 700669 ;;
;;;;bc565;58;Streptococcus pneumoniae CGSP14 ;;
;;;;bc566;59;Streptococcus pneumoniae D39 ;;
;;;;bc567;59;Streptococcus pneumoniae G54 ;;
;;;;bc568;58;Streptococcus pneumoniae gamPNI0373 ;;
;;;;bc569;59;Streptococcus pneumoniae Hungary19A-6 ;;
;;;;bc570;59;Streptococcus pneumoniae INV104 ;;
;;;;bc571;59;Streptococcus pneumoniae INV200 ;;
;;;;bc572;59;Streptococcus pneumoniae JJA ;;
;;;;bc573;60;Streptococcus pneumoniae NT 110 58 ;;
;;;;bc574;59;Streptococcus pneumoniae OXC141 ;;
;;;;bc575;59;Streptococcus pneumoniae P1031 ;;
;;;;bc576;54;Streptococcus pneumoniae PCS8235 ;;
;;;;bc577;59;Streptococcus pneumoniae R6 ;;
;;;;bc578;59;Streptococcus pneumoniae SPN032672 ;;
;;;;bc579;59;Streptococcus pneumoniae SPN033038 ;;
;;;;bc580;59;Streptococcus pneumoniae SPN034156 SNP034156 ;;
;;;;bc581;59;Streptococcus pneumoniae SPN034183 SNP034183 ;;
;;;;bc582;59;Streptococcus pneumoniae SPN994038 SNP994038 ;;
;;;;bc583;59;Streptococcus pneumoniae SPN994039 SNP994039 ;;
;;;;bc584;59;Streptococcus pneumoniae SPNA45 ;;
;;;;bc585;59;Streptococcus pneumoniae ST556 ;;
;;;;bc586;59;Streptococcus pneumoniae Taiwan19F-14 ;;
;;;;bc587;59;Streptococcus pneumoniae TCH8431/19A ;;
;;;;bc588;59;Streptococcus pneumoniae TIGR4 ;;
;;;;bc589;59;Streptococcus pneumoniae TIGR4 ATCC BAA-334 ;;
1;;;;bc590;42;Streptococcus pseudopneumoniae IS7493 ;;
1;;;;bc591;67;Streptococcus pyogenes 1E1 ;;
;;;;bc592;67;Streptococcus pyogenes 7F7 ;;
;;;;bc593;67;Streptococcus pyogenes A20 ;;
;;;;bc594;67;Streptococcus pyogenes Alab49 ;;
;;;;bc595;68;Streptococcus pyogenes ATCC 19615 ;;
;;;;bc596;69;Streptococcus pyogenes HKU QMH11M0907901 ;;
;;;;bc597;69;Streptococcus pyogenes HKU360 ;;
;;;;bc598;67;Streptococcus pyogenes HSC5 ;;
;;;;bc599;57;Streptococcus pyogenes M1 476 ;;
;2*60;;;bc600;120;Streptococcus pyogenes M1 GAS SF370 ;;
;;;;bc601;57;Streptococcus pyogenes M23ND ;;
;;;;bc602;67;Streptococcus pyogenes MGAS10270 ;;
;;;;bc603;67;Streptococcus pyogenes MGAS10394 ;;
;;;;bc604;67;Streptococcus pyogenes MGAS10750 ;;
;;;;bc605;57;Streptococcus pyogenes MGAS15252 ;;
;;;;bc606;57;Streptococcus pyogenes MGAS1882 ;;
;;;;bc607;68;Streptococcus pyogenes MGAS2096 ;;
;;;;bc608;67;Streptococcus pyogenes MGAS315 ;;
;;;;bc609;67;Streptococcus pyogenes MGAS5005 ;;
;;;;bc610;67;Streptococcus pyogenes MGAS6180 ;;
;;;;bc611;68;Streptococcus pyogenes MGAS8232 ;;
;;;;bc612;68;Streptococcus pyogenes MGAS9429 ;;
;;;;bc613;67;Streptococcus pyogenes NZ131 ATCC BAA-1633 ;;
;;;;bc614;57;Streptococcus pyogenes SSI-1 ;;
;;;;bc615;66;Streptococcus pyogenes STAB1102 ;;
;;;;bc616;67;Streptococcus pyogenes STAB901 ;;
;;;;bc617;59;Streptococcus pyogenes STAB902 ;;
;;;;bc618;66;Streptococcus pyogenes str. Manfredo ;;
1;;;;bc619;68;Streptococcus salivarius 57.I ;;
;;;;bc620;68;Streptococcus salivarius CCHSS3 ;;
;;;;bc621;68;Streptococcus salivarius JIM8777 ;;
;;;;bc622;68;Streptococcus salivarius NCTC 8618 ;;
1;;;;bc623;61;Streptococcus sanguinis SK36 ;;
1;;;;bc624;60;Streptococcus sp. I-G2 ;;
1;;;;bc625;86;Streptococcus sp. I-P16 ;;
1;;;;bc626;69;Streptococcus sp. VT 162 ;;
1;;;;bc627;56;Streptococcus suis 05HAS68 ;;
;;;;bc628;56;Streptococcus suis 05ZYH33 ;;
;;;;bc629;59;Streptococcus suis 6407 ;;
;;;;bc630;56;Streptococcus suis 98HAH33 ;;
;;;;bc631;56;Streptococcus suis A7 ;;
;;;;bc632;56;Streptococcus suis BM407 ;;
;;;;bc633;56;Streptococcus suis D12 ;;
;;;;bc634;54;Streptococcus suis D9 ;;
;;;;bc635;49;Streptococcus suis GZ1 ;;
;;;;bc636;62;Streptococcus suis JS14 ;;
;;;;bc637;56;Streptococcus suis P1/7 ;;
;;;;bc638;56;Streptococcus suis S735 ;;
;;;;bc639;56;Streptococcus suis SC070731 ;;
;;;;bc640;56;Streptococcus suis SC84 ;;
;;;;bc641;59;Streptococcus suis SS12 ;;
;;;;bc642;58;Streptococcus suis ST1 ;;
;;;;bc643;56;Streptococcus suis ST3 ;;
;;;;bc644;56;Streptococcus suis T15 ;;
;;;;bc645;56;Streptococcus suis TL13 ;;
;;;;bc646;56;Streptococcus suis YB51 ;;
1;;;;bc647;55;Streptococcus thermophilus ASCC 1275 ;;
;;;;bc648;67;Streptococcus thermophilus CNRZ1066 ;;
;;;;bc649;67;Streptococcus thermophilus JIM 8232 ;;
;;;;bc650;67;Streptococcus thermophilus LMD-9 ;;
;;;;bc651;67;Streptococcus thermophilus LMG 18311 ;;
;;;;bc652;57;Streptococcus thermophilus MN-ZLW-002 ;;
;;;;bc653;57;Streptococcus thermophilus ND03 ;;
;;;;bc654;67;Streptococcus thermophilus SMQ-301 ;;
1;;555;1;bc655;59;Streptococcus uberis 0140J ;;
1;;888;1;bc656;56;Terribacillus aidingensis MP602 ;;
1;;555;1;bc657;62;Tetragenococcus halophilus NBRC 12172 ;;
1;;555;1;bc658;61;Thermobacillus composti KWC4 ;;
1;;777;1;bc659;54;Virgibacillus sp. SK37 ;;
1;;766;1;bc660;75;Weissella ceti WS08 ;;
;;;;bc661;71;Weissella ceti WS105 ;;
;;;;bc662;77;Weissella ceti WS74 ;;
1;;;;bc663;56;Weissella koreensis KACC 15510 ;;
1;;;;en001;55;Erysipelothrix rhusiopathiae str. Fujisawa ;;
;;433;1;en002;53;Erysipelothrix rhusiopathiae SY1027 ;;
1;;111;1;en003;40;Faecalitalea cylindroides T2-87 ;;
1;;777;1;en004;77;Lactobacillus salivarius UCC118 ;;
1;;666;1;en005;60;Acidaminococcus fermentans DSM 20731 ;;
1;;333;1;en006;53;Acidaminococcus intestini RyC-MR95 ;;
1;;;;en007;51;Megamonas hypermegale ART12/1 ;;
1;;777;1;en008;65;Megasphaera elsdenii DSM 20460 ;;
1;;10,9,9;1;en009;77;Pelosinus fermentans JBW45 ;;
1;;16,15,14;1;en010;99;Pelosinus sp. UFO1 ;;
1;;777;1;en011;73;Selenomonas ruminantium subsp. lactilytica TAM6421 ;;
1;;444;1;en012;55;Selenomonas sputigena ATCC 35185 ;;
1;;444;1;en013;49;Veillonella parvula DSM 2008 ;;
1;;655;1;cd001;62;Acetobacterium woodii DSM 1030 ;;
1;;555;1;cd002;67;Acetohalobium arabaticum DSM 5501 ;;
1;;11,10,10;1;cd003;110;Alkaliphilus metalliredigens QYMF ;;
1;;;;cd004;88;Alkaliphilus oremlandii OhILAs ;;
1;;;;cd005;51;Ammonifex degensii KC4 ;;
1;;;;cd006;48;Anaerococcus prevotii DSM 20548 ;;
1;;;;cd007;27;butyrate-producing bacterium SM4/1 ;;
;;;;cd008;57;butyrate-producing bacterium SS3/4 ;;
;;;;cd009;53;butyrate-producing bacterium SSC/2 ;;
1;;;;cd010;60;Butyrivibrio fibrisolvens 16/4 ;;
1;;666;1;cd011;51;Butyrivibrio proteoclasticus B316 ;;
1;;;;cd012;56;Caldanaerobacter subterraneus subsp. tengcongensis MB4 ;;
1;;333;1;cd013;52;Caldicellulosiruptor bescii DSM 6725 ;;
1;;;;cd014;50;Caldicellulosiruptor hydrothermalis 108 ;;
1;;;;cd015;51;Caldicellulosiruptor kristjanssonii I77R1B ;;
1;;;;cd016;48;Caldicellulosiruptor kronotskyensis 2002 ;;
1;;;;cd017;47;Caldicellulosiruptor lactoaceticus 6A ;;
1;;;;cd018;46;Caldicellulosiruptor obsidiansis OB47 ;;
1;;;;cd019;49;Caldicellulosiruptor owensensis OL ;;
1;;;;cd020;48;Caldicellulosiruptor saccharolyticus DSM 8903 ;;
1;;;;cd021;41;Candidatus Arthromitus sp. SFB-mouse-Japan ;;
;;;;cd022;40;Candidatus Arthromitus sp. SFB-mouse-NL ;;
;;;;cd023;40;Candidatus Arthromitus sp. SFB-mouse-Yit ;;
1;;;;cd024;39;Candidatus Arthromitus sp. SFB-rat-Yit ;;
1;;;;cd025;47;Candidatus Desulforudis audaxviator MP104C ;;
1;;;;cd026;53;Carboxydothermus hydrogenoformans Z-2901 ;;
1;;;;cd027;75;Clostridium acetobutylicum ATCC 824 ;;
;;;;cd028;75;Clostridium acetobutylicum DSM 1731 ;;
;;;;cd029;77;Clostridium acetobutylicum EA 2018 ;;
1;;;;cd030;69;Clostridium autoethanogenum DSM 10061 ;;
1;;;;cd031;79;Clostridium baratii str. Sullivan ;;
1;;17,16,16;1;cd032;70;Clostridium beijerinckii 59B ;;
;;;;cd033;95;Clostridium beijerinckii ATCC 35702 SA-1 ;;
;;;;cd034;95;Clostridium beijerinckii NCIMB 8052 ;;
1;;;;cd035;84;Clostridium botulinum 111 ;;
;;;;cd036;70;Clostridium botulinum 202F ;;
;;;;cd037;81;Clostridium botulinum A str. ATCC 19397 ;;
;;;;cd038;80;Clostridium botulinum A str. ATCC 3502 ;;
;;;;cd039;81;Clostridium botulinum A str. Hall ;;
;;;;cd040;81;Clostridium botulinum A2 str. Kyoto ;;
;;;;cd041;81;Clostridium botulinum A3 str. Loch Maree ;;
;;;;cd042;77;Clostridium botulinum B str. Eklund 17B NRP ;;
;;;;cd043;82;Clostridium botulinum B1 str. Okra ;;
;;;;cd044;83;Clostridium botulinum Ba4 str. 657 ;;
;;10,10,10;1;cd045;87;Clostridium botulinum BKT015925 ;;
;;;;cd046;73;Clostridium botulinum CDC 1436 ;;
;;554;1;cd047;53;Clostridium botulinum CDC 297 ;;
;;;;cd048;79;Clostridium botulinum E3 str. Alaska E43 ;;
;;;;cd049;72;Clostridium botulinum F str. 230613 ;;
;;;;cd050;82;Clostridium botulinum F str. Langeland ;;
;;;;cd051;72;Clostridium botulinum H04402 065 ;;
;;;;cd052;79;Clostridium botulinum NCTC 8266 ;;
;;;;cd053;79;Clostridium botulinum NCTC 8550 ;;
;;;;cd054;76;Clostridium botulinum Prevot 594 ;;
1;;888;1;cd055;65;Clostridium cellulolyticum H10 ATCC 35319 ;;
1;;;;cd056;60;Clostridium cellulosi ;;
1;;10,9,9;1;cd057;80;Clostridium cellulovorans 743B ;;
1;;;;cd058;50;Clostridium cf. saccharolyticum K10 ;;
1;;666;1;cd059;61;Clostridium clariflavum DSM 19732 ;;
1;;677;1;cd060;63;Clostridium kluyveri DSM 555 ;;
;;;;cd061;63;Clostridium kluyveri NBRC 12016 ;;
1;;999;1;cd062;74;Clostridium ljungdahlii DSM 13528 ;;
1;;10,10,10;1;cd063;81;Clostridium novyi NT ;;
1;;999;1;cd064;77;Clostridium pasteurianum BC1 ;;
;2*81;;;cd065;162;Clostridium pasteurianum DSM 525 ATCC 6013 ;;
1;;;;cd066;93;Clostridium perfringens ATCC 13124 ;;
;;10,10,10;1;cd067;96;Clostridium perfringens str. 13 ;;
1;;;;cd068;85;Clostridium saccharobutylicum DSM 13864 ;;
;;;;cd069;68;Clostridium saccharolyticum WM1 ;;
1;;;;cd070;71;Clostridium saccharoperbutylacetonicum N1-4HMT ;;
1;;999;1;cd071;66;Clostridium scatologenes ATCC 25775 ;;
1;;;;cd072;84;Clostridium sordellii ATCC9714 ;;
;;;;cd073;85;Clostridium sordellii JGS6382 ;;
1;;;;cd074;62;Clostridium sp. BNL1100 ;;
1;;;;cd075;53;Clostridium sp. SY8519 ;;
1;;;;cd076;81;Clostridium sporogenes NCIMB 10696 ;;
1;2*49;;;cd077;98;Clostridium stercorarium subsp. stercorarium DSM 8532 ;;
1;;;;cd078;60;Clostridium sticklandii DSM 519 ;;
1;;546;1;cd079;53;Clostridium tetani 12124569 ;;
;;;;cd080;54;Clostridium tetani E88 Massachusetts substr. E88 ;;
1;;;;cd081;46;Coprococcus catus GD/7 ;;
1;;;;cd082;28;Coprococcus sp. ART55/1 ;;
1;;222;1;cd083;48;Coprothermobacter proteolyticus DSM 5265 ;;
1;;444;1;cd084;54;Dehalobacter restrictus DSM 9455 PER-K23 ;;
1;;;;cd085;53;Dehalobacter sp. CF ;;
1;;;;cd086;53;Dehalobacter sp. DCA ;;
1;;;;cd087;76;Desulfitobacterium dehalogenans ATCC 51507 ;;
1;;;;cd088;73;Desulfitobacterium dichloroeliminans LMG P-21439 ;;
1;;555;1;cd089;76;Desulfitobacterium hafniense DCB-2 ;;
;;;;cd090;63;Desulfitobacterium hafniense Y51 ;;
1;;;;cd091;73;Desulfitobacterium metallireducens DSM 15288 853-15A ;;
1;;898;1;cd092;68;Desulfosporosinus acidiphilus SJ4 ;;
1;;;;cd093;82;Desulfosporosinus meridiei DSM 13257 ;;
1;;;;cd094;77;Desulfosporosinus orientis DSM 765 ;;
1;;9,10,10;1;cd095;70;Desulfotomaculum acetoxidans DSM 771 ;;
1;;;;cd096;66;Desulfotomaculum carboxydivorans CO-1-SRB ;;
1;;;;cd097;67;Desulfotomaculum gibsoniae DSM 7213 ;;
1;;;;cd098;49;Desulfotomaculum kuznetsovii DSM 6115 ;;
1;;;;cd099;74;Desulfotomaculum reducens MI-1 ;;
1;;;;cd100;67;Desulfotomaculum ruminis DSM 2154 ;;
1;;;;cd101;60;Ethanoligenens harbinense YUAN-3 ;;
1;;777;1;cd102;69;Eubacterium acidaminophilum DSM 3953 ;;
1;;;;cd103;47;Eubacterium eligens ATCC 27750 ;;
1;;;;cd104;60;Eubacterium limosum KIST612 ;;
1;;;;cd105;60;Eubacterium rectale ATCC 33656 ;;
;;;;cd106;44;Eubacterium rectale DSM 17629 ;;
;;;;cd107;53;Eubacterium rectale M104/1 ;;
1;;;;cd108;50;Eubacterium siraeum 70/3 ;;
;;;;cd109;38;Eubacterium siraeum V10Sc8a ;;
1;;;;cd110;60;Faecalibacterium prausnitzii L2-6 L2/6 ;;
1;;;;cd111;71;Faecalibacterium prausnitzii SL3/3 ;;
1;;444;1;cd112;48;Filifactor alocis ATCC 35896 ;;
1;;444;1;cd113;48;Finegoldia magna ATCC 29328 ;;
1;;444;1;cd114;59;Halanaerobium hydrogeniformans ;;
1;;;;cd115;55;Halanaerobium praevalens DSM 2228 ;;
1;;555;1;cd116;78;Halobacteroides halobius DSM 5150 ;;
1;;;;cd117;57;Halothermothrix orenii H 168 DSM 9562 ;;
1;hmo;10,10,10;1;cd118;109;Heliobacterium modesticaldum Ice1 ATCC 51547 ;;
1;;;;cd119;61;Lachnoclostridium phytofermentans ISDg ;;
1;;;;cd120;46;Mageeibacillus indolicus UPII9-5 ;;
1;;;;cd121;51;Mahella australiensis 50-1 BON ;;
1;;;;cd122;52;Moorella thermoacetica ATCC 39073 ;;
1;;;;cd123;52;Natranaerobius thermophilus JW/NM-WN-LF ;;
1;;;;cd124;72;Oscillibacter valericigenes Sjm18-20 ;;
1;;;;cd125;42;Parvimonas micra KCOM 1535 ChDC B708 ;;
1;;;;cd126;53;Pelotomaculum thermopropionicum SI ;;
1;;;;cd127;67;Peptoclostridium difficile 2007855 ;;
;;;;cd128;89;Peptoclostridium difficile 630 ;;
;;;;cd129;91;Peptoclostridium difficile 630 cultivar NCTC 13307 /strain ;;
;;;;cd130;91;Peptoclostridium difficile 630Derm ;;
;;;;cd131;80;Peptoclostridium difficile BI1 ;;
;;;;cd132;22;Peptoclostridium difficile BI9 ;;
;;9,10,10;1;cd133;85;Peptoclostridium difficile CD196 ;;
;;;;cd134;66;Peptoclostridium difficile CF5 ;;
;;;;cd135;88;Peptoclostridium difficile M120 ;;
;;14,16,13;1;cd136;110;Peptoclostridium difficile M68 ;;
;;;;cd137;67;Peptoclostridium difficile R20291 ;;
1;;;;cd138;53;Peptoniphilus sp. 1-1 ;;
1;;;;cd139;58;Roseburia hominis A2-183 ;;
1;;;;cd140;52;Roseburia intestinalis M50/1 ;;
;;;;cd141;66;Roseburia intestinalis XB6B4 ;;
1;;;;cd142;57;Ruminiclostridium thermocellum ATCC 27405 ;;
;;;;cd143;57;Ruminiclostridium thermocellum DSM 1313 ;;
1;;;;cd144;79;Ruminococcus albus 7 DSM 20455 ;;
1;;;;cd145;57;Ruminococcus bicirculans 80/3 ;;
1;;;;cd146;36;Ruminococcus bromii L2-63 ;;
1;;;;cd147;45;Ruminococcus champanellensis 18P13 JCM 17042 ;;
1;;;;cd148;46;Ruminococcus obeum A2-162 ;;
1;;;;cd149;47;Ruminococcus sp. SR1/5 ;;
1;;;;cd150;47;Ruminococcus torques L2-14 ;;
1;;;;cd151;57;Sulfobacillus acidophilus DSM 10332 ;;
;;;;cd152;56;Sulfobacillus acidophilus TPY ;;
1;;666;1;cd153;98;Symbiobacterium thermophilum IAM 14863 IAM14863 ;;
1;;444;1;cd154;55;Syntrophobotulus glycolicus DSM 8271 ;;
1;;533;1;cd155;48;Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 ;;
1;;222;1;cd156;47;Syntrophothermus lipocalidus DSM 12680 ;;
1;2*53;222;1;cd157;106;Tepidanaerobacter acetatoxydans Re1 ;;
1;;333;1;cd158;53;Thermacetogenium phaeum DSM 12270 ;;
1;;222;1;cd159;51;Thermaerobacter marianensis DSM 12885 ;;
1;;333;1;cd160;53;Thermincola potens JR ;;
1;;444;1;cd161;57;Thermoanaerobacter brockii subsp. finnii Ako-1 ;;
1;;;;cd162;56;Thermoanaerobacter italicus Ab9 ;;
1;;;;cd163;58;Thermoanaerobacter kivui DSM 2030 ;;
1;;;;cd164;59;Thermoanaerobacter mathranii subsp. mathranii str. A3 ;;
1;;;;cd165;57;Thermoanaerobacter pseudethanolicus ATCC 33223 39E ;;
1;;;;cd166;56;Thermoanaerobacter sp. X513 ;;
1;;;;cd167;54;Thermoanaerobacter sp. X514 ;;
1;;;;cd168;57;Thermoanaerobacter wiegelii Rt8.B1 ;;
1;;;;cd169;58;Thermoanaerobacterium saccharolyticum JW/SL-YS485 ;;
1;;555;1;cd170;58;Thermoanaerobacterium thermosaccharolyticum DSM 571 ;;
;;;;cd171;58;Thermoanaerobacterium thermosaccharolyticum M0795 ;;
1;;;;cd172;58;Thermoanaerobacterium xylanolyticum LX-11 ;;
1;;222;1;cd173;48;Thermodesulfobium narugense DSM 14796 ;;
1;;333;1;cd174;53;Thermosediminibacter oceani DSM 16646 ;;

génomes bacilli[modifier | modifier le wikicode]

60;Aerococcus urinae ACS-120-V-Col10a ;;;;56;Amphibacillus xylanus NBRC 15112 ;;;;95;Bacillus amyloliquefaciens IT-45 ;;;;;;;;;89;Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19 ;;;;;;89;Bacillus amyloliquefaciens subsp. plantarum AS43.3 ;;;;;;70;Bacillus amyloliquefaciens TA208 ;;;;112;Bacillus anthracis 2002013094 ;;;;;;;;;94;Bacillus anthracis BA1015 ;;;;;;;;;75;Bacillus atrophaeus 1942 ;;;;80;Bacillus atrophaeus subsp. globigii BSS ;;;;95;Bacillus bombysepticus str. Wang ;;;;;;;;83;Bacillus cellulosilyticus DSM 2522 ;;;;;;118;Bacillus cereus Al Hakam ;;;;;;;95;Bacillus cereus Q1 ;;;;;;;;;107;Bacillus cytotoxicus NVH 391-98 ;;;;;;;;;;;;123;Bacillus sp. X12014 ;;;;;;;;;;;;;;;;;;;86;Bacillus subtilis subsp. subtilis str. 168 ;;;;;;;;142;Bacillus thuringiensis Bt407 ;;;;;;;;;78;Bacillus thuringiensis MC28 ;;;;;;;;98;Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;;;67;Listeria monocytogenes EGD ;;;;;;175;Paenibacillus mucilaginosus 3016 ;;;;;;;;;;165;Paenibacillus polymyxa SC2 ;;;;;;63;Staphylococcus aureus 04-02981 ;;;;;80;Streptococcus agalactiae 09mas018883 ;;;;59;Streptococcus uberis 0140J ;;;;;;;;56;Terribacillus aidingensis MP602 ;;;;;62;Tetragenococcus halophilus NBRC 12172 ;;;;;;;;61;Thermobacillus composti KWC4 ;;;;;;;;54;Virgibacillus sp. SK37 ;;;;;75;Weissella ceti WS08 ;;;;;
bc001;444;Chromosome ;;;bc004;666;Chromosome ;;;bc008;10,10,10;Chromosome;;;;;;;;bc014;10,8,10;Chromosome;16s°;court;;;bc015;10,9,10;Chromosome;;;;;bc025;666;Chromosome;;;bc029;11,11,11;Chromosome;;;;;;;;bc034;10,10,10;Chromosome;;;;;;;;bc063;777;Chromosome;;;bc065;888;Chromosome;;;bc066;13,13,13;Chromosome;;;;;;;bc067;10,10,10;Chromosome;;;;;bc074;14,14,14;Chromosome;;;;;;bc090;13,13,13;Chromosome;;;;;;;;bc097;13,13,13;Chromosome;;;;;;;;;;;bc125;12,12,12;Chromosome;;;;;;;;;;;;;;;;;;bc147;10,10,10;Chromosome;;;;;;;bc158;14,14,14;Chromosome;;;;;;;;bc165;15,15,15;Chromosome;;;;;;;bc244;999;Chromosome;;;bc328;666;Chromosome;;;;;bc384;14,14,14;Chromosome;;;;;;;;;bc393;14,13,13;Chromosome;;;;;bc413;755;Chromosome;;;;bc499;777;Chromosome;;;bc655;555;Chromosome ;;;;;;;bc656;888;Chromosome;;;;bc657;555;Chromosome;;;;;;;bc658;555;Chromosome;;;;;;;bc659;777;Chromosome;;;;bc660;766;Chromosome;;;;
16s23s5s;;;;;2*16s23s5s;;;;;2*16atcgca235;;;;;;;;;;4*16s23s5s;;;;;;;3*16s23s5s;;;;;;;2*16s23s5s;;;;;4*16s23s5s;;;;;;;;;;5*16s23s5s;;;;;;;;;;16s23s5s;;;;;3*16s23s5s;;;;;8*16s23s5s;;;;;;;;;7*16s23s5s;;;;;;;5*16s23s5s;;;;;;;;7*16s23s5s;;;;;;;;;;5*16s23s5s;;;;;;;;;;;;;16s23s5s;;;;;;;;;;;;;;;;;;;;3*16s23s5s   encadrés;;;;;;;;;5*16s23s5s;;;;;;;;;;10*16s23s5s;;;;;;;;;4*16atcgca235;;;;;2*16s23s5s dont un encadré ici;;;;;;;5*16s23s5s;;;;;;;;;;;7*16s23s5s;;;;;;;16atcgca235;;;;;;2*16-gca-235-aac;;;;;2*16-gca-235-aac-cgt;;;dir : direct;;;;;;4*16s23s5s;;;;;;16s23s5s;;;;;;;;;16s23s5s;;;;;;;;;4*16s23s5s;;;;;;16atcgca235;;;;;;
16atcgca235-aac-acc;;;;;16atcgca235-aac-acc;;;;;2*16s23s5s;;;;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;;;16atcgca235;;;;;;;16atcgca235;;;;;2*16atcgca235;;;;;;;;;;16atcgca235-15aas;;;;;;;;;;2*16atcgca235;;;;;16s23s5s-atgf-gac;;;;;4*16s23s5s-22,19,15,8 aas;;;;;;;;;16atcgca235-9aas;;;;;;;16s23s5s-atgf-gac;;;;;;;;16atcgca235;;;;;;;;;;2*16atcgca235;;;;;;;;;;;;;2*16atcgca235;;;;;;;;;;;;;;;;;;;;2*16atcgca235;;;;;;;;;2*16atcgca235;;;;;;;;;;16s23s5s-gaa;;;;;;;;;16atcgca235-5aas;;;;;2*16s23s5s-21,9;;;;;;;9*16s23s5s-23  22  19  17  16  12  11  9  9;;;;;;;;;;;16s-gca-235;;;;;;;16atcgca-235-26aas;;;;;;5*16-gca-235-17,15,12,9,4 aas;;;;;16s-gca-235-17, 12, 7 aas;;;comp : complement;;;;;;16s23s5s-aac-acc;;;;;;16s23s5s-aac;;;;;;;;;16s-5s-23s-atgf-ctc-ctg;;;;;;;;;16atcgca235-aac-acc;;;;;;16s23s5s;;;;;;
16atcgca235-22aas;;;;;16s23s5s-atgf-gac;;;;;5*16s23s5s-21,16,9,9,5 aas;;;;;;;;;;16s°atcgca235;;;;;;;16s23s5s-21,16,9,7 aas  ;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;4*16s23s5s-20,19,11,9 aas;;;;;;;;;;3*16s23s5s-22,20,9aas;;;;;;;;;;16s23s5s-aac-acc;;;;;16s23s5s-aac-acc;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;2*16s23s5s-16,16aas;;;;;;;2*16atcgca235;;;;;;;;4*16s23s5s-22,20,15,9 aas;;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;;;;;suite3-16s23s5s;;;;;;;;;;;;;;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;suite2-16s23s5s;;;;;;;;;;3*16s23s5s-20,15,9;;;;;;;;;2*16s23s5s dont un encadré ici;;;;;16atcgca235-14aas;;;;;;;;;;;;;;;;;;16s-5s-atcgca-23s-8aas;;;;;;;16s23s5s-6aas;;;;;;;interc;;interc;;;;;;;;;;;16atcgca235;;;;;;2*16s-gca-235-25, 8aas ;;;;;;;;;2*16s-5s-atcgca-23s-9,5aas;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca;;;;;;
16s23s5s-12aas;;;;;16s23s5s-9aas;;;;;cgt gga 16s23s5s atgf gac;;;;;;;;;;16s23s5s-x aas  et 16atcgca235-x aas;;;;;;;16s23s5s-atgf-gac;;;;;;;16s23s5s-x aas;;;;;33aas-16s23s5s-atgf-gac;;;;;;;;;;11aas-16s23s5s-atgf-gac;;;;;;;;;;16s23s5s-atgf-gac;;;;;3*16s23s5s-21,16,9 aas;;;;;interc;;interc;;interc;;interc;;;interc;;interc;;interc;;;5*16s23s5s-22,20,15,9,9 aas;;;;;;;;11aas-16s23s5s-atgf-gac;;;;;;;;;;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;;;10aas-16s23s5s-atgf-gac;;;;;;;;;;;;;;;;;;;;16s23s5s-21, 16, 9, 6aas;;;;;;;;;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;16s23s5s-6, 5aas;;;;;16atcgca235-aac-acc;;;;;;;;interc;;interc;;interc;;interc;;interc;;16s-5s-atcgca-23s-5s-11aas;;;;;;;5s-8aas-16s-atc-235;;;;;;16s;47;16s;47;;;interc;;;interc;;;;;11aas-16s23s5s-atgf-gac;;;;;;16s23s5s-12aas;;;;;;;;;16s-5s-23s-14aas;;;;;;;;;16s23s5s-14aas;;;;;;2*16atcgca235-17aas, 4aas-5s-aac;;;;;;
interc;;interc;;;16s23s5s-13aas;;;;;interc;;interc;;interc;;interc;;;;interc;;interc;;interc;;;16s°atcgca235;;;;;;;interc;-;interc;;;interc;;;interc;;;interc;;;;interc;;interc;;interc;;interc;;;;2*16s23s5s-21,16 aas;;;;;interc;;interc;;;140;16s;140;16s;5;gaa;3;aac;;159;16s;303;16s;71;aaa;;13aas-16s23s5s;;;;;;;;interc;;interc;;interc;;interc;;;;°;interc;;;;;;;;;;;;7*16s23s5s-21,16,14,12,10,9,9;;;;;;;;;;;;;;;;;;;;;interc;;à enlever;interc;;;interc;;12aas-16s23s5s-atgf-gac;;;;;;;;;;Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 20  15  9,  sauf  14 avec 12aas-16s23s5s-atgf-gac.;;;;;;;;;;interc;;interc;;;interc;;interc;;interc;;cds;342;cds;677;cds;537;cds;373;cds;324;;3*16s23s5s-11, 17, 21 aas;;;;;;;ctc-gga-16s23s5s;;;;;;gca;153;gca;155;;dir    ;361;cds;amino acid permease;;;;;;16s23s5s-13aas;;;;;;;interc;;;;;;;;;interc;;;;;;;;;interc;;;;;gga-16atcgca235-gta;;;;;;
203;16s;16;gaa;;interc;;interc;;;170;16s;246;ttg;4;gca;16;cca;;;3;gaa;-2934;16s°;228;16s;;interc;-;interc;-;interc;;;3;gaa;228;16s;;139;16s;;10;gca;;3;gac;comp;;10;ttg;140;16s;1;gaa;3;gac;comp;;interc;;interc;;;176;16s;4;gaa;;96;23s;97;23s;7;agc;8;agc;;13;atc;67;23s;32;gaa;;interc;;interc;;;interc;;;141;16s;140;16s;6;gaa;3;aac;direct;;comp;753;cds;efflux RND transporter permease subunit;;;;;;;;;;Les blocs sont emboités. Ils sont tous 16s23s5s. Met avec atgj. Quand les blocs se suivent j’ajoute une ligne pour le 16s suivant.;;;;;;;;;;;;;;;;;;;;16s;164;;cgt;13;;gaa;25;;Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 22 20  15  9  9,  sauf  14 avec 12aas-16s23s5s-atgf-gac.;;;;;;;;;;;interc;;;;;;;;cds;161;cds;298;;16s;244;gaa;5;ttg;45;;ctc;28;16s;268;16s;252;16s;260;16s;258;;;interc;;interc;;interc;;23s°5s;;;;;;23s;72;23s;72;;dir    ;66;16s;;;;;;;;interc;;;;;comp;208;cds;methionine adenosyltransferase;;;;;;dir    ;368;cds;MFS transporter;;;;;;dir     ;175;cds;SprT family protein;*;;;interc;;;;;
75;23s;12;ttc;;388;16s;483;16s;;47;23s;7;tta;16;cca;32;cgt;;;3;agc;98;23s;47;23s;;3;gaa;170;16s;170;16s;;3;agc;98;23s;;97;23s;;5;ggc;;12;atgf;comp;;14;tgc;97;23s;8;aac;12;atgf;comp;;176;16s;4;gaa;;106;23s;3;agc;;8;5s;4;5s;7;aac;5;gaa;;176;gca;8;5s;5;agc;;1;gaa;10;ttg;;10;gca;;96;23s;97;23s;7;agc;8;agc;direct;;dir     ;242;16s;;;;;;;;;;;Première boîte, les blocs sont tous 16s23s5s-xaas,   21  16  12  9.;;;;;;;;;;;;;;;;;;;;23s;55;;gga;159;;agc;3;;;interc;;;;;;;;;dir    ;139;cds;hp;;;;;;gta;3;5s;68;;23s;80;agc;34;tgc;19;;tcc;12;23s;95;23s;94;23s;168;23s;166;;cds;392;cds;1 116;cds;726;;;interc;à elever;interc;;;5s;3;5s;3;;dir    ;193;gca;dir    ;592;cds;50S ribosomal protein L17;*;;dir    ;167;cds;SprT family protein;;;comp;7;gaa;;;;;;;dir    ;101;16s;;;;;;;dir     ;3;aac;;;;dir    ;434;cds;lysine--tRNA ligase;;;
13;5s;22;gac;;186;23s;201;23s;;23;5s;6;tgc;11;cgt;296;ggc;;;10;aac;9;5s;23;5s;;3;agc;97;23s;47;23s;;10;aac;9;5s;;4;5s;;5;aaa;;46;5s;comp;;5;ggc;4;5s;10;atc;45;5s;comp;;106;23s;3;agc;;9;5s;17;aac;;2;aac;4;gta;10;atc;25;gta;;67;23s;3;aac;1;aac;;3;aac;14;tgc;;9;cca;;8;5s;5;5s;7;aac;4;gaa;direct;;dir     ;222;23s;°;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;5s;20;;16s;167;;aac;10;;comp;680;cds;L-lactate dehydrogenase;;;;;;;dir    ;141;16s;;;;;;;gaa;138;23s;208;;5s;13;aac;6;ggc;5;;atgf;14;5s;55;5s;43;5s;9;5s;31;;16s;207;16s;207;gga;9;;ttg;38;5s;70;comp;;gta;2;gta;2;;dir    ;200;23s;dir    ;66;16s;;;;dir    ;2;aac;;;;comp;24;agc;dir     ;230;cds;site-specific integrase;*;;dir    ;63;5s;comp;132;cds;undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase;*;;dir     ;7;agc;;;;dir    ;84;16s;;;;
34;aac;41;atgf;;4;5s;11;5s;;29;gta;53;ggc;14;tta;2;acc;;;15;atc;5;aac;5;gta;;10;aac;9;5s;23;5s;;15;atc;5;aac;;4;gta;;65;caa;;141;23s;comp;;63;caa;4;gta;6;tgg;141;23s;comp;;9;5s;17;aac;;5;acc;15;atc;;17;tcc;9;aca;13;gga;3;atgf;;8;5s;11;tcc;32;atc;;10;atc;5;ggc;;3;cgt;;2;aac;8;gta;10;atc;46;gta;direct;;dir     ;4;5s;dir   ;465;101;cds;SprT family protein;;;;;;comp;466;;cds;1,4-alpha-glucan branching protein GlgB;;;;;;;;;;;;;;;;gta;4;;23s;55;;atc;15;;comp;6;gaa;dir    ;113;cds;hp;;;;dir    ;97;23s;;interc;;;;;atgj;6;16s;436;;gta;8;atc;25;caa;29;;atgj;14;atc;19;atc;19;aac;6;aac;6;;23s;76;23s;76;cca;22;;gga;103;23s;468;comp;;gac;2;gac;2;;dir    ;15;5s;dir    ;193;gca;;;;dir    ;8;agc;;;;comp;19;atc;comp;18;ttg;;;;dir    ;21;atc;comp;15;tac;;;;dir     ;25;gaa;;;;dir    ;6;atc;;;;
13;tcc;9;gaa;;3;gta;4;aac;;37;aca;9;caa;24;ggc;45;aac;;;8;gga;36;tcc;36;aca;;15;atc;5;aac;5;gta;;9;gga;35;tcc;;9;aca;;17;tac;;75;16s;comp;;19;cac;9;aca;9;aca;75;16s;comp;;5;aac;15;atc;;35;tcc;9;gga;;4;gaa;22;cac;10;aaa;87;gac;;5;gta;150;gaa;39;gga;;3;tgg;65;caa;;16;tta;;17;tcc;11;tac;13;gga;87;gac;direct;;dir     ;9;gta;dir   ;72;6;aac;;;;;;;comp;5;;gaa;;;;;;;;;;;;;;;;;aca;36;;5s;13;;gga;10;;comp;7;agc;dir    ;140;16s;;;;;dir    ;4;5s;dir    ;403;cds;hp;;;tcc;8;cds;-8;;aca;41;gga;23;cac;15;;agc;8;gca;16;gca;17;tcc;38;tcc;38;;5s;34;5s;82;cgt;5;;gga;7;16s;118;comp;;aaa;9;aaa;9;;dir    ;18;gta;dir    ;200;23s;;;;dir    ;30;gaa;;;;comp;9;gga;comp;41;tgc;;;;dir    ;179;gca;comp;10;ttc;;;;dir     ;5;gac;;;;dir    ;202;gca;;interc;;
21;gaa;12;agc;;21;aca;43;tcc;;10;aaa;29;cac;6;cta;47;5s;;;20;cac;10;gaa;6;aaa;;8;gga;36;tcc;36;aca;;21;cac;10;gaa;;22;cac;;5;gta;;1;gga;comp;;7;tgg;22;cac;8;ttc;1;gga;comp;;35;tcc;9;gga;;10;gaa;24;cac;;26;gta;29;cta;14;aca;5;caa;;18;aca;261;gta;3;cgt;;16;aca;12;cac;;29;ggc;;5;gaa;4;caa;10;aaa;5;caa;direct;;dir     ;10;tac;dir   ;91;6;agc;°;interc;;;;;comp;3;;agc;comp;808;;cds;SIS domain-containing protein;;;;;;;;;;;;aaa;6;;atgf;60;;cac;17;;comp;7;aac;dir    ;97;23s;;;;;dir    ;8;gta;comp;141;16s;;;;aac;7;cds;138;;aaa;5;cac;28;tgg;7;;tcg;4;gaa;9;gaa;8;gaa;11;gaa;11;;atc;22;gca;4;ggc;10;;tgc;5;gga;21;comp;;cta;10;cta;10;;dir    ;73;gac;dir    ;15;5s;;;;dir    ;5;gac;;;;comp;4;ttc;comp;11;caa;;;;dir    ;85;23s;comp;21;gac;;;;dir     ;263;caa;;;;dir    ;103;23s;dir     ;452;cds;hp
14;gta;10;atc;;7;aaa;32;gaa;;9;ctg;10;tgg;36;aaa;170;23s;;;10;ttc;7;gta;24;cta;;20;cac;10;gaa;6;aaa;;11;ttc;7;gta;;29;cta;;24;gaa;;4;cca;comp;;10;tac;29;cta;4;gac;4;cca;comp;;10;gaa;24;cac;;7;gta;14;ttc;;3;atgf;16;ggc;13;ttc;16;aaa;;14;aaa;55;atgf;6;ggc;;10;ttc;14;tgg;;13;cta;;24;gta;14;aaa;14;aca;17;aaa;direct;;dir     ;5;caa;dir   ;75;5;gaa;dir     ;381;cds;lysine--tRNA ligase;*;;comp;149;;aac;comp;17;;aac;;;;;;;;;;;;;cta;40;;gac;:4;;ttc;12;;comp;10;atc;dir    ;5;5s;;;;;dir    ;12;tac;comp;98;23s;;;;5s;69;gac;3;;cta;14;ttc;4;tac;20;;acc;4;tac;20;gta;5;gta;17;gta;17;;gca;4;aac;3;cta;11;;caa;11;ctc;:2;comp;;aca;35;aca;28;;dir    ;5;aaa;dir    ;9;gta;;;;dir    ;16;caa;;;;comp;43;gac;comp;2;cac;;;;dir    ;3;aac;comp;5;gta;;;;dir     ;17;aaa;;;;dir    ;4;5s;dir     ;84;16s;
12;gac;3;gga;;18;cta;31;atgf;;19;ggc;11;tac;5;aca;:5;16s;;;6;gac;9;atgf;14;ggc;;11;ttc;7;gta;24;cta;;6;gac;11;atgf;;16;ggc;;4;acc;;3;cgt;comp;;18;aca;16;ggc;20;atgf;98;cgt;comp;;7;gta;14;ttc;;38;atgf;39;gac;;9;gac;3;tta;3;gac;93;ctc;;48;cta;33;gac;10;caa;;3;gac;10;tac;;13;aaa;;3;atgf;29;cta;12;ttc;97;ctc;direct;;dir     ;13;aaa;dir   ;76;35;gta;dir     ;242;16s;;;;comp;4;;atc;comp;70;;atc;comp;517;;cds;kinase/pyrophosphorylase;;;;;;;;ggc;14;;;;;gac;11;;comp;13;gga;dir    ;8;gta;;;;;dir    ;4;caa;comp;8;5s;;;;23s;126;gta;2;;ggc;21;gac;4;ttc;4;;gca;119;aac;3;aca;10;atgf;13;atgf;15;;aac;34;tcc;19;aaa;4;;cac;2;;;;;ggc;8;atc;10;;dir    ;10;cta;dir    ;31;gga;;;;dir    ;77;aaa;;;;comp;47;atgf;comp;5;tgg;;;;dir    ;24;acc;comp;156;atgj;;;;dir     ;34;cta;;;;dir    ;2;gta;dir     ;6;other;
7;ttc;17;gac;;45;ggc;26;gac;;9;tta;3;aca;23;gta;;;;;19;atgf;10;gac;11;tta;;6;gac;7;atgf;14;ggc;;19;atgf;12;gac;;3;tta;;9;aac;;16;tta;comp;;9;ttc;3;tta;54;tca;16;ctc;comp;;38;atgf;39;gac;;15;gac;36;atgf;;18;ttc;10;cgt;27;atgf;4;cgt;;25;ggc;10;ttc;19;cac;;24;atgf;14;aca;;5;aca;;9;gac;16;ggc;1;gac;4;cgt;direct;;dir     ;29;cta;dir   ;76;74;gac;dir     ;144;23s;;;;comp;17;;gga;comp;9;;tgc;comp;4;;atc;;;;;;;;;tta;9;;16s;167;;atgf;17;;comp;10;aaa;dir    ;11;tac;;;;;dir    ;18;aaa fin;comp;2;aac;;;;gca;69;cgt;35;;tta;12;atgf;42;gac;6;;ncRNA;36;gta;19;tac;18;gac;49;gac;67;;atgj;3;gaa;9;caa;55;;tgg;15;5s;12;direct;;tta;11;gaa;13;;dir    ;13;aca;dir    ;16;atc;;;;dir    ;58;ctc;;;;comp;16;tca;comp;4;tac;;;;dir    ;40;gaa;comp;166;23s;;;;dir     ;58;ctc;;;;dir    ;42;aaa;dir     ;203;gca;
29;tac;11;atgf;;3;tta;7;ttc;;17;cgt;10;ttc;47;5s;;;;;7;tca;3;ttc;16;cgt;;19;atgf;10;gac;11;tta;;7;tca;3;ttc;;10;cgt;;82;5s;;29;ggc;comp;;3;gac;10;cgt;20;tca;5;aaa;comp;;15;gac;36;atgf;;5;ttc;6;tca;;10;aca;16;cca;62;tca;1;cca;;3;tta;62;aca;6;tgg;;93;tca;9;ttc;;4;gta;;18;ttc;3;tta;27;atgf;1;cca;direct;;dir     ;10;ggc;dir   ;75;5;caa;dir     ;4;5s;;;;comp;22;;cac;comp;31;;caa;comp;9;;gga;dir;351;;cds;hp;;;;cgt;27;;23s;111;;tca;6;;comp;14;aca;dir    ;4;caa;;;;;dir    ;31;cta deb;comp;18;tcc;;;;atc;105;ggc;19;;cgt;10;tca;22;atgf;21;;cca;6;gac;20;aac;4;ttc;4;acg;11;;agc;31;gta;29;gta;11;;tac;5;gta;16;direct;;cgt;7;tca;10;;dir    ;8;ggc;dir    ;5;caa;;;;dir    ;9;cgt;;;;comp;13;gaa;comp;22;ttc;;;;dir    ;6;caa;comp;22;gca;;;;dir     ;5;cgt;;;;dir    ;76;aca;dir     ;90;23s;
27;tgg;18;tca;;4;cgt;28;tac;;4;cca;7;gac;170;23s;;;;;2;atgi;11;aca;4;cca;;7;tca;3;ttc;16;cgt;;2;atgi;11;aca;;16;cca;;141;23s;;14;cta;comp;;24;atgf;15;cca;16;gca;88;caa;comp;;5;ttc;6;tca;;18;aca;2;atgi;;7;tac;20;gca;4;atgi;75;gga;;64;cgt;20;tac;28;tac;;15;tca;3;gac;;87;5s;;10;aca;10;cgt;17;tca;75;gga;direct;;dir     ;3;tta;dir   ;73;15;aaa;dir     ;5;gta;;;;comp;38;;ttc;comp;32;;cac;comp;7;;tgg;dir;307;;16s;;;;;cca;9;;5s;9;;atgi;2;;comp;9;ttc;dir    ;15;aaa;;;;;dir    ;16;ggc;comp;4;gaa;;;;16s;547;cca;3;;cca;19;atgi;11;gta;56;;cgt;104;ttc;15;gta;21;aca;13;cac;10;;gaa;6;atgf;25;gaa;11;;aca;7;aca;6;direct;;cca;15;atgf;2;;dir    ;18;tta;dir    ;10;tca;;;;dir    ;35;cca;;;;comp;17;atc;comp;3;gac;;;;dir    ;9;aaa;comp;63;atc;;;;dir     ;33;cca;;;;dir    ;8;tta;dir     ;5;5s;
7;cac;9;atgi;;24;cca;11;tgg;;19;gca;7;atgf;:9;16s;;;;;20;atgj;10;tac;:9;gca;;2;atgi;11;aca;4;cca;;20;atgj;10;tac;;20;gca;;:9;16s;;5;aaa;comp;;5;gta;20;gca;10;cca;46;gac;comp;;18;aca;2;atgi;;10;tac;21;atgj;;20;tgg;54;tca;20;atgj;140;16s;;7;cca;23;tgg;5;gac;;14;gca;24;atgf;;139;23s;;7;tac;15;cca;4;atgi;141;16s;direct;;dir     ;4;cgt;dir   ;81;3;cta;dir     ;10;aca;;;;comp;3;;gac;comp;28;;tac;comp;24;;tac;dir;91;;23s;;;;;gca;170;;aac;5;;atgj;19;;comp;3;gac;dir    ;29;cta;;;;;dir    ;3;tta;comp;26;gta;;;;cds;:7;aac;7;;gca;341;atgj;42;gaa;33;;ggc;7;aaa;10;atgf;12;tac;8;caa;5;;gta;10;gac;13;acc;3;;ttc;18;aaa;33;direct;;atgj;19;ttc;11;;dir    ;3;cgt;dir    ;21;atgf;;;;dir    ;20;gga;;;;comp;1;gga;comp;13;gta;;;;dir    ;133;cta;comp;104;5s;;;;dir     ;5;gga;;;;dir    ;37;cgt;dir     ;8;aac;
74;caa;14;atgj;;:9;gca;32;cac;;2;atgj;10;gta;;;à enlever d’ici, mis en 2aas;;;;4;gca;29;tgg;;;;20;atgj;10;tac;:9;gca;;4;gca;29;tgg;;54;tca;;;;;87;caa;comp;;17;gaa;4;atgj;3;cgt;4;gta;comp;;10;tac;21;atgj;;25;tgg;6;gca;;63;cac;20;tca;15;gca;44;23s;;:11;gca;10;cac;12;tca;;10;cca;5;gta;;:9;16s;;19;tgg;20;gca;20;atgj;45;23s;direct;;dir     ;10;cca;dir   ;86;91;ctc;dir     ;14;aaa;;;;comp;29;;atgf;comp;17;;gac;comp;15;;tca;dir;7;;5s;;;;;16s;164;;tcc;34;;gca;5;;comp;28;atgf;dir    ;16;ggc;;;;;dir    ;10;cgt;comp;3;atgf;;;;;;5s;68;;16s;244;gca;22;tcc;6;;ctg;9;ctg;3;gac;34;tgg;13;aaa;17;;atgf;25;aca;4;aac;18;;gac;21;ggc;7;direct;;atgi;15;tac;6;;dir    ;5;cca;dir    ;17;ttc;;;;dir    ;97;atc;;;;comp;40;gac;comp;11;gaa;;;;dir    ;9;ggc;comp;319;16s;;;;dir     ;226;atc;;;;dir    ;26;cca;dir     ;82;acg;
11;tgc;5;gca;;;;6;caa;;7;atgi;36;gaa;4;gca;10;gac;comp;;17;cca;9;cac;;;;4;gca;29;tgg;;;;18;cca;9;cac;;20;cta;;1;gaa;;46;gac;comp;;2;tcc;17;atgi;16;tta;8;gaa;comp;;25;tgg;6;gca;;9;cac;14;cca;;5;caa;3;atgf;10;cca;12;5s;;;;7;caa;25;atgj;;3;cgt;10;gaa;;;;;63;cac;51;tca;16;gca;12;5s;direct;;dir     ;14;gca;dir   ;77;4;cgt;dir     ;29;cta;;;;comp;17;;tca;comp;104;;tca;comp;19;;atgj;dir;161;;gta;;;;;23s;55;;gaa;9;;cca;15;;comp;17;tca;dir    ;3;tta;;;;;dir    ;15;cca;comp;11;gac;;;;cds;200;23s;208;;23s;80;cca;10;aac;14;;aaa;9;ggc;12;cac;13;cac;26;ggc;40;;gac;50;tac;102;5s;76;;atgf;14;tta;5;direct;;tca;10;tgg;14;;dir    ;24;atgj;dir    ;5;tac;;;;dir    ;173;16s;;;;comp;47;atgf;comp;47;tcc;;;;dir    ;7;cgt;comp;:7;cds;SigmaK-factor processing regulatory protein BofA;*;;dir     ;309;16s;;;;dir    ;24;atgj;dir     ;33;gta;
:12;ttg;4;cca;;;;25;ggc;;19;tca;5;tcc;16;cca;19;atgf;comp;;9;cgt;53;caa;170;16s;;17;cca;9;cac;;;;9;cgt;50;caa;;1;atgf;;8;aac;;4;gta;comp;;8;aac;27;tca;29;ggc;3;agc;comp;;9;cac;14;cca;;47;caa;11;cgt;;14;ggc;8;gac;3;cgt;3;atgf;;;;6;ggc;5;gca;;16;tta;5;tcc;;140;16s;;5;caa;27;tca;10;cca;3;atgf;direct;;dir     ;59;tca;dir   ;77;1;cca;dir     ;10;ggc;;;;comp;12;;atgi;comp;23;;atgj;comp;9;;gca;dir;19;;aca;;;;;5s;:9;;gta;9;;cgt;9;;comp;4;atgi;dir    ;10;cgt;;;;;dir    ;20;gca;comp;18;ttc;;;;gac;26;16s;501;;5s;:9;cgt;9;5s;80;;caa;9;tgc;15;caa;8;caa;9;ggc;24;;ttc;22;caa;4;23s;129;;tca;38;cgt;20;direct;;atgf;2;cac;6;;dir    ;6;atgi;dir    ;11;tgg;;;;dir    ;288;23s;;;;comp;29;tca;comp;5;aac;;;;dir    ;157;gga;;;;;;;dir     ;119;23s;;;;dir    ;35;tca;dir     ;139;aca;
;;18;cgt;;;;5;tgc;;7;atgf;9;aac;11;cgt;47;5s;comp;;19;tta;6;ggc;47;23s;;9;cgt;52;caa;170;16s;;20;tta;6;ggc;;12;gac;;11;atc;;1;gaa;comp;;96;5s;1;atgf;14;cta;:13;aac;comp;;47;caa;11;cgt;;5;ggc;14;tta;;10;tgc;9;ttc;16;tta;174;gac;;;;30;tgc;67;5s;;29;ggc;9;aac;;98;23s;;14;ggc;3;atgf;3;cgt;:13;gac;direct;;dir     ;19;tca;dir   ;71;71;gga;dir     ;3;tta;;;;comp;19;;atgj;comp;17;;cca;comp;9;;cca;dir;9;;aaa;;;;;;;;atgf;11;;tta;14;;comp;20;atgj;dir    ;15;cca;;;;;dir    ;56;tca;comp;10;aca;;;;gaa;3;cds;:6;;;;tta;14;23s;172;;cac;17;cgt;5;aaa;17;ggc;12;ttg;5;;aca;5;aaa;12;gca;20;;gac;10;cca;23;direct;;ttc;20;caa;10;;dir    ;10;tca;dir    ;8;cac;;;;dir    ;21;5s;;;;comp;16;atgi;comp;78;5s;;;;dir    ;:11;cds;phosphoenolpyruvate carboxylase;;;;;;dir     ;180;5s;;;;dir    ;3;atgf;dir     ;5;5s;
;;32;tta;;;;:13;ttg;;10;gac;99;5s;14;tta;228;23s;comp;;9;ggc;7;tgc;46;5s;;19;tta;6;ggc;47;23s;;9;ggc;7;tgc;;14;ttc;;6;tgg;;8;aac;comp;;77;23s;12;gac;4;aaa;;;;;5;ggc;14;tta;;6;tgc;42;ggc;;:15;ttg;3;aca;29;ggc;:14;;;;;41;tta;316;23s;;16;cta;92;5s;;4;5s;;10;tgc;9;gac;16;tta;;;;;dir     ;3;atgf;dir   ;1554;242;16s;dir     ;8;cgt;;;;comp;17;;gca;comp;12;;cgt;comp;5;;tta;dir;8;;cta;;;;;16s;164;;gac;12;;ggc;5;;comp;15;gca;dir    ;20;gca;;;;;dir    ;20;tca;comp;7;tac;;;;gta;2;;;;à enlever;;ggc;15;gca;46;;gac;12;cca;158;ctc;13;tgc;10;cca;19;;tac;16;cta;10;atc;38;;tca;9;gca;121;direct;;gga;34;ttg;:16;;dir    ;21;atgf;dir    ;22;caa;;;;dir    ;70;atgf;;;;comp;22;atgj;comp;218;23s;;;;;;;;;;;;;dir     ;131;atgf;;;;dir    ;8;gac;dir     ;63;aac;
;;11;ggc;;;;;;;20;ttc;228;23s;24;ggc;97;16s;comp;;10;ctg;245;tta;2;aac;;9;ggc;7;tgc;46;5s;;10;ctg;242;tta;;10;aca;;9;aca;;11;atc;comp;;8;gca;14;ttc;11;caa;10;gca;;;6;tgc;42;ggc;;673;tta;7;cta;;;;10;tgg;22;cta;;;;;;:16;ttg;:16;16s;;4;aaa;140;23s;;6;gta;;:15;ttg;9;ttc;29;ggc;140;16s;;;dir     ;8;gac;dir   ;2926;92;23s;dir     ;10;cca;;;;comp;5;;cca;comp;11;;ggc;comp;8;;ggc;dir;5;;ggc;;;;;23s;55;;ttc;5;;ctg;10;;comp;10;cca;dir    ;53;tca;;;;;dir    ;3;atgf;comp;19;tgg;;;;cgt;35;;;;acc;24;cta;5;atc;127;;gta;4;gca;4;ctg;5;tta;20;gga;1;;cac;18;ggc;5;5s;93;;atgi;28;16s;92;direct;;atc;13;;;;dir    ;11;ttc;dir    ;82;ttg;;;;dir    ;45;gac;;;;comp;14;gca;comp;406;16s;;;;dir     ;94;cds;hp;;;;;;dir     ;211;gac;;;;dir    ;40;ttc;dir     ;:7;cds;hp
;;8;aca;;;;;;;8;cac;:16;16s;6;cta;8;gga;comp;;37;aaa;  :16;ttg;342;acc;;10;ctg;246;tta;2;aac;;37;aaa;:16;ttg;;13;aaa;;9;ttc;;6;tgg;comp;;130;atc;10;aca;8;tac;5;ggc;;;673;tta;7;cta;;:16;ttg;37;aaa;;140;16s;8;atc;9;cac;;;;;;;;;;;11;caa;:15;16s;;9;aca;;;;6;aca;22;cta;82;23s;;;dir     ;14;ttc;dir   ;116;10;5s;dir     ;:9;gca;-;*;;comp;7;;cgt;comp;242;;aaa;comp;10;;cta;dir;13;;tta;;;;;5s;46;;aca;22;;aaa;37;;comp;3;cgt;dir    ;19;tca;;;;;dir    ;8;gac;comp;63;cac;;;;ggc;36;;;;aac;14;aaa;41;16s;:16;;aac;15;acc;5;ggc;14;cgt;3;aga;187;;caa;4;cgt;12;16s;367;;atgj;21;atc;166;direct;;agc;:18;16s;47;;dir    ;32;gga;<>dir    ;:13;cds;AraC family transcriptional regulator;*;;comp;:13;cds;hp;;;comp;3;cca;comp;:12;cds;hp;;;comp;21;ttg;;;;;;;dir     ;:14;cds;thiamine-phosphate kinase;*;;dir    ;17;gga;;;;
;;7;cta;;;;;;;15;gga;;;36;aaa;:4;cgt;comp;;29;aca;;;32;ggc;;37;aaa;:16;ttg;342;acc;;29;aca;;;;10;gga;;4;gac;;9;aca;comp;;:17;16s;13;aaa;5;gta;5;aaa;;;:16;ttg;37;aaa;;;;41;aca;;86;23s;1;aac;4;aca;;;;;;;;;;;9;tac;;;;24;cac;;;;10;tgg;9;cac;9;5s;;;dir     ;6;aca;dir   ;77;3;atgf;;;;;;;comp;5;;tta;comp;104;;aca;comp;186;;aca;dir;17;;cgt;;;;;aac;4;;tac;5;;aca;32;;comp;16;tta;dir    ;3;atgf;;;;;dir    ;10;ttc;comp;5;caa;;;;5s;68;;;;5s;80;aca;8;;;;tac;8;tcg;19;tgc;10;ttg;147;cds;:16;;aaa;15;ttg;7;cds;:13;;gca;17;23s;70;direct;;;;gca;153;;dir    ;7;atc;;;;;;;;;;;;;comp;13;cgt;;;;;;;comp;15;cgt;;;;;;;;;;;;;dir    ;17;gga;;;;
;;4;aaa;;;;;;;10;atc;;;5;aca;;;;;23;gta;;;16;cgt;;29;aca;;;32;ggc;;23;gta;;;;7;atc;;20;atgf;;8;ttc;comp;;;;10;gga;97;5s;65;caa;;;;;41;aca;;176;16s;22;gta;;9;5s;:19;gaa;4;gta;;;;;;;;;;;4;gta;45;5s;comp;29;cta;;;;8;atc;4;aca;4;aac;;;dir     ;11;tgg;dir   ;76;176;gac;;;;;;;comp;9;;ggc;comp;4;;gta;comp;91;;5s;dir;18;;cca;;;;;acc;56;;tgg;24;;gta;20;;comp;29;ggc;dir    ;8;gac;;;;;dir    ;6;aca;comp;14;ggc;;;;23s;208;;;;23s;172;gta;13;;;;aca;5;agc;17;cgt;5;cds;:17;;;;ctg;6;cca;7;;;;cca;9;5s;:9;direct;;16s;47;23s;72;;dir    ;69;agc;;;;;;;dir    ;393;cds;hp;;;comp;15;tta;;;;;;;comp;11;tgc;;;;;;;dir    ;528;cds;hp;;;dir    ;16;gga;;;;
;;10;gta;;;;;;;3;aac;;;23;gta;;;;;47;5s;;;4;cca;;23;gta;;;16;cgt;;47;5s;;;;7;aac;;54;tca;;4;gac;comp;;;;7;atc;141;23s;17;tac;;;;;22;gta;;54;23s;54;5s;;4;aac;;;97;5s;;;;;;;;;;;98;5s;140;23s;comp;16;ggc;;;;1;acc;4;gta;24;acc;;;dir     ;9;atc;dir   ;474;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;comp;9;;cta;comp;41;;gaa;comp;307;;23s;dir;:9;;gca;;;;;ggc;30;;cac;9;;5s;55;;comp;22;cta;dir    ;10;ttc;;;;;dir    ;10;tgg;comp;10;tgc;;;;16s;153;;;;gca;46;5s;81;;;;gaa;15;gtc;5;cca;105;;;cds;83;;ggc;10;gga;1 133;cds;107;;cgt;18;;;;;gca;153;5s;3;;dir    ;:18;cds;rod shape-determining protein MreC;;;;;;dir    ;173;16s;;;;comp;11;ggc;;;;;;;comp;6;ggc;;;;;;;dir    ;329;16s;;;;dir    ;4;gga;;;;
;;75;5s;;;;;;;3;agc;;;47;5s;;;;;81;23s;;;20;gca;;47;5s;;;4;cca;;170;23s;;;;:20;agc;;20;tca;;20;atgf;comp;;;;7;aac;:20;16s;5;gta;;;;;54;5s;;22;5s;176;23s;;24;acc;;;140;23s;;;;;;;;;;;140;23s;75;16s;comp;3;tta;;;;:20;gaa;98;5s;5;gaa;;;dir     ;1;caa;;;;;;;;;;;comp;163;;aaa;comp;91;;5s;comp;555;;16s;dir;-;;16s;suite2;;;;cgt;27;;caa;49;;23s;167;;comp;10;cac;dir    ;3;aca;;;;;dir    ;9;atc;comp;152;ttg;;;;cds;:5;;;;atc;127;23s;244;;;;gcc;9;acg;39;cds;:19;cds;797;gga;5;;tgc;26;cds;:17;cca;7;;tta;10;aaa;3;;;23s;72;gta;2;;;;;;;;;;;dir    ;233;23s;;;;comp;11;aca;;;;;;;comp;10;caa;;;;;;;dir    ;151;23s;;;;dir    ;42;atc;;;;
;;165;23s;;;;;;;:21;gaa;;;170;23s;;;;;14;gca   ;;;:7;atgj;;170;23s;;;20;gca;;:21;16s;;;;;;;16;gca;;54;tca;comp;;;;6;agc;;;24;gaa;;;;;176;23s;;30;gta;:21;16s;;5;gaa;;;:22;16s;;;;;;;;;;;:20;16s;1;gga;comp;10;cgt;;;;;;141;23s;17;gta;;;dir     ;167;gaa;;;;;;;;;;;comp;162;;aca;comp;284;;23s;comp;:12;;cds;exodeoxyribonuclease III;;;;;;;;cca;8;;ggc;5;;16s;:21;;comp;4;aca;dir    ;10;tgg;;;;;dir    ;1;aac;dir    ;:15;cds;DUF3884 family protein;*;;;;;;;16s;:4;16s;:21;;;;atc;54;tcc;41;;;16s;261;cca;16;;cgt;22;;;ttg;12;;ggc;3;caa;9;;;5s;3;gac;2;;dir    ;83;cds;hp;;;;;;dir    ;12;5s;;;;comp;13;cta;;;;;;;comp;20;cac;;;;;;;dir    ;36;5s;;;;dir    ;71;agc;;;;
;;34;gca;;;;;;;;;;;:9;16s;;;;;96;atc;;;;;;:21;16s;;;:7;atgj;;;;;;;10;ttg;;10;cca;;20;tca;comp;;;;:22;gaa;;;4;acc;;;;;:21;16s;;37;aca;;;;17;gta;;;;;;;;;;;;;;;;;3;cca;comp;14;cca;;;;;;:22;16s;65;tac;;;dir     ;:20;cds;CBS domain-containing protein;;;;;;;;;;comp;8;;gta;comp;437;;16s;;;;;;;;;;;;;gca;171;;tgc;7;;;;;comp;4;gta;dir    ;8;atc;;;;;dir    ;132;gaa;;;;;;;;;;;;;;;;;;;5s;112;ctc;283;cds;298;23s;94;cgt;4;;cca;9;cds;412;cgt;5;;cta;3;tac;29;;;gta;5;aaa;9;;comp;16;gaa;;;;;;;dir    ;1;aac;;;;comp;2;aaa;;;;;;;comp;39;tgg;;;;;;;dir    ;2;aac;;;;dir    ;:19;cds;hp;;;
;;75;atc;;;;;;;;;;;;;;;;;:23;16s;;;;;;;;;;;;;;;;;;14;tgc;;3;cgt;;16;gca;comp;;;;;;;;9;aac;;;;;;;;8;aaa;;;;65;tac;;;;;;;;;;;;;;;10;gca;92;cgt;comp;16;gca;;;;;;;;5;caa;;;;;;;;;;;;;;;;comp;145;;5s;comp;:16;;cds;6-phospho-3-hexuloisomerase;;;;;;;;;;;;16s;164;;tta;265;;;;;comp;97;5s;dir    ;1;aac;;;;;dir    ;:20;cds;CBS domain-containing protein;;;;;;;;;;;;;;;;;;23s;258;cds;:22;16s;254;5s;43;ggc;8;;gga;204;16s;108;ggc;35;;aaa;5;gta;7;;;gga;36;cta;10;;comp;50;atc;;;;;;;dir    ;17;tcc;;;;comp;7;gta;;;;;;;comp;89;aca;;;;;;;dir    ;16;tcc;;;;;;;;;;
;;:24;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5;ggc;;16;tta;;10;cca;comp;;;;;;;;82;5s;;;;;;;;42;cta;;;;5;caa;;;;;;;;;;;;;;;5;ggc;3;ctc;comp;4;atgj;;;;;;;;5;aaa;;;< dir;273;cds;group-specific protein;;;;;;;;;;comp;286;;23s;;;;;;;;;;;;;;;;;23s;55;;ttg;:16;;;;;comp;140;23s;dir    ;129;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;16s;403;;;23s;168;atc;11;cta;42;;cds;:21;5s;39;aaa;28;;aca;16;gaa;1;;;atc;10;aca;35;;comp;10;aca;;;;;;;dir    ;20;gaa;;;;comp;79;5s;;;;;;;comp;37;gac;;;;;;;dir    ;4;gaa;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;63;caa;;29;ggc;;3;cgt;comp;;;;;;;;141;23s;;;;;;;;14;ggc;;;;86;aaa;;;;;;;;;;;;;;;5;aaa;15;cta;comp;17;atgi;;;;;;;;10;ggc;;;comp;7;gaa;;;;;;;;;;;comp;506;;16s;;;;;;;;;;;;;;;;;5s;183;;;;;;;;comp;103;16s;dir    ;:20;cds;CBS domain-containing protein;*;;;dir    ;114;cds;SprT family protein;;;;;;;;;;;;;;;;;;cds;:23;cds;104;5s;15;gaa;5;aaa;8;;;;atc;20;gac;26;;gta;11;aac;10;;;gaa;13;ggc;8;;comp;5;cta;;;;;;;dir    ;36;gta;;;;comp;181;23s;;;;;;;comp;41;atgf;;;;;;;dir    ;24;gta;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;19;cac;;22;cta;;16;tta;comp;;;;;;;;:9;16s;;;;;;;;9;tta;;;;:8;gca;;;;;;;;;;;;;;;65;caa;5;aaa;comp;24;tca;;;;;;;;:9;gca;;;comp;4;agc;°;interc;;;;;;;;;dir     ;:21;;cds;MgtC/SapB family protein;;;;;;;;;;;;;;;;16s;164;;;;;;;;comp;:22;;cds;hp;;;;;;dir    ;3;aac;;;;;;;;;;;;;;;;;;;;;ggg;5;agc;29;gtc;5;caa;9;;;;gca;128;atgf;30;;5s;70;5s;70;;;tca;10;tta;11;;comp;73;aaa;;;;;;;dir    ;122;atgf;;;;comp;60;gca;;;;;;;comp;82;gta;;;;;;;dir    ;46;atgf;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;7;tgg;;9;cac;;29;ggc;comp;;;;;;;;;;;;;;;;;14;cgt;;;;;;;;;;;;;;;;;;;;16;tac;85;caa;comp;2;atgf;;;;;;;;;;;;comp;4;aac;comp;344;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;23s;55;;;;;;;;;interc;;;;;;;;;dir    ;8;agc;;;;;;;;;;;;;;;;;;;;;cca;106;atgj;39;atgf;4;tgg;4;;;;23s;130;gta;9;;23s;212;23s;468;;;atgf;2;cgt;7;;comp;18;gac;;;;;;;dir    ;28;gac;;;;comp;538;16s;;;;;;;comp;18;gaa;;;;;;;dir    ;38;gac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;17;tac;;4;aca;;13;cta;comp;;;;;;;;;;;;;;;;;6;cca;;;;;;;;;;;;;;;;;;;;5;gta;2;gac;comp;11;gac;;;;;;;;;;;;comp;11;atc;dir     ;242;16s;;;;;;;;Deuxième boîte, les blocs sont tous 16s23s5s-xaas,  (14  10  12  9), sauf la boîte 12 qui est 10aas-16s23s5s-atgf-gac.;;;;;;;;;;;;;;;;;;;;5s;:6;;;;;;;;dir    ;113;cds;SprT family protein;;;;;;;dir    ;4;gaa;dir    ;224;cds;hp;*;;;;;;;;;;;;;;;;cgt;11;gta;15;tgg;9;atgf;5;;;;agc;28;gaa;17;;gca;18;16s;:6;;;ttc;11;cca;:10;;comp;15;gta;;;;;;;dir    ;8;ttc;;;;comp;:26;cds;lysine--tRNA ligase;;;;;;comp;6;tcc;;;;;;;dir    ;21;ttc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5;gta;;4;gta;;5;aaa;comp;;;;;;;;;;;;;;;;;:9;gca;;;;;;;;;;;;;;;;;;;;23;gaa;24;atgf;comp;14;ttc;;;;;;;;;;;;comp;13;gga;dir     ;149;23s;°;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;3;aac;;interc;;;;;;dir    ;25;gta;dir    ;141;16s;;;;;;;;;;;;;;;;;;ggc;5;atgf;14;caa;8;gtc;5;;;;atgj;10;tcc;3;;atc;89;;;;;tac;6;;;;comp;200;5s;;;;;;;dir    ;1;tac;;;;;;;;;;;;;comp;146;aac;;;;;;;dir    ;22;tac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;24;gaa;;97;5s;;87;caa;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;acc;5;gta;comp;10;aca;;;;;;;;;;;;comp;10;aaa;dir     ;8;5s;dir     ;218;cds;hp;;*;;dir    ;271;;cds;hp;;;;;dir    ;146;;cds;SprT family protein;;;;;;;;;;;;;;;;dir    ;8;agc;dir    ;372;cds;lysine--tRNA ligase;*;;;dir    ;3;atgf;dir    ;86;23s;;;;;;;;;;;;;;;;;;ctg;13;gac;48;aaa;18;gaa;11;;;;gta;4;aac;18;;16s;:28;;;;;tgg;14;16s;47;;comp;193;23s;;;;;;;dir    ;16;tgg;;;;dir    ;40;cds;ISL3 family transposase;;;;;;comp;97;23s;;;;;;;dir    ;10;tgg;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;acc;;141;23s;;46;gac;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8;aac;8;gaa;comp;12;aaa;;;;;;;;;;;;comp;14;aca;dir     ;5;aac;dir     ;242;16s;;;;;dir    ;284;;16s;;;;;;dir    ;4;;aac;;;;;;;;;;;;;;;;;dir    ;4;gaa;dir    ;140;16s;;;;;dir    ;87;gac;dir    ;9;5s;;;;;;;;;;;;;;;;;;ctc;16;ttc;5;ctg;4;atc;43;;;;aca;19;5s;76;;;;;;;;cac;6;gca;153;;comp;66;gca;;;;;;;dir    ;74;cac;;;;dir    ;69;rpr;;;;;;;comp;104;5s;;;;;;;dir    ;22;cac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;aac;;:19;16s;;4;gta;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;98;5s;3;agc;comp;11;gga;;;;;;;;;;;;comp;9;ttc;dir     ;12;tcc;dir     ;145;23s;;;;;dir    ;143;;23s;dir    ;254;;cds;hp;dir    ;15;;agc;dir     ;307;;16s;suite2;;;;;;;;;;;;dir    ;26;gta;dir    ;97;23s;;;;;dir    ;5;caa;dir    ;4;aac;;;;;;;;;;;;;;;;;;aaa;10;aca;9;ggc;11;5s;94;;;;gac;77;23s;400;;;;;;;;caa;10;23s;72;;comp;345;16s;;;;;;;dir    ;5;ggc;;;;comp;3;cca;;;;;;;comp;378;16s;;;;;;;dir    ;3;caa;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;96;5s;;;;;8;gaa;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;141;23s;:13;aac;comp;4;atc;;;;;;;;;;;;comp;1;gac;dir     ;5;gaa;dir     ;8;5s;;;;;dir    ;10;;5s;dir    ;142;;16s;;dir    ;49;;gaa;dir     ;91;;23s;;;;;;;;;;;;;dir    ;3;atgf;dir    ;4;5s;;;;;dir    ;16;aaa;dir    ;22;acc;;;;;;;;;;;;;;;;;;tac;28;tac;15;cgt;12;23s;255;;;;ttc;6;16s;493;;;;;;;;ttg;:13;5s;3;;comp;:8;cds;ribosome-associated translation inhibitor RaiA;;;;;;dir    ;15;tgc;;;;comp;13;cgt;;;;;;;comp;:14;cds;hp;;;;;;dir    ;9;ggc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;141;23s;;;;;3;agc;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:9;16s;;;;8;aac;;;;;;;;;;;;comp;19;atgf;dir     ;23;gta;dir     ;4;aac;;;;;dir    ;7;;aac;dir    ;144;;23s;;dir    ;22;;gac;dir     ;7;;5s;;;;;;;;;;;;;dir    ;86;gac;dir    ;4;gta;;;;;dir    ;98;ctc;dir    ;5;gaa;;;;;;;;;;;;;;;;;;ttc;12;aaa;183;cca;577;16s;306;;;;tac;7;cds;:11;;;;;;;;;;gta;5;;;;;;;;;;;dir    ;215;ttg;;;;comp;15;tta;;;;;;;;;;;;;;;;dir    ;7;tgc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:11;16s;;;;;:35;aac;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;6;agc;;;;;;;;;;;;comp;17;tca;dir     ;3;atgf;dir     ;23;acc;;;;;dir    ;18;;tcc;dir    ;10;;5s;;dir    ;8;;caa;dir     ;161;;gta;;;;;;;;;;;;;dir    ;5;caa;dir    ;13;aca;;;;;dir    ;4;cgt;dir    ;16;gta;;;;;;;;;;;;;;;;;;5s;159;cds;:9;cds;:11;cds;:12;;;;aaa;154;;;;;;;;;;;;gga;36;;;;;;;;;;;<>dir    ;:13;cds;hp;;;comp;11;ggc;;;;;;;;;;;;;;;;dir    ;219;ttg;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:22;gaa;;;;;;;;;;;;comp;4;atgi;dir     ;8;gac;dir     ;5;gaa;;;;;dir    ;4;;gaa;dir    ;26;;aac;;dir    ;62;;cta;dir     ;19;;aca;;;;;;;;;;;;;dir    ;17;aaa;dir    ;14;aaa;;;;;dir    ;1;cca;dir    ;65;tac;;;;;;;;;;;;;;;;;;23s;256;;;;;;;;;;cds;:10;;;;;;;;;;;;atc;10;;;;;;;;;;;;;;;;;comp;11;aca;;;;;;;;;;;;;;;;dir    ;:14;cds;ISL3 family transposase;*;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;17;atgj;dir     ;14;ttc;dir     ;9;gta;;;;;dir    ;20;;gta;dir    ;18;;acc;;dir    ;60;;ctc;dir     ;9;;aaa;;;;;;;;;;;;;dir    ;93;ctc;dir    ;29;cta;;;;;dir    ;76;gga;dir    ;5;caa;;;;;;;;;;;;;;;;;;16s;537;;;;;;;;;;;;;;;;;;;;;;;gaa;:5;;;;;;;;;;;;;;;;;comp;13;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;14;gca;dir     ;9;aca;dir     ;63;tac;;;;;dir    ;3;;atgf;dir    ;7;;gaa;;dir    ;16;;cgt;dir     ;8;;cta;;;;;;;;;;;;;dir    ;4;cgt;dir    ;16;ggc;;;;;dir    ;141;16s;dir    ;5;aaa;;;;;;;;;;;;;;;;;;cds;:9;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;2;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;8;cca;dir     ;7;tac;dir     ;5;caa;;;;;dir    ;38;;gac;dir    ;176;;gta;;dir    ;15;;cca;dir     ;5;;ggc;;;;;;;;;;;;;dir    ;1;cca;dir    ;3;tta;;;;;dir    ;45;23s;dir    ;10;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;7;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;3;cgt;dir     ;10;tgg;dir     ;5;aaa;;;;;dir    ;32;;ttc;dir    ;8;;aca;;dir    ;106;;gga;dir     ;13;;tta;;;;;;;;;;;;;dir    ;76;gga;dir    ;8;cgt;;;;;dir    ;12;5s;dir    ;117;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;82;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;10;tta;dir     ;113;cac;dir     ;10;ggc;;;;;dir    ;7;;tac;dir    ;46;;tac;;dir    ;308;;16s;dir     ;17;;cgt;;;;;;;;;;;;;dir    ;139;16s;dir    ;9;cca;;;;;dir    ;2;atgf;dir    ;:9;cds;glycerate kinase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;181;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;29;ggc;dir     ;4;caa;dir     ;97;gca;;;;;dir    ;14;;tgg;dir    ;8;;caa;;dir    ;91;;23s;dir     ;18;;cca;;;;;;;;;;;;;dir    ;46;23s;dir    ;:9;gca;;;;;dir    ;174;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;60;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;18;cta;dir     ;10;ggc;dir     ;:9;cds;glycerate kinase;;*;;dir    ;41;;cac;dir    ;56;;aaa;;dir    ;165;;5s;dir     ;:9;;gca;;;;;;;;;;;;;dir    ;12;5s;dir    ;-;16s;suite2;;;;dir    ;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;596;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;9;cac;dir     ;11;tgc;;;;;;;;dir    ;5;;caa;dir    ;6;;ggc;;dir    ;3;;atgf;dir     ;-;;16s;suite3;;;;;;;;;;;;dir    ;3;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;:9;cds;response regulator transcription factor;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;aca;dir     ;309;ttg;;;;;;;;dir    ;8;;ggc;dir    ;255;;gca;;dir    ;155;;gac;;;;;;;;;;;;;;;;;dir    ;174;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;4;gta;dir     ;:15;cds;HNH endonuclease;;;;;;;dir    ;6;;tgc;dir    ;:10;;cds;arginase;dir    ;:12;;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;dir    ;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;144;5s;;;;;;;;;;;dir    ;132;;ttg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;237;23s;;;;;;;;;;;dir    ;:14;;cds;tyrosine-type recombinase/integrase;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;112;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;366;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;139;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;:22;cds;MgtC/SapB family protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;97;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;8;5s;dir     ;103;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;2;aac;dir     ;140;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;17;tcc;dir     ;86;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;4;gaa;dir     ;9;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;26;gta;dir     ;4;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;3;atgf;dir     ;21;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;9;gac;dir     ;5;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;18;ttc;dir     ;16;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;10;aca;dir     ;65;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;7;tac;dir     ;5;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;19;tgg;dir     ;5;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;63;cac;dir     ;10;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;5;caa;dir     ;116;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;14;ggc;dir     ;:9;cds;glycerate kinase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;10;tgc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;144;ttg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;:15;cds;DUF3884 family protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;

génomes clostridia[modifier | modifier le wikicode]

62;Acetobacterium woodii DSM 1030 ;;;;67;Acetohalobium arabaticum DSM 5501 ;;;;;;;;;;;;;;;;51;Butyrivibrio proteoclasticus B316 ;;;;70;Clostridium beijerinckii 59B ;;;;87;Clostridium botulinum BKT015925 ;;;53;Clostridium botulinum CDC 297 ;;;81;Clostridium novyi NT ;;;;;77;Clostridium pasteurianum BC1 ;;;;;;53;Clostridium tetani 12124569 ;;;;54;Dehalobacter restrictus DSM 9455 PER-K23 ;;;;68;Desulfosporosinus acidiphilus SJ4 ;;;;;69;Eubacterium acidaminophilum DSM 3953 ;;;;;;;;;48;Filifactor alocis ATCC 35896 ;;;;;48;Finegoldia magna ATCC 29328 ;;;;;59;Halanaerobium hydrogeniformans ;;;;;78;Halobacteroides halobius DSM 5150 ;;;;;109;Heliobacterium modesticaldum Ice1 ATCC 51547 ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;98;Symbiobacterium thermophilum IAM 14863 IAM14863 ;;;;;48;Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 ;;;;;;53;Thermincola potens JR ;;;;;;57;Thermoanaerobacter brockii subsp. finnii Ako-1 ;;;;;;58;Thermoanaerobacterium thermosaccharolyticum DSM 571 ;;;
cd001;655;Chromosome;;;cd002;555;Chromosome ;;;cd003;11,10,10;chromosome;;110 tRNAs;;;;;;;;cd011;666;Chromosome;;;cd032;17,16,16;Chromosome;;;cd045;10,10,10;Chromosome;;cd047;554;Chromosome;;cd063;10,10,10;Chromosome;;;;cd064;999;Chromosome;;;;;cd079;546;Chromosome;;;cd084;444;Chromosome;;;cd092;898;Chromosome;;;;cd102;777;Chromosome;;;;;;;;cd112;444;Chromosome ;;;;cd113;444;Chromosome;;;;cd114;444;Chromosome;;;;cd116;555;Chromosome;;;;cd118;10,10,10;Chromosome;;;;;;;cd133;9,10,10;chromosome;;;;;;;;cd136;14,16,13;Chromosome;;;;;;;;;;;cd153;666;Chrpmosome;;;;cd155;533;Chromosome;;;;;cd160;333;Chromosome;;;;;cd161;444;Chromosome;;;;;cd170;555;Chromosome;;
3*16s23s5s;;;;;16atcgca235;;;;;3*16s23s5s;;;;;;;;;;;;16s5s23s;;;;;7*16s23s5s;;;;;3*16s23s5s;;;;16s23s5s;;;;4*16s23s5s;;;;;;16s23s5s;;;;;;;16s23s5s-atgi-gca;;;;;2*16-gca-235;;;;;5*16s23s5s;;;;;;2*16-gca-235;;;;;;;;;;16s23s-gca-5s-gta-tac-gga-cga;;;;;;16s-atc-235;;;;;;16atcgca235;;;;;;16s23s5s-aac;;;;;;2*16s5s-gcc-23s;;;;;;;;;3*16s23s5s;;;;;;;;;;s°   ribosomal RNA rRNA prediction is too short;;;;;;;;;;;;;2*16s23s5s;;;;;;16atcgca235;;;;;;;16-cds-atcgca-23s16s°5s  cds ci-dessous;;;;;;;2*16s23s5s;;;;;;;3*16s23s5s;;;;
16s-gcaatc-235-6aas;;;;;16atcgca235-6aas;;;;;16-gca-2355;;;beCoA;bifunctional enoyl-CoA hydratase/phosphate  acetyltransferase;;*;;;;;;16s5s23s-gac-aca;;;;;NCBI et gtRNAdb ne concordent pas.;;;;;16s23s5s-atgi-gca;;;;16s23s5s-aac;;;;16s23s-aac-5s-aac;;;;;;16s23s5s-atgi-gca;;;;;;;16s23s5s-aaa;;;;;16s23s5s;;;;;2*16atcgca235;;;;;;2*16s23s5s;;;;;;;;;;tcc-16s-cds-235-19aas;;;;;;16s23s5s;;;;;;2*16atcgca235-acc;;;;;;16s23s5s-caa-gaa-tac-ggc;;;;;;16s5s-gcc-23s-19aas;;;;;;;;;2*16s-gca-235;;;;;;;;;;s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends ;;;;;;;;;;;;;16s23s5s-gtg-gaa-cgg;;;;;;16s23s5s;;;;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;16s-23s°-gca-atc-23s-16s°-5s-6aas;;;;;;;16s23s5s-aac-ggg;;;;
5aas-16s-gcaatc-235-6aas;;;;;3*16s23s5s-12,9,4 aas;;;;;16-atc-235;;;2pK;two pore domain potassium channel family protein;;;;;;;;16s5s-atc-23s;;;;;2*16s23s5s-atgi-gca;;;;;16s23s5s-aaa;;;;16s23s5s-ttc;;;;16-gca-atc-23-aac;;;;;;2*16s23s5s-aaa;;;;;;;16s23s5s-ttc;;;;;16atcgca-cds-235;;;;;16-gca-235;;;;;;2*16-gca-235-22,21aas;;;;;;;;;;16s-cds-235;;;;;;16s-gca-235-11 aas;;;;;;16s23s5s-13 aas;;;;;;16atcgca235-acc;;;;;;16s5s-gcc-23s-5aas;;;;;;;;;16s23s-gga-5s;;;;;;;;;;;;;;;;;;;;;;;2*16s23s5s-12aas;;;;;;16s23s°23s5s;;;;;;;;long;interc;;;;;23s°-16s-16s°-23s-5s-aac-ggg;;;;;;;16-gcaatc-235-6aas;;;;
5s;;;;;interc;;interc;;;3*16s23s5s-22,13,9aas;;;Aspam;aspartate aminotransferase family protein;;;;;;;;agc-16s5s23s-6aas;;;;;16s23s5s-ttc-gac-gaa;;;;;16s23s-aac-5s-aac;;;;16s23s5s-aac-aac;;;;16s23s5s-ttc-5s-ttc-aaa;;;;;;16s23s5s-ttc;;;;;;;16s-atc-23s;;;;;;;;;;8aas-16s;;;;;;16s23s5s-8aas;;;;;;;;;;tcg-16s23s-gca-5s-12aas;;;;;;16s-gca-235-18 aas;;;;;;;;;;;;16s23s5s-8 aas;;;;;;16s5s23s-aaa-acc-ctc;;;;;;;;;16s23s5s-43aas;;;;;;;;;;C196;9,10,10;;M8;;;;;;;;;;16s23s5s-13aas;;;;;;16s23s°23s5s-5s-5s;;;;;;;<comp;411;185;cds;hp;;;;long;interc;;;;;;;;;
interc;;interc;;;80;16s;109;16s;;2*16-gca-235,22,13aas;;;;;;;;;;;;tca-tcc-16s5s23s-5aas;;;;;2*16s23s-aac-5s;;;;;16s23s5s-ttc-5s-ttc-aaa;;;;16s5s-atgi-gca;;;;16s23s5s-aaa;;;;;;16-atc-235-ttc-tgc;;;;;;;16s°-atc-235-atgi-gca;;;;;MLMPSVAHFNIAPSMARRSLSLFAIHGIAILEHPCSLKTAQREKQNAKCESKDNEMAFKF;;;*;;;;;;;;;;;;;;;;;;;;;;;;;interc;;;;;comp;184;cds;alanine--glyoxylate aminotransferase family protein;*;;16s23s5s-21 aas;;;;;;16s5s-atc-23s-aac;;;;;;;;;16s23s5s-18aas;;;;;;;;;;3*16s23s5s;;;3*16s23s5s;;;;;;;;;;;;;;;;;long;interc;;;;;dir    ;1541;12;16s;;;;dir     ;393;324;cds;30S ribosomal protein S9;*;;;interc;;;
226;aaa;169;aaa;;20;atc;109;23s;;cd003;long;inter;;;;;;;;;;16s5s-gca-23s-aac-gaa-tgc;;;;;16s-atc-23s-aac;;;;;16s-gca-atc-235-6aas;;;;interc;;long;;16s23s5s-atgi-gca;;;;;;16s23s5s-aac;;;;;;;23s5s-aaa;;;;;;;;;;comp;456;cds;cob(I)yrinic acid a,c-diamide adenosyltransferase;*;;interc;long;;interc;long;;interc;long;;;tcc-16s-cds-235-19aas hp ci-dessous;;;;;;dir    ;337;cds;peptidoglycan-binding protein;*;;comp;4;ggc;;;;;;;;;;16s5s-atcgca-23s-aac-atgf;;;;;;;;;16s-gca-235-9aas;;;;;;;;;;2*16s-gca-235;;;16s’-gca-23s°-16s°-23s    16s°-gca-23s’;;;;;;;;;;;interc;;;;;comp;1119;606;cds;sulfate permease;*;;dir    ;222;207;cds;hp;;;dir     ;1622;-1554;16s;;;;dir     ;353;cds;30S ribosomal protein S9;*
22;tac;23;tac;;53;gca;28;5s;;comp;1538;315;16s;suite1;;;;;;;;interc;;interc;;;5s-ttc;;;;;gca-atc-gga-16s23s5s;;;;3;gca;;;16-gca-atc-235-6 aas;;;;;;atgi-gca-16s23s5s-aac;;;;;;;interc;long; ;;;;;;;;comp;4;tta;;;;356;1911;cds;415;1605;cds;196;828;cds;;MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT;;;;*;;dir    ;42;16s;;;;comp;48;tac;;;;comp;381;cds;hp;;;15aas-16s5s-atcgca-23s;;;;;;;;;16s23s-aca;;;;;;;;;;16s23s-gga-5s;;;16s23s-gga-5s;;;;;;;;;;dir    ;463;cds;glutamate--tRNA ligase;*;;dir     ;1706;-1607;16s;;;;dir    ;77;94;atc;;;;dir     ;106;1501;23s°;;;;dir     ;273;16s;;
77;aca;163;aca;;109;23s;9;caa;;comp;74;8;gga;;;;;;;;;510;agc;59;tca;;16s-gca-23s5s;;;;;16s-gca-atc-23s-aac;;;;8;atgi;;;;;;;;;16s23s5s-5aas;;;;;;;200;2848;23s;comp;;;;;;;comp;11;tgc;;;;65;1534;16s;65;1534;16s;5;;gga;;;interc;;;;;dir    ;124;gca;;;;comp;8;gcc;;;;dir     ;95;16s;;;;cgg-tgg-16s5s-gcc-23s-5aas;;;;;;;;;;;;;;;;;;;16s23s-aca;;;16s23s-aca;;;;;;;;;;dir    ;212;16s;;;;dir     ;104;1767;23s°;;;;dir    ;76;356;gca;;;;dir     ;76;1;gca;;;;dir     ;1;gca;;
15;gac;15;gac;;27;5s;117;gaa;;comp;76;13;aca;;;;;;;;;61;16s;156;tcc;;16235-aaa-cds-5s-aaa;;;;;interc;;;;79;5s;;;;interc;;;;;;;;;;;;66;;atc;comp;;;;;;;comp;1;gga;;;;34;;gca;34;;gca;27;;ggc;;comp;403;cds;DUF2232 domain-containing protein;*;;dir    ;43;23s;;;;comp;6;acc;;;;dir     ;89;23s;;;;ttc-cds-16s5s-atc-23s-aac-atgf;;;;;;;;;long;interc;;;long;interc;;;;;16s23s5s-43aas ;;;16s-cds-23s°-5s-43aas;;;;;;;;;;dir    ;46;23s;;;;dir     ;3095;50;23s;;;;dir    ;3168;-2889;23s;;;;dir     ;77;64;atc;;;;dir     ;74;atc;;
53;gaa;53;gaa;;9;aac;5;gta;;comp;77;12;gac;;;long;interc;;;;;256;5s;61;16s;;16s-gcaatc-23s5s-ttc-tgc;;;;;61;gag;;;117;16s;;;comp;237;cds;DNA/RNA nuclease SfsA;;;;long;interc;;;;;166;553;16s°;comp;;;;;;;comp;7;aac;;;;93;2916;23s;93;2916;23s;79;;cta;;comp;109;agg;;;;dir    ;318;5s;;;;comp;74;gac;;;;dir     ;76;5s;;;;;;;;;;;;;1206;505;cds;glycosyl transferase;705;281;cds;N-acetylmuramoyl-L-alanine amidase CwlD;*;;16s23s5s-18aas ;;;cds-cds-23s°-5s-18aas;;;;;;;;;;dir    ;58;5s;;;;dir     ;114;602;5s;;;;dir    ;102;3026;16s°;;;;dir     ;3351;-3087;23s;;;;dir     ;266;23s;;
11;aac;11;aac;;132;caa;3;gac;;comp;77;83;atgf;;dir    ;909;505;cds;beCoA;;;76;23s;256;5s;;interc;long aas;;;;6;caa;;;:2;cds;108 pb;;comp;53;gag;;;;dir   ;255;844;cds;pro-sigmaK processing inhibitor BofA;*;;;;;;;;;;;;comp;61;agc;;;;5;117;5s;5;117;5s;11;;tac;;comp;6;tgc;;;;dir    ;3;aac;;;;comp;29;gta;;;;dir     ;22;caa;;;;interc;;interc;;interc;;interc;;;1508;279;16s;;1509;279;16s;;;;16s-gca-235-9aas ;;;16s°-23s°-5s-9aas;;;;;;;;;;dir    ;3;aac;;;;dir     ;3084;:0;cds;HAMP domain-containing protein;*;;dir    ;117;89;5s;;;;dir     ;86;3032;16s°;;;;dir     ;6;5s;;
346;5s;346;5s;;5;gta;8;aca;;comp;76;77;atgj;;dir    ;1538;61;16s;;;;34;gac;77;23s;;190;250;cds;direct;;4;aga;;;;;;;comp;6;caa;;;;dir   ;1513;235;16s;;;;6;;gca;comp;;;;;;;comp;6;acc;;;;17;;aac;11;;aac;6;;aca;;comp;41;cac;;;;dir    ;4;tta;;;;comp;11;gaa;;;;dir     ;54;gaa;;;;541;cds;260;cds;219;cds;487;cds;;2900;180;23s;;2901;131;23s;;;;;;;;;;;long;interc;;;;;dir    ;6;ggc;;;;;;;;;;;comp;1143;:2;cds;peptidase C45;;;dir     ;152;9;5s;;;;dir     ;6;aac;;
333;23s;330;23s;;3;gac;17;aaa;;comp;76;9;ttc;;dir    ;76;290;gca;;;;30;gta;41;aac;;5;;aaa;comp;;19;gga;;;;;;;comp;5;aga;;;;dir   ;2907;118;23s;;;;6;;atgi;comp;;;;;;;comp;6;tca;;;;7;;atgf;15;;tta;6;;gac;;comp;9;atgi;;;;dir    ;26;atgf;;;;comp;11;agc;;;;dir     ;128;gta;;;;253;16s;5;gac;236;23s;252;16s;;117;6;5s;;117;6;5s;;;;;;+;16s23s5s-19aas;;;dir   ;705;281;cds;N-acetylmuramoyl-L-alanine amidase CwlD;*;;dir    ;95;atgj;;;;16s23s5s-5s5s;;;;;;;;;;;;;;dir     ;75;6;aac;;;;dir     ;7;gaa;;
18;atc;18;atc;;8;aca;57;atgf;;comp;77;5;atc;;dir    ;2938;179;23s;;;;6;aca;5;gaa;;159;;5s;comp;;16;cta;;;;;;;comp;14;gga;;;;dir   ;117;26;5s;;;;107;117;5s;comp;;;;;;;comp;215;gac;;;;17;;gaa;7;;atgf;16;;gta;;comp;14;atgj;;;;dir    ;101;atgj;;;;comp;12;atgj;;;;dir     ;4;gac;;;;64;5s;10;gta;6;gca;64;5s;;75;6;aac;;75;4;aac;;;;;;+;16s23s5s-tta-atgi;;;dir   ;977;100;16s°;;;;dir    ;5;ttc;;;;dir     ;660;232;cds;sporulation protein YunB;*;;16-cds-atcgca-23s16s°5s  cds ci-dessous;;;;;;;dir     ;75;9;gaa;;;;dir     ;18;atgi;;
245;gca;92;gca;;:8;aaa;16;ttc;;comp;77;6;cca;;dir    ;117;8;5s;;;;66;tac;36;atgi;;294;316;cds;comp;;4;gaa;;;;;;;comp;17;cta;;;;dir   ;75;62;gaa;;;;200;2822;23s;comp;;;;;;;comp;47;16s;;;;5;;gta;17;;gaa;5;;gaa;;comp;4;ttc;;;;dir    ;7;gaa;;;;comp;36;gga;;;;dir     ;6;aca;;;;234;gcc;4;gaa;64;atc;6;atc;;86;15;tta;;75;5;gaa;;;;;;+;16s23s5s;;;dir   ;1519;126;23s°;;;;dir    ;6;tac;;;;dir     ;1656;-1583;16s;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;dir     ;76;25;atgi;;;;dir     ;13;gac;;
268;16s;:8;16s;;;;10;cta;;comp;76;22;tgg;;dir    ;75;5;aac;;;;6;atgf;57;gta;;7;;aaa;comp;;97;5s;;;;;;;comp;6;gaa;;;;dir   ;84;7;cta;;;;66;;atc;comp;;;;;;;dir;:8;cds;hp;;;9;;gac;5;;gta;93;117;5s;;comp;15;tca;;;;dir    ;41;gta;;;;comp;8;atgf;;;;dir     ;18;aaa;;;;119;23s;18;aaa;328;5s;229;gca;;76;7;atgf;;76;5;gta;;;;;;+;16’-gca-235-tta-atgi;;;dir   ;117;7;5s;;;;dir    ;7;ggc;;;;dir     ;107;1859;23s°;;;;;long;interc;;;;;dir     ;77;9;gac;;;;dir     ;269;ttc;;
9;tgc;;;;30;cca;8;gga;;comp;77;14;atgi;;dir    ;89;15;tta;;;;:7;ttc;:7;tta;;138;;5s;comp;;94;23s;;;;;;;comp;24;5s;;;;dir   ;75;7;ggc;;;;:3;1467;16s;comp;;;;;;;;;;;;;5;;aca;49;;gac;82;2916;23s;;comp;4;aaa;;;;dir    ;5;gac;;;;comp;20;aaa;;;;dir     ;4;gga;;;;6;tcc;103;caa;505;16s;112;23s;;75;9;gaa;;77;10;gac;;;;;;;;;;dir   ;75;6;aac;;;;dir    ;116;gtc;;;;dir     ;3267;50;23s;;;;comp;429;185;cds;hp;;;dir     ;76;29;ttc;;;;comp;186;acg;;
6;ggc;;;;56;gga;13;aga;;comp;77;9;cca;;dir    ;76;5;atgf;;;;;;;;;339;;23s;comp;;3;atc;;;;;;;comp;127;23s;;;;dir   ;74;3;gga;;;;;;;;;;;;;;;;;;;;7;;tac;8;;aca;510;1534;16s;;comp;10;caa;;;;dir    ;23;aca;;;;comp;29;caa;;;;dir     ;150;cca;;;;10;ccg;237;23s;1;ggc;6;aac;;74;5;gga;;75;14;aca;;;;;;+;23s5s;;;dir   ;86;15;tta;;;;dir    ;5;gac;;;;dir     ;114;330;5s;;;;dir    ;1541;12;16s;;;;dir     ;75;254;acg;;;;dir     ;:8;cds;HlyD family efflux transporter periplasmicadaptor subunit;*
311;ttc;;;;17;atgf;:12;cac;;comp;92;14;agc;;dir    ;77;9;atgj;;;;61;16s;;;;771;;16s;comp;;74;gca;;;;;;;comp;3;atc;;;;dir   ;77;509;aga;;;;;;;;;;;;;;;;;;;;9;;gga;24;;cta;:8;888;cds;;comp;11;aga;;;;dir    ;11;tac;;;;comp;32;5s;;;;dir     ;:8;cds;signal peptide peptidase SppA;*;;14;gga;64;gcc;32;ctg;243;atgf;;76;5;gta;;85;9;tac;;;;Décompte;;+;16s;;;dir   ;76;7;atgf;;;;dir    ;3;ctg;;;;dir     ;109;557;5s;;;;dir    ;222;207;cds;hp;;;dir     ;1287;:8;cds;tetratricopeptide repeat protein;*;;;;;;
12;gac;;;;8;aaa;;;;comp;89;8;tca;;dir    ;75;8;gaa;;;;5;5s;;;;:2;371;cds;comp;;:8;16s;;;;;;;comp;80;gca;;;;dir   ;693;;cds;DNA/RNA nuclease SfsA;;;;;;;;;;;;;;;;;;;10;;aga;9;;ggc;;;;;comp;6;ggc;;;;dir    ;39;ggc;;;;comp;94;23s;;;;;;;;;;1;cac;328;5s;42;ccc;:4;cds;;77;9;gac;;74;10;gga;;;;16s;14;;;;;dir   ;75;8;gaa;;;;dir    ;18;atc;;;;dir     ;109;564;5s;;;;dir    ;77;94;atc;;;;;;;;;;;;;;;
:13;gta;;;;3;aca;109;16s;;comp;76;4;aaa;;dir    ;76;125;gta;;;;212;gca;;;;;;;;;;;;;;;;;comp;405;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;8;;caa;23;;aga;;;;;comp;6;cta;;;;dir    ;875;cgt;;;;comp;680;16s;;;;comp;110;cds;tRNA 2-thiouridine(34) synthase MnmA  assembly pathway, ATPase PilB;*;;9;tgc;651;16s;4;cgt;;;;75;14;aca;;77;9;aga;;;;16s’;2;+;16s23s°-cds;;;dir   ;74;4;gga;;;;dir    ;2;acg;;;;dir     ;2277;:0;cds;5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase;*;;dir    ;76;186;gca;;;;;long;interc;;;;;;;;;
;;;;;5;gac;109;23s;;comp;76;6;caa;;dir    ;77;69;gac;;;;113;23s;;;;543;341;cds;comp;;;;;;;;;;comp;:8;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;34;;aaa;9;;caa;;;;;comp;28;aca;;;;dir    ;:12;cds;hp   4904 aas !!;;;comp;:13;cds;D-alanyl-D-alanine carboxypeptidase;*;;comp;131;riboswitch;;;;3;gtc;:6;cds;120;ggc;155;cds;;85;8;tac;;76;11;caa;;;;16s°;5;+;3*16s-23s°;;;dir   ;76;5;gta;;;;dir    ;145;tcg;;;;;;;;;;;dir    ;3166;-2889;23s;;;;comp;738;128;cds;SDR family oxidoreductase;*;;;;;;
;;;;;132;gta;28;5s;;comp;77;8;aga;;dir    ;85;39;tac;;;;43;aac;;;;140;;16s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;7;;tca;11;;aaa;;;;;comp;5;gac;;;;;;;;;;;;;;;;comp;133;cac;;;;6;ttc;;;42;atgj;213;ttc;;84;29;cta;;76;2;aaa;;;;23s;11;;;;;dir   ;77;10;gac;;;;dir    ;:12;cds;polyamine aminopropyltransferase;*;;;;;;;;;dir    ;102;3026;16s°;;;;comp;75;13;ggg;;;;;;;;
;;;;;8;gaa;8;caa;;comp;74;8;gga;;dir    ;83;321;cta;;;;13;gaa;;;;3;;gca;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;25;;ttc;24;;tca;;;;;comp;35;gta;;;;dir     ;430;cds;aminopeptidase;;;;;;;;;comp;9;aga;;;;4;tac;439;cds;16;agc;563;cds;;77;7;aga;;89;17;tca;;;;23s’;2;+;16s°-23s°-23s’-5s;;;dir   ;75;9;ggc;;;;;;;;;;;;;;;;;dir    ;117;336;5s;;;;comp;75;10;aac;;;;;;;;
;;;;;28;caa;139;gaa;;comp;76;13;aca;;dir    ;75;12;ggc;;;;:4;tgc;;;;111;;atc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;;atgj;5;;agc;;;;;comp;2;gaa;;;;dir     ;42;16s;;;;;;;;;;comp;13;gga;;;;17;caa;237;23s;6;atgf;252;16s;;76;88;caa;;91;8;agc;;;;23s°;11;+;23s°-5s;;;dir   ;74;954;aga;;;;dir     ;416;cds;DUF1646 domain-containing protein;*;;;;;;;;;comp;549;:2;cds;cytochrome c3;;;comp;109;32;5s;;;;;;;;
;;;;;109;5s;7;tac;;comp;77;125;gac;;dir    ;76;12;cac;;;;;;;;;70;;23s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;29;;atgi;7;;cca;;;;;comp;7;atgf;;;;dir     ;124;gca;;;;;;;;;;comp;13;ttc;;;;4;aaa;64;gcc;7;aac;64;5s;;89;3;tca;;77;85;cca;;;;5s;14;+;16s°gca-23s°;;;dir   ;840;:9;cds;TIGR00159 family protein;*;;dir     ;280;16s;;;;;;;;;;;;;;;;;;comp;3731;-350;23s;;;;;;;;
;;;;;109;23s;:4;ggc;;comp;76;12;gta;;dir    ;75;4;tgc;;;;;;;;;5;;5s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;;cca;25;;atc;;;;;comp;8;tta;;;;dir     ;43;23s;;;;;;;;;;comp;4;atgf;;;;5;gaa;328;5s;4;gaa;141;atc;;76;6;ttc;;76;60;tgg;;;;;;;;;;;;;;;;;dir     ;46;23s;;;;;;;;;;;16s-cds-16s°-23s-cds-5s le 1er cds ci-dessous;;;;;;;comp;86;331;16s°;;;;;;;;
;;;;;:9;16s;;;;comp;75;6;gaa;;dir    ;77;642;cgt;;;;;;;;;4;;ttc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;;cac;40;;atgi;;;;;comp;29;aac;;;;dir     ;193;5s;;;;;;;;;;comp;10;aaa;;;;5;gta;460;16s;18;aaa;100;23s;;77;11;atgj;;77;6;cca;;;;;long;interc;;;;dir    ;774;179;cds;SigB/SigF/SigG family RNA polymerase sigma factor;*;;dir     ;6;5s;;;;;;;;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;comp;1790;-1696;16s;;;;;;;;
;;;;;;;;;;comp;76;68;atgf;;comp;261;:14;cds;hp;;;;;;;;167;;tgc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8;;aaa;6;;tgg;;;;;comp;234;5s;;;;dir     ;3;aac;;;;;;;;;;comp;18;gcc;;;;7;gac;5;tgg;4;caa;6;aac;;77;23;atgi;;77;3;atc;;;;dir   ;645;214;cds;tyrosine-type recombinase/integrase;*;dir    ;1438;161;16s;;;;dir     ;5;aag;;;;;;;;;;;;long;interc;;;;;comp;447;1614;23s°;;;;;;;;
;;;;;;;;;;comp;117;126;5s;;;;;;;;;;;;;;:4;99;cds;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;16;;tgc;47;;cca;;;;;comp;54;23s;;;;dir     ;4;tta;;;;;;;;;;comp;54;gta;;;;43;agc;207;cgg;91;tac;102;atgf;;77;7;cca;;76;7;ttc;;;;dir   ;459;554;cds;helix-turn-helix domain-containing protein;*;comp;117;201;5s;;;;dir     ;25;gag;;;;;;;;;;;dir   ;1242;56;cds;hp;;;comp;264;:2;cds;DUF1657 domain-containing protein;*;;;;;;
;;;;;;;;;;comp;2938;248;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;22;;cta;6;;atgi;;;;;comp;253;cds;hp;;;dir     ;129;atgf;;;;;;;;;;comp;39;gaa;;;;30;ccc;:3;cds;7;gtc;:4;cds;;77;8;cac;;77;114;atg;:18;;;dir   ;1740;0;cds;hypothetical protein;;comp;2893;217;23s;;;;dir     ;5;atgj;;;;;;;;;;;comp;117;126;5s;;;;;;;;;;;;;;;
;;;;;;;;;;comp;1538;589;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;88;;cgt;34;;ttc;;;;;comp;841;16s;;;;dir     ;7;gaa;;;;;;;;;;comp;133;cac;;;;3;ctg;;;325;tgc;;;;76;7;aaa;;1391;68;16s;;;;dir   ;204;168;cds;hp;;comp;1508;108;16s;;;;dir     ;5;ttc;;;;;;;;;;;dir   ;210;29;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;dir     ;819;:22;cds;2pK;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:22;279;cds;:23;;atgj;;;;;comp;54;tcc;;;;dir     ;41;gta;;;;;;;;;;comp;9;aga;;;;4;ggc;464;cds ;:17;cds;704;cds;;74;6;tgc;;76;271;gca;;;;dir   ;827;133;23s°;;;comp;77;11;atgi;;;;dir     ;6;tac;;;;;;;;;;;comp;3168;-381;23s;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;Comp;:20;cds;nucleoside deaminase;*;;dir     ;5;gac;;;;;;;;;;comp;7;gga;;;;4;cgt;327;16s;;;252;16s;;75;5;aac;;2900;126;23s;;;;dir   ;117;7;5s;;;comp;89;5;tta;;;;dir     ;7;ggc;;;;;;;;;;;comp;102;761;16s°;;;;;;;;;;;;;;;
;;;;;;;;;;;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;23;aca;;;;;;;;;;comp;13;cta;;;;352;acc;226;5s;;;64;5s;;86;15;tta;;117;213;5s;;;;dir   ;75;5;aac;;;comp;117;201;5s;;;;dir     ;31;gcc;;;;;;;;;;;comp;222;12;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;dir     ;819;135;cds;2pK;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;16s-cds-235  cds ci-dessous;;;;;;dir     ;35;tac;;;;;;;;;;comp;13;ttc;;;;:20;cds ;98;23s;;;194;atc;;76;7;atgf;;1185;372;cds;pyridoxal phosphate-dependent aminotransferase;*;;dir   ;75;6;gaa;;;comp;2900;375;23s;;;;dir     ;19;gtc;;;;;;;;;;;comp;1541;185;16s;;;;;;;;;;;;;;;
;;;;;;;;;;comp;74;36;gga;;;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT;;;;*;;dir     ;5;gga;;;;;;;;;;comp;4;atgf;;;;;;4;aaa;;;112;23s;;75;9;gaa;;2352;21;cds;anaerobic ribonucleoside triphosphate reductase;*;;dir   ;76;6;gta;;;comp;76;52;gca;;;;dir     ;5;gac;;;;;;;;;;;dir   ;447;:0;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;83;atgj;;comp;1422;126;cds;Aspam;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;7;aga;;;;;;;;;;comp;6;aaa;;;;;;8;acc;;;109;aac;;74;5;gga;;540;776;cds;anaerobic ribonucleoside-triphosphate reductase  activating protein;*;;dir   ;77;12;gac;;;comp;1264;100;16s’;;;;dir     ;49;ctg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;77;atgf;;comp;76;9;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;tcg-16s23s-gca-5s-12aas;;;;;;dir     ;4;gaa;;;;;;;;;;comp;4;aca;;;;;;89;ctc;;;:2;cds;;76;5;gta;;1508;52;16s;;;;dir   ;75;15;aca;;;dir    ;1166;52;16s’;;;;dir     ;3;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;9;ttc;;comp;77;5;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;50S ribosomal protein L32 ci-dessous;;;;;;dir     ;5;aaa;;;;;;;;;;comp;5;gac;;;;;;:3;cds;;;;;;77;9;gac;;76;373;gca;;;;dir   ;85;10;tac;;;dir    ;76;248;gca;;;;dir     ;9;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;5;atc;;comp;76;4;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;MAVPKRKTAKSATRSRRSANMKMTAKTLVKCSNCGEFALPHHVCAECGHYKGREVIAK;;;;*;;dir     ;19;tca;;;;;;;;;;comp;55;gta;;;;;;;;;;;;;75;14;aca;;2900;126;23s;;;;dir   ;74;11;gga;;;dir    ;596;100;23s°;;;;Dir;:13;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;6;cca;;comp;75;27;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;118;cds;CDP-archaeol synthase;*;;dir     ;20;agc;;;;;;;;;;comp;22;gaa;;;;;;;;;;;;;85;9;tac;;117;7;5s;;;;dir   ;77;10;aga;;;dir    ;577;321;16s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;22;tgg;;comp;83;137;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;57;tgg;;;;dir     ;69;atgi;;;;;;;;;;comp;76;caa;;;;;;;;;;;;;84;23;cta;;75;5;aac;;;;dir   ;76;12;caa;;;dir    ;2228;100;23s;;;;comp;333;cds;MFS transporter;*;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;14;atgi;;comp;85;12;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;6;atc;;;;dir     ;0;ttc;;;;;;;;;;comp;90;5s;;;;;;;;;;;;;75;24;ggc;;86;15;tta;;;;dir   ;76;3;aaa;;;dir    ;568;320;16s°;;;;comp;80;ccg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;9;cca;;comp;76;13;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;13;cca;;;;dir     ;135;tgg;;;;;;;;;;comp;95;23s;;;;;;;;;;;;;77;9;aga;;76;7;atgf;;;;dir   ;89;19;tca;;;dir    ;1633;100;23s°;;;;comp;6;ccc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;92;14;agc;;comp;77;126;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;26;agc;;;;dir     ;86;cgg;;;;;;;;;;comp;404;16s;;;;;;;;;;;;;76;8;caa;;75;14;gaa;;;;dir   ;91;9;agc;;;dir    ;2449;126;23s’;;;;comp;4;gcc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;89;8;cta;;comp;76;12;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;16;aag;;;;comp;:19;cds;prepilin-type N-terminal cleavage/methylation domain-containing protein;*;;;;;;;;comp;:21;cds;tRNA 2-thiouridine(34) synthase MnmA;*;;;;;;;;;;;76;2;aaa;;74;5;gga;;;;dir   ;77;86;cca;;;dir    ;117;127;5s;;;;comp;8;cac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;4;aaa;;comp;75;6;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;18;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;89;3;tca;;76;5;gta;;;;dir   ;76;61;tgg;;;dir    ;510;;cds;transcription repressor NadR;*;;comp;7;tgg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;27;ggc;;comp;76;15;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;63;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;6;ttc;;77;10;gac;;;;dir   ;77;6;cca;;;;;;;;;;comp;5;cgg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;83;84;cta;;comp;89;5;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;10;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;11;atgj;;75;9;ggc;;;;dir   ;77;4;atc;;;comp;660;228;cds;type A-1 chloramphenicol O-acetyltransferase;*;;comp;34;cgt;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;85;12;tac;;comp;75;8;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;28;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;17;atgi;;74;975;aga;;;;dir   ;76;8;ttc;;;dir    ;1351;321;16s;;;;comp;5;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;13;aca;;comp;117;126;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;8;cac;;840;:10;cds;TIGR00159 family protein;;;dir   ;77;115;atgj;:18;;dir    ;488;101;23s°;;;;comp;4;ctg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;125;gac;;comp;2938;349;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;35;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;7;aaa;;;;;;;;dir   ;1198;1;16s;;;comp;1420;250;23s°;;;;comp;47;ctc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;12;gta;;comp;1538;:13;16s;suite1;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;74;7;tgc;;;;;;;;dir   ;687;100;cds;xylose isomerase;;comp;76;52;gca;;;;comp;5;gag;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;6;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;172;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;12;cgt;;;;;;;;dir   ;796;182;23s°;;;comp;564;100;16s°;;;;comp;112;cag;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;14;atgf;;comp;1538;378;16s;suite2;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;62;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;75;gta;;;;;;;;dir   ;117;7;5s;;;comp;285;217;23s°;;;;comp;44;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;89;5;tta;;comp;76;9;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;606;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;414;:43;cds;hp;;;;;;;dir   ;75;7;aac;;;comp;1508;179;16s;;;;comp;281;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;8;aac;;comp;77;4;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;495;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;86;16;tta;;;>comp;446;386;cds;B/F/G family RNA polymerase sigma-70 factor;*;;comp;914;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;117;179;5s;;comp;76;4;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;200;tcg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;atgf;;;dir    ;1508;321;16s;;;;comp;:12;cds;ABC transporter permease;*;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;2938;166;23s;;comp;76;6;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;Comp;:14;cds;50S ribosomal protein L32;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;10;gaa;;;dir    ;2900;181;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;61;gca;;comp;77;8;aga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;6;gga;;;dir    ;117;6;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;1538;:23;16s;suite2;comp;74;8;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;6;gta;;;dir    ;75;6;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;76;133;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;gac;;;dir    ;86;15;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;76;12;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;15;aca;;;dir    ;76;7;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;75;4;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;85;11;tac;;;dir    ;75;9;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;117;161;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;84;29;cta;;;dir    ;74;5;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;2938;381;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;8;aga;;;dir    ;76;5;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;1538;472;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;90;caa;;;dir    ;77;9;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;387;:9;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;89;4;tca;;;dir    ;75;14;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;7;ttc;;;dir    ;85;10;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;12;atgj;;;dir    ;84;28;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;30;atgi;;;dir    ;77;7;aga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;8;cca;;;dir    ;76;89;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;9;aca;;;dir    ;89;3;tca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;aaa;;;dir    ;76;6;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;7;tgc;;;dir    ;77;11;atgj;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;7;aac;;;dir    ;77;29;atgi;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;86;16;tta;;;dir    ;77;7;cca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;atgf;;;dir    ;77;8;cac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;10;gaa;;;dir    ;76;353;aaa;:19;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;6;gga;;;comp;117;126;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;6;gta;;;comp;2036;582;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;gac;;;dir    ;1506;217;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;15;aca;;;dir    ;2900;126;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;85;10;tac;;;dir    ;117;216;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;84;25;cta;;;comp;1185;372;cds;pyridoxal phosphate-dependent aminotransferase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;25;ggc;;;dir    ;2352;21;cds;anaerobic ribonucleoside triphosphate reductase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;aga;;;dir    ;540;778;cds;anaerobic ribonucleoside-triphosphate reductase activating protein;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;9;caa;;;dir    ;1537;261;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;3;aaa;;;dir    ;2899;201;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;89;4;tca;;;dir    ;117;5;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;7;ttc;;;dir    ;89;11;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;12;atgj;;;dir    ;77;108;atgi;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;18;atgi;;;dir    ;1508;184;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;9;cac;;;dir    ;645;100;23s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;aaa;;;<dir    ;259;112;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;8;tgc;;;comp;2110;375;23s’;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;13;cgt;;;comp;76;52;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;76;gta;:43;;comp;578;282;16s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;414;308;cds;hp;;dir    ;204;12;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;3432;;cds;pyruvate carboxylase;;dir    ;1278;;cds;phage portal protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;

génomes negativicutes[modifier | modifier le wikicode]

77;Lactobacillus salivarius UCC118 ;;;;;;;;99;Pelosinus sp. UFO1 ;;73;Selenomonas ruminantium subsp. lactilytica TAM6421 ;;;;55;Selenomonas sputigena ATCC 35185 ;
en004;777;Chromosome;;;;;;;en010;16,15,14;Chromosome;;en011;777;Chromosome;;en012;444;Chromosome
16s23s5s;;;;;;;;;6*16s23s5s;;;;4*16s23s5s;;;;16s23s5s;;
16atcgca235-9aas;;;;;;;;;3*16atcgca235;;;;16-gcaatc-235-cac-tgg-agc;;;;16-gca-atc-235;;
2*16atcgca235-12aas;;;;;;;;;16-gca-235;;;;16-gcaatc-2355-13 aas;;;;16s23s5s-cac-tgg;;
16235-19aas;;;;;;;;;16s23s5s-5s;;;;16s23s;;;;16s23s5s-12aas;;
16s23s5s-cds-tac-caa;;;;;;;;;16-gca-235-aac;;;;interc;;;;interc;;
16235-aac-gaa-acg;;;;;;;;;16atcgca235-aac;;;;133;cds ;comp ;;320;cds;comp
;;;;;;;;;16s23s5s-acc;;;;87;16s;;;27;ctc;comp
interc;;interc;;interc;;interc;;;16s-23s°;;;;4;gca;;;31;ctg;comp
331;cds;356;cds;3;caa;15;acg;;gga-5s-5aas-ncRNA-9aas;;;;168;atc;;;10;tta;comp
103;16s;13;16s;151;tac;4;gaa;;;interc;;;70;23s;;;12;gga;comp
31;atc;244;23s;248;cds;5;aac;;;212;gga;;4;5s;;;8;aca;comp
126;gca;5;5s;35;5s;240;5s;;;8;5s;;26;5s;;;5;ttc;comp
244;23s;3;gta;13;23s;13;23s;;;5;aac;;24;aac;;;4;gac;comp
5;5s;65;aaa;:2;16s;:3;16s;;;53;atg;;6;caa;;;61;gta;comp
14;aac;4;aca;;;;;;;14;cac;;8;aaa;;;41;aag;comp
14;tcc;12;ggc;527;cds;30;ttg;;;4;caa;;7;gaa;;;4;aaa;comp
2;gaa;8;tta;103;16s;24;tgc;;;44;agc;;6;aag;;;18;caa;comp
9;gta;6;cgt;31;atc;10;caa;;;25;ncRNA;;6;gta;;;4;aac;comp
25;gac;24;cca;126;gca;6;cac;;;6;cgt;;39;gac;;;174;5s;comp
4;ttc;16;atg;244;23s;12;tgg;;;1;ttc;;10;ttc;;;406;23s;comp
12;tac;40;atg;5;5s;4;tac;;;9;aca;;14;aca;;;159;16s;comp
6;tgg;10;tca;3;gta;25;ttc;;;11;tac;;18;gga;;;293;cds;dir
11;cac;4;atg;15;aaa;9;gac;;;2;aaa;;23;tta;;;24;cgt;comp
9;caa;9;gac;8;cta;2;gta;;;6;gaa;;55;ctg;;;74;atg;comp
30;tgc;19;ttc;4;aca;14;gaa;;;20;gta;;102;ctc;;;5;ggc;comp
149;ttg;8;gga;9;ggc;14;tcc;;;3;gac;;:15;cds;;;105;ggc;comp
:14;cds;3;atc;8;tta;5;aac;;;:15;ggc;;;;;;:15;cds;comp
;;4;agc;47;cgt;244;5s;;;;;;;;;;;;
;;22;gaa;4;cgt;126;23s;;;;;;;;;;;;
;;4;atg;403;cca;31;gca;;;;;;;;;;;;
;;201;gac;:11;cds;103;atc;;;;;;;;;;;;
;;:19;cds;;;:14;16s;;;;;;;;;;;;