Recherche:Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Ftableur

Une page de Wikiversité.
Sauter à la navigation Sauter à la recherche
Fiche mémoire sur Ftableur
Icon falscher Titel.svg
En raison de limitations techniques, la typographie souhaitable du titre, « Fiche : Ftableur
Les clusters de gènes tRNA et rRNA chez les procaryotes/Fiche/Ftableur
 », n'a pu être restituée correctement ci-dessus.


  • fiche en préparation

Tanger le 2.11.19

Firmicutes[modifier | modifier le wikicode]

bacilli[modifier | modifier le wikicode]

bacilli blocs[modifier | modifier le wikicode]

lien;blocs;16s;total aas;avec;sans;total page;Bc001-25;;;;;Notes
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
bc001;16s23s5s;4;60;40;20;;'’’sans;19;4;;;'''avant
;16atcgca235-aac-acc;;;;;;'’’1-3;3;2;;3;3*cgt gga 16s23s5s atgf gac
;16atcgca235-22aas;;;;;;'’’4-8;3;;;;
;16s23s5s-12aas;;;;;;'’’9-23;13;2;;;'''1-3
;;;;;;;'’’24-43;;;;;2*16atcgca235-aac-acc
bc002;16s23s5s-tca;6;65;1;64;49;'’’total;38;8;0;3;2*16s23s5s-atgf-gac
;5*16s23s5s;;;;;;;;;;;16s23s5s-tca
;;;;;;;;;;;;
bc004;2*16s23s5s;6;56;28;28;;;;;;;'''autres incomplets
;16atcgca235-aac-acc;;;;;;;;;;;16s°atcgca235
;16s23s5s-atgf-gac;;;;;;;;;;;16s°23s5s-16 aas 
;2*16s23s5s-13,9 aas;;;;;;;;;;;16s°atcgca235
;;;;;;;;;;;;
bc008;2*16atcgca235;10;95;68;27;;;;;;;
;2*16s23s5s;;;;;;;;;;;
;5*16s23s5s-21,16,9,9,5 aas;;;;;;;;;;;
;cgt gga 16s23s5s atgf gac;;;;;;;;;;;
;;;;;;;;;;;;
bc014;4*16s23s5s;8;89;59;30;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-9,7 aas ;;;;;;;;;;;
;16atcgca235-21 aas;;;;;;;;;;;
;16s°atcgca235;;;;;;;;;;;
;16s°23s5s-16 aas ;;;;;;;;;;;
;;;;;;;;;;;;
bc015;3*16s23s5s;9;89;52;37;;;;;;;
;16atcgca235;;;;;;;;;;;
;4*16s23s5s-21,16,9,7 aas  ;;;;;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;16s°atcgca235;;;;;;;;;;;
;;;;;;;;;;;;
bc025;2*16s23s5s;6;70;41;29;;;;;;;
;16atcgca235;;;;;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-21,16 aas;49;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc029-74;;;;;Notes
bc029;4*16s23s5s;11;112;98;14;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;2*16atcgca235;;;;;;'’’sans;33;6;;1;'''avant
;4*16s23s5s-20,19,11,9 aas;;;;;;'’’1-3;5;;;3;3*33,12,11aas-16s23s5s-atgf-gac
;33aas-16s23s5s-atgf-gac;;;;;;'’’4-8;1;;;;13aas-16s23s5s
;;;;;;;'’’9-23;22;2;;;
bc034;5*16s23s5s;10;94;81;13;;'’’24-43;;;;;'''1-3
;16atcgca235-15aas;;;;;73;'’’total;61;8;0;4;3*16s23s5s-atgf-gac
;3*16s23s5s-22,20,9aas;;;;;;;;;;;2*16s23s5s-aac-acc
;11aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc063;16s23s5s;7;75;45;30;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;2*16s23s5s-21,16 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc065;3*16s23s5s;8;80;50;30;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;3*16s23s5s-21,16,9 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc066;8*16s23s5s;13;95;68;27;;;;;;;
;4*16s23s5s-22,19,15,8 aas;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc067;7*16s23s5s;10;83;43;40;;;;;;;
;16atcgca235-9aas;;;;;;;;;;;
;2*16s23s5s-16,16aas;;;;;;;;;;;
;;;;;;;;;;;;
bc074;5*16s23s5s;14;118;94;24;;;;;;;
;16s23s5s-atgf-gac;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9 aas;;;;;;;;;;;
;13aas-16s23s5s;73;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc090-244;;;;;Notes
bc090;7*16s23s5s;13;95;83;12;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;16atcgca235;;;;;;'’’sans;35;13;;;'''avant
;4*16s23s5s-22,20,15,9 aas;;;;;;'’’1-3;1;;;6;5*(3*12),11,10aas-16s23s5s-atgf-gac
;11aas-16s23s5s-atgf-gac;;;;;;'’’4-8;3;1;;;cgt-gga-16s23s5s-atgf-gac
;;;;;;;'’’9-23;26;;;;
bc097;5*16s23s5s;13;107;93;14;;'’’24-43;;;;;'''1-3
;2*16atcgca235;;;;;85;'’’total;65;14;0;6;16s23s5s-gaa
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;
;;;;;;;;;;;;
bc125;16s23s5s;12;123;107;16;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;suite3-16s23s5s;;;;;;;;;;;
;10aas-16s23s5s-atgf-gac;;;;;;;;;;;
;7*16s23s5s-21,16,14,12,10,9,9;;;;;;;;;;;
;;;;;;;;;;;;
bc147;3*16s23s5s   encadrés;9;86;60;26;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;;;
;3*16s23s5s-21, 16, 9, 6aas;;;;;;;;;;;
;;;;;;;;;;;;
bc158;5*16s23s5s;14;142;93;49;;;;;;;
;2*16atcgca235;;;;;;;;;;;
;suite2-16s23s5s;;;;;;;;;;;
;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc165;10*16s23s5s;15;78;59;19;;;;;;;
;16s23s5s-gaa;;;;;;;;;;;
;3*16s23s5s-20,15,9;;;;;;;;;;;
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;
;;;;;;;;;;;;
bc244;4*16atcgca235;9;98;26;72;;;;;;;
;16atcgca235-5aas;;;;;;;;;;;
;2*16s23s5s dont un encadré ici;;;;;;;;;;;
;2*16s23s5s-6, 5aas;85;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc328-656;;;;;Notes
bc328;2*16s23s5s dont un encadré ici;;67;50;17;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;2*16s23s5s-21,9;6;;;;;'’’sans;18;2;1;2;'''avant
;16atcgca235-14aas;;;;;;'’’1-3;1;1;4;1;5s-8aas-16s-atc-235
;16atcgca235-aac-acc;;;;;;'’’4-8;1;1;2;;ctc-gga-16s23s5s
;;;;;;;'’’9-23;15;2;6;;11aas-16s23s5s-atgf-gac
bc384;5*16s23s5s;14;175;138;37;;'’’24-43;;1;;;
;9*16s23s5s-23  22  19  17  ;;;;;58;'’’total;35;7;13;3;'''1-3
;16  12  11  9  9 aas;;;;;;;;;;;16atcgca235-aac-acc
;;;;;;;;;;;;16s23s5s-aac-acc
bc393;7*16s23s5s;13;165;73;92;;;;;;;2*16-gca-235-aac
;16s-gca-235;;;;;;;;;;;2*16-gca-235-aac-cgt
;16s-5s-atcgca-23s-8aas;;;;;;;;;;;
;16s-5s-atcgca-23s-5s-11aas;;;;;;;;;;;'''autres
;3*16s23s5s-11, 17, 21 aas;;;;;;;;;;;16s-gca-235
;;;;;;;;;;;;16s-5s-atcgca-23s-8aas
bc413;16atcgca235;5;63;47;16;;;;;;;16s-5s-atcgca-23s-5s-11aas
;16atcgca-235-26aas;;;;;;;;;;;
;16s23s5s-6aas;;;;;;;;;;;2*16-gca-235-aac
;5s-8aas-16s-atc-235;;;;;;;;;;;5*16-gca-235-17,15,12,9,4 aas
;ctc-gga-16s23s5s;;;;;;;;;;;2*16-gca-235-aac-cgt
;23s°5s;;;;;;;;;;;3*16s-gca-235-17, 12, 7 aas
;;;;;;;;;;;;
bc499;2*16-gca-235-aac;7;80;66;14;;;;;;;'''5s en trop
;5*16-gca-235-17,15,12,9,4 aas;;;;;;;;;;;16s-5s-atcgca-23s-5s-11aas
;;;;;;;;;;;;23s°5s
bc655;2*16-gca-235-aac-cgt;5;59;45;14;;;;;;;5s-8aas-16s-atc-235
;3*16s-gca-235-17, 12, 7 aas;;;;;;;;;;;
;;;;;;;;;;;;
bc656;4*16s23s5s;8;56;30;26;;;;;;;
;16s23s5s-aac-acc;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;
;11aas-16s23s5s-atgf-gac;;;;;;;;;;;
;16s23s5s-13aas;58;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Bc657-660;;;;;Notes
bc657;16s23s5s;5;62;36;26;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;16s23s5s-aac;;;;;;'’’sans;7;1;;;'''avant
;2*16s-gca-235-25, 8aas ;;;;;;'’’1-3;2;1;;2;12aas-16s23s5s-atgf-gac
;16s23s5s-12aas;;;;;;'’’4-8;1;2;1;;gga-16atcgca235-gta
;;;;;;;'’’9-23;3;2;;;
bc658;16s-5s-23s;5;61;58;3;;'’’24-43;;;1;;'''1-3
;16s-5s-23s-atgf-ctc-ctg;;;;;23;'’’total;13;6;2;2;16s23s5s-aac
;2*16s-5s-atcgca-23s-9,5aas;;;;;;;;;;;16s-5s-23s-atgf-ctc-ctg
;16s-5s-23s-14aas;;;;;;;;;;;16atcgca235-aac-acc
;;;;;;;;;;;;
bc659;4*16s23s5s;7;54;32;22;;;;;;;'''autres
;16atcgca235-aac-acc;;;;;;;;;;;16s-5s-23s-14aas
;12aas-16s23s5s-atgf-gac;;;;;;;;;;;2*16s-5s-atcgca-23s-9,5aas
;16s23s5s-14aas;;;;;;;;;;;2*16s-gca-235-25, 8aas 
;;;;;;;;;;;;
bc660;16atcgca235;6;75;38;37;;;;;;;'''5s en trop
;16s23s5s;;;;;;;;;;;16atcgca235-4aas-5s-aac
;16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca;;;;;;;;;;;
;2*16atcgca235-17aas, 4aas-5s-aac;;;;;;;;;;;
;gga-16atcgca235-gta;;;;;;;;;;;
;;23;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
;;;;;;;;;;;;
lien;blocs;aas;total aas;avec;sans;total pages;Total;;;;;
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’autres;'’’avant 16s;
;;;;;;;'’’sans;112;26;1;3;
;;;;;;;'’’1-3;12;4;4;15;
;'’’Moyenne;;88;59;29;;'’’4-8;9;4;3;0;
;'’’ecartype;;30;28;19;;'’’9-23;79;8;6;0;
;'’’max;;175;138;92;;'’’24-43;0;1;1;0;
;'’’min;;54;1;3;288;'’’total;212;43;15;18;

bacilli notes[modifier | modifier le wikicode]

avant::1-3
33,5*12,3*11,10aas-16s23s5s-atgf-gac::4*16atcgca235-aac-acc
4*cgt-gga-16s23s5s-atgf-gac::2*16-gca-235-aac
13aas-16s23s5s::2*16-gca-235-aac-cgt
5s-8aas-16s-atc-235::
ctc-gga-16s23s5s::5*16s23s5s-atgf-gac
::3*16s23s5s-aac-acc
gga-16atcgca235-gta::16s23s5s-gaa
::16s23s5s-tca
autres::16s23s5s-aac
16s-gca-235::16s-5s-23s-atgf-ctc-ctg
2*16-gca-235-aac::
2*16-gca-235-aac-cgt::autres incomplets
9*16-gca-235-2*17,15,2*12,9,8,7,4 aas::16s°atcgca235
16s-gca-235-25aas::16s°23s5s-16 aas 
3*16s-5s-atcgca-23s-9,8,5aas::16s°atcgca235
16s-5s-atcgca-23s-5s-11aas::
16s-5s-23s-14aas::5s en trop
::16atcgca235-4aas-5s-aac
zéro cds::16s-5s-atcgca-23s-5s-11aas
::5s-8aas-16s-atc-235
incomplets::23s°5s

Bacilli typage[modifier | modifier le wikicode]

bacilli blocs intégrés[modifier | modifier le wikicode]
avant inversé;Total intégré;;;;;;
16s23s5s;;16s23s5s;atcgca;gca;autres;atc;total
0;sans;112;26;1;*0;;139
1;1-3;13;5;4;*0;;22
4;4-8;13;4;3;*2;1;21
10;9-23;89;8;6;*3;;103
1;24-43;1;1;1;*0;;3
16;total;228;44;15;*5;1;288
0;Dont 16s5s-*-23s;1;4;0;*5;;5
bacilli blocs 1-3[modifier | modifier le wikicode]
bacilli;;;
1-3 après/ap;Total;‰;
aac;12;333;
acc;7;194;
atgf;6;167;
gac;5;139;833
cgt;2;56;
ctc;1;28;
ctg;1;;
gaa;1;;
tca;1;;
;36;;
aac-acc;7;;
atgf-gac;5;;
;;;
1-3 avant/ap;;;avant inversé
atgf;14;;ctc-gga
gac;14;;gta-gga
gta;1;;
atgf-gac;14;;
bacilli blocs 4-8[modifier | modifier le wikicode]
bc499;bc008;bc244;bc244;bc658;bc660;bc147;bc244;bc413;bc014;bc015;bc655;bc066;bc393;bc657
4;5;5;5;5;5;6;6;6;7;7;7;8;8;8
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
gca;23s;atc;23s;5s;other;23s;23s;23s;23s;23s;gca;23s;5s;gca
23s;5s;gca;5s;atc;gca;5s;5s;5s;5s;5s;23s;5s;atc;23s
5s;;23s;;gca;23s;;;;;;5s;;gca;5s
;;5s;;23s;5s;;;;;;;;23s;
gta;aac;aac;ggc;atgj;aac;aac;aac;aac;aac;aac;gta;aac;agc;gta
gga;acc;tcc;cgt;gta;acg;acc;cca;gaa;acc;acc;gac;acc;atgj;aaa
atc;ggc;atgj;gta;gac;gta;ggc;ggc;gta;ggc;ggc;aaa;gaa;gta;cta
gaa;cgt;gaa;gaa;ttc;aca;cgt;cgt;tac;cgt;cgt;cta;gta;aca;aca
;cca;gta;gac;tac;5s;cca;gta;caa;cca;cca;aca;tac;gac;ggc
;;;;;aac;gca;gac;aaa;gca;gca;atc;caa;ttc;tta
;;;;;;16s;;;atgj;atgj;gaa;aaa;tac;cgt
;;;;;;23s;;;;;;gca;aaa;cca
;;;;;;5s;;;;;;;;
bacilli blocs 9-23[modifier | modifier le wikicode]
bc004;bc008;bc008;bc014;bc015;bc029;bc034;bc065;bc067;bc074;bc074;bc090;bc097;bc097;bc125;bc125;bc147;bc158;bc158;bc165;bc328;bc384;bc384;bc499;bc658;bc125;bc029;bc384;bc393;bc393;bc001;bc125;bc384;bc499;bc655;bc657;bc004;bc656;bc125;bc328;bc658;bc659;bc034;bc066;bc074;bc090;bc097;bc158;bc165;bc499;bc008;bc014;bc015;bc025;bc063;bc065;bc067;bc067;bc125;bc147;bc384;bc384;bc393;bc499;bc655;bc660;bc029;bc066;bc384;bc029;bc034;bc074;bc090;bc097;bc158;bc165;bc008;bc014;bc015;bc025;bc063;bc065;bc125;bc147;bc328;bc393;bc001;bc034;bc066;bc074;bc090;bc097;bc158;bc384;bc384;bc657;bc413
9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;9;10;11;11;11;11;12;12;12;12;12;12;13;13;14;14;14;14;15;15;15;15;15;15;15;15;16;16;16;16;16;16;16;16;16;16;16;17;17;17;17;17;19;19;19;20;20;20;20;20;20;20;21;21;21;21;21;21;21;21;21;21;22;22;22;22;22;22;22;22;23;25;26
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s°;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;gca;5s;23s;23s;23s;23s;5s;23s;23s;23s;gca;gca;23s;23s;23s;23s;atc;5s;23s;atc;23s;23s;23s;23s;23s;23s;gca;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;gca;gca;atc;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;atc;23s;23s;23s;23s;23s;23s;23s;23s;gca;atc
5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;23s;atc;5s;5s;5s;5s;atc;5s;5s;5s;23s;23s;5s;5s;5s;5s;gca;23s;5s;gca;5s;5s;5s;5s;5s;5s;23s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;23s;23s;gca;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;gca;5s;5s;5s;5s;5s;5s;5s;5s;23s;gca
;;;;;;;;23s;;;;;;;;;;;;;;;5s;gca;;;;;gca;;;;5s;5s;;;;;23s;;;23s;;;;;;;5s;;;;;;;;;;;;;;5s;5s;23s;;;;;;;;;;;;23s;;;;;;;;;23s;;;;;;;;;5s;23s
;;;;;;;;5s;;;;;;;;;;;;;;;;23s;;;;;23s;;;;;;;;;;5s;;;5s;;;;;;;;;;;;;;;;;;;;;;;5s;;;;;;;;;;;;5s;;;;;;;;;5s;;;;;;;;;;5s
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
gta;gta;gta;gta;gta;aac;aac;gta;gta;aac;gta;aac;aac;gta;gta;gta;gta;aac;gta;aac;gta;ttc;agc;gta;aac;aac;aac;atc;aac;aac;aac;aca;atc;gta;gta;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;gta;aac;aac;aac;aac;aac;acc;aac;gca;gaa;aac;aac;aac;gca;gta;gta;gta;gta;gta;atc;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;atc;gta;gta;gta;gta;gta;gta;gta;atc;atc;gta;gta
aca;aca;aca;aca;aca;acc;acc;aca;aca;acc;aca;acc;acc;aca;aca;aca;aca;acc;aca;acc;aca;tac;atgj;gac;acc;acc;acc;gaa;tcc;acc;tcc;cta;gaa;gga;gga;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;tcc;gac;tcc;tcc;tcc;tcc;tcc;tcc;tcc;atgj;gta;tcc;tcc;tcc;aac;gac;gac;aaa;aca;aca;gca;aca;tac;tac;tac;tac;tac;tac;aca;aca;aca;aca;aca;aca;aca;aca;aca;gca;aaa;aca;aca;aca;aca;aca;aca;gca;gcc;aaa;aca
aaa;aaa;aaa;aaa;aaa;gaa;gaa;aaa;aaa;gaa;aaa;gaa;gaa;aaa;aaa;aaa;aaa;gaa;aaa;gaa;aaa;aaa;gta;aaa;gaa;gaa;gaa;gtc;gaa;gaa;gaa;ggc;gtc;atc;atc;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;aaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;tca;aca;gaa;gaa;gaa;tcc;aaa;aaa;aca;cac;cac;gaa;cac;caa;caa;caa;caa;caa;caa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aaa;aac;cta;cac;cac;cac;cac;cac;cac;gaa;gaa;cta;aaa
cta;cta;cta;cta;cta;gta;gta;cta;cta;gta;cta;gta;gta;cta;cta;cta;cta;gta;cta;gta;cta;ctc;atgf;cta;caa;gta;gta;atgf;gta;gta;gta;tta;atgf;gaa;caa;gta;atgf;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;gta;cta;gta;gta;gta;gta;gta;gta;gta;gac;aaa;gta;gta;gta;gaa;cta;cta;tta;cta;cta;gta;cta;aaa;aaa;aaa;aaa;aaa;aaa;ctg;ctg;ctg;ctg;cta;cta;cta;ctg;cta;atgj;aca;cta;cta;cta;cta;cta;cta;tac;aca;aca;cta
ggc;ggc;ggc;ggc;ggc;tac;tac;ggc;ggc;tac;ggc;tac;tac;ggc;ggc;ggc;ggc;tac;ggc;tac;ggc;ctg;gac;aca;aaa;aca;tac;tgg;atgf;caa;gac;cca;tgg;tca;tca;gac;gac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;aca;atgf;atgf;atgf;atgf;atgf;atgf;atgf;tac;ggc;atgf;atgf;atgf;gta;aca;aca;cgt;ggc;ggc;aca;ggc;cta;cta;cta;cta;cta;cta;ggc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;agc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;aac;tac;ggc;ggc
tta;tta;tta;tta;tta;caa;caa;tta;tta;caa;tta;caa;caa;tta;tta;tta;tta;caa;tta;caa;tta;ggc;ttc;ggc;cta;tac;tgg;caa;gac;aaa;ttc;gca;caa;atgf;atgf;ttc;ttc;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;atc;gac;gac;gac;gac;gac;gac;gac;tgg;cgt;gac;gac;gac;atgf;ggc;ggc;cca;tta;tta;tac;tta;ggc;ggc;ggc;ggc;ggc;ggc;tta;tta;tta;tta;tta;tta;tta;tta;tta;gaa;tta;tta;tta;tta;tta;tta;tta;gta;aac;tta;tta
cgt;cgt;cgt;cgt;cgt;aaa;aaa;cgt;cgt;aaa;cgt;aaa;aaa;cgt;cgt;cgt;cgt;aaa;cgt;aaa;cgt;cgt;aca;tta;ggc;caa;cac;aaa;aaa;cta;tac;atgj;aaa;ttc;ttc;tac;tac;ttc;ttc;ttc;aca;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;gaa;ttc;ttc;ttc;ttc;ttc;ttc;ttc;cac;cca;ttc;acg;ttc;gac;tta;tta;atgj;cgt;cgt;aac;cgt;tta;tta;tta;tta;tta;tta;cgt;cgt;cgt;cgt;cgt;cgt;cgt;cgt;cgt;gta;cgt;cgt;cgt;cgt;cgt;cgt;cgt;gac;gta;cgt;cgt
cca;cca;cca;cca;cca;ggc;ggc;cca;cca;ggc;cca;ggc;ggc;cca;cca;cca;cca;ggc;cca;ggc;cca;cca;tac;cgt;cgt;aaa;caa;ctg;ggc;ggc;tgg;tca;cta;tac;tac;tgg;tgg;tac;tac;tac;tgg;tac;aca;aca;aca;aca;aca;aca;aca;tca;aca;aca;aca;aca;aca;aca;aca;caa;atgj;aca;cac;aca;aca;cgt;cgt;tca;cca;cca;gta;cca;cgt;cgt;cgt;cgt;cgt;cgt;cca;cca;cca;cca;cca;cca;cca;cca;cca;atgf;cca;cca;cca;cca;cca;cca;cca;ttc;gac;cca;cca
gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gca;ggg;aaa;cca;gga;ggc;ggc;ggc;cgt;cgt;cac;tac;ggc;tgg;tgg;cac;cac;tgg;tgg;tgg;cac;tgg;tac;tac;tac;tac;tac;tac;tac;atgf;tac;tac;tac;tac;tac;tac;tac;ggc;tca;tac;caa;tac;tac;cca;cca;atgf;gca;gca;atgf;gca;cca;cca;cca;cca;cca;cca;gca;gca;gca;gca;gca;gca;gca;gca;gca;gac;gca;gca;gca;gca;gca;gca;gca;aaa;cac;gca;gca
;;;;;;;;;;;;;;;;16s;;;;16s;;;;;gca;tgc;cgt;ttg;cca;caa;tgg;cgt;cac;cac;caa;caa;cac;cac;cac;caa;cac;tgg;tgg;tgg;tgg;tgg;tgg;tgg;ttc;tgg;tgg;tgg;tgg;tgg;tgg;tgg;cgt;gac;tgg;aaa;tgg;caa;atgj;atgj;gac;tca;tca;gac;tca;gca;gca;gca;gca;gca;gca;atgj;atgj;atgj;atgj;atgj;atgj;atgj;atgj;atgj;ttc;atgj;atgj;atgj;atgj;atgj;atgj;atgj;ctg;caa;atgj;atgj
;;;;;;;;;;;;;;;;23s;;;;23s;;;;;;ttg;cca;cca;gga;tgc;gga;cca;caa;caa;tgc;ggc;ggc;caa;caa;ggc;caa;cac;cac;cac;cac;cac;cac;cac;tac;cac;cac;cac;cac;cac;cac;cac;gga;tac;cac;ggc;cac;aaa;atgi;atgi;ttc;tca;tca;cac;cta;tca;tca;tca;tca;tca;tca;atgi;atgi;atgi;atgi;atgi;atgi;atgi;atgi;atgi;aca;atgi;atgi;atgi;atgi;atgi;atgi;atgi;ggc;aaa;atgi;atgi
;;;;;;;;;;;;;;;;5s;;;;5s;;;;;;;;;;ttg;atc;gga;ttg;ttg;ttg;tgc;tgc;ggc;ggc;tgc;ggc;caa;caa;caa;caa;caa;caa;caa;tgg;caa;caa;caa;caa;caa;caa;caa;atc;cac;caa;ggc;caa;cta;tca;tca;gga;atgf;atgf;caa;atgf;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tca;tac;tca;tca;tca;tca;tca;tca;tca;tgc;ctg;tca;tca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;tgc;tgc;cgt;tgc;ggc;ggc;ggc;ggc;ggc;ggc;ggc;cac;ggc;ggc;ggc;ggc;ggc;ggc;ggc;aac;caa;ggc;ttg;ggc;ggc;atgf;atgf;gga;gac;gac;aaa;gac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;atgf;cac;atgf;atgf;atgf;atgf;atgf;atgf;atgf;cgt;ggc;atgf;gac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;tgc;tgc;tgc;tgc;tgc;tgc;tgc;caa;tgc;tgc;tgc;tgc;tgc;tgc;tgc;agc;tgc;tgc;cca;tgc;cgt;ttc;ttc;gga;ttc;ttc;ctc;ttc;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;gac;caa;gac;gac;gac;gac;gac;gac;gac;cca;cgt;gac;tca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;ttg;ttg;ttg;ttg;tta;tta;tta;tta;tta;tta;tta;gaa;atc;tta;gga;tta;ttg;gga;gga;gga;aca;aca;ctg;aca;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;ttc;aaa;gga;ttc;ttc;ttc;ttc;ttc;ttc;gca;cca;gga;atgf
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;ttg;ttg;ttg;ttg;ttg;ttg;aaa;aac;ttg;aga;cgt;cca;atc;atc;atc;tgg;tgg;ggc;aaa;aca;aca;aca;aca;aca;aca;cac;cac;cac;cac;cac;cac;cac;cac;cac;ctg;atc;aca;aca;aca;aca;aca;aca;acc;ncRNA;atc;gac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg;gga;agc;agc;agc;atc;atc;tgc;gga;tgg;tgg;tgg;tgg;tgg;tgg;gga;gga;gga;gga;gga;gga;gga;gga;gga;ggc;agc;aaa;aaa;aaa;aaa;aaa;aaa;tcg;gca;gaa;ttc
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;aac;aac;cgt;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;atc;tgc;gaa;gga;gga;gga;gga;gga;gga;agc;acc;tca;aca
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;cca;aac;aac;aac;acc;caa;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;cgt;atgf;atc;atc;atc;atc;atc;atc;gtc;tcg;atgf;tac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;agc;gaa;gaa;gaa;gaa;gaa;gaa;agc;agc;agc;agc;agc;agc;agc;agc;agc;cca;gac;aac;aac;aac;aac;aac;aac;acg;agc;gac;tgg
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gga;ttc;agc;agc;agc;agc;agc;agc;tcc;atgj;ttc;cac
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gaa;gaa;gaa;gaa;gaa;gaa;ctc;atgf;gga;caa
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;tcc;atc;tgc
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ctc;agc;gga
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;gaa;gga
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;ttg
bacilli blocs avant[modifier | modifier le wikicode]
bc147;bc008;bc413;bc125;bc034;bc074;bc090;bc656;bc066;bc097;bc158;bc165;bc659;bc029
4;4;9;12;13;13;13;13;14;14;14;14;14;35
;;5s;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac;aac
;;gta;agc;agc;agc;agc;agc;agc;agc;agc;agc;agc;agc
;;aca;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa;gaa
;;aaa;;gta;gta;gta;;gta;gta;gta;gta;;gta
;;ggc;;gac;atgf;gac;gac;atgf;gac;atgf;atgf;gac;gac
;;tta;gac;caa;gac;caa;caa;gac;caa;gac;gac;caa;caa
;;cgt;caa;aaa;caa;aaa;aaa;caa;aaa;caa;caa;aaa;aaa
cgt;cgt;cca;cta;;aaa;;;aaa;cta;aaa;aaa;cta;cta
gga;gga;gca;ctc;ctc;cta;ctc;ctc;ctc;ctc;ctc;ctc;ctc;ggc
16s;16s;16s;cgt;cgt;ctc;cgt;cgt;cgt;cgt;cgt;cgt;cgt;tta
23s;23s;atc;cca;cca;cgt;cca;cca;cca;cca;cca;cca;cca;cgt
5s;5s;23s;gga;gga;cca;gga;gga;gga;gga;gga;gga;gga;cca
atgf;atgf;5s;;;gga;;atc;;;;;atc;gca
gac;gac;;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;tca
;;;23s;23s;23s;23s;23s;23s;23s;23s;23s;23s;tca
;;;5s;5s;5s;5s;5s;5s;5s;5s;5s;5s;atgf
;;;atgf;atgf;;atgf;atgf;atgf;atgf;atgf;atgf;atgf;gac
;;;gac;gac;;gac;gac;gac;gac;gac;gac;gac;ttc
;;;;;;;;;;;;;aca
;;;;;;;;;;;;;tgg
;;;;;;;;;;;;;atc
;;;;;;;;;;;;;aac
;;;;;;;;;;;;;gaa
;;;;;;;;;;;;;gta
;;;;;;;;;;;;;gac
;;;;;;;;;;;;;caa
;;;;;;;;;;;;;aaa
;;;;;;;;;;;;;cta
;;;;;;;;;;;;;ggc
;;;;;;;;;;;;;tta
;;;;;;;;;;;;;cgt
;;;;;;;;;;;;;cca
;;;;;;;;;;;;;gga
;;;;;;;;;;;;;16s
;;;;;;;;;;;;;23s
;;;;;;;;;;;;;5s
;;;;;;;;;;;;;atgf
;;;;;;;;;;;;;gac
bacilli total blocs longs[modifier | modifier le wikicode]
bacilli total blocs longs;;effectifs;;;;;;;bacilli total blocs longs;;Pour 1000;;;;;
tot;;1749;;atgf;;83;;;tot;;1000;;atgf;;47;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
atc;48;acc;20;aac;87;agc;38;;atc;27;acc;11;aac;50;agc;22
ctc;14;ccc;0;cac;53;cgt;82;;ctc;8;ccc;0;cac;30;cgt;47
gtc;3;gcc;1;gac;99;ggc;101;;gtc;2;gcc;1;gac;57;ggc;58
ttc;63;tcc;30;tac;56;tgc;30;;ttc;36;tcc;17;tac;32;tgc;17
atgi;20;aca;87;aaa;84;aga;1;;atgi;11;aca;50;aaa;48;aga;1
cta;54;cca;77;caa;69;cga;0;;cta;31;cca;44;caa;39;cga;0
gta;112;gca;63;gaa;93;gga;51;;gta;64;gca;36;gaa;53;gga;29
tta;59;tca;48;taa;0;tga;0;;tta;34;tca;27;taa;0;tga;0
atgj;32;acg;3;aag;0;agg;0;;atgj;18;acg;2;aag;0;agg;0
ctg;11;ccg;0;cag;0;cgg;0;;ctg;6;ccg;0;cag;0;cgg;0
gtg;0;gcg;0;gag;0;ggg;1;;gtg;0;gcg;0;gag;0;ggg;1
ttg;32;tcg;2;tag;0;tgg;42;;ttg;18;tcg;1;tag;0;tgg;24

clostridia[modifier | modifier le wikicode]

clostridia blocs[modifier | modifier le wikicode]

28.11.19 Tanger;;Ftableur;;;;;;;;;;;;;
clostridia;blocs;;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd001-32;;;;;;;;Notes 1
cd001;3*16s23s5s;5;62;21;41;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s-gcaatc-235-6aas;;;;;;'’’sans;15;1;2;2;2;;;'’’avant
;5aas-16s-gcaatc-235-6aas;;;;;;'’’1-3;7;;1;1;1;;;5aas-16s-gcaatc-235-6aas
;5s;;;;;;'’’4-8;1;1;1;;;;3;'’’agc-16s5s23s-6aas
;;;;;;;'’’9-23;5;;;2;;;;'’’tca-tcc-16s5s23s-5aas
cd002;16atcgca235;5;67;34;33;;'’’24-43;;;;;;;;
;16atcgca235-6aas;;;;;45;'’’total;28;2;4;5;3;0;3;'’’autres
;3*16s23s5s-12,9,4 aas;;;;;;;;;;;;;;'’’16s5s-atc-23s
;;;;;;;;;;;;;;;'’’16s5s-gca-23-aac-gaa-tgc
cd003;3*16s23s5s;10;110;83;27;;;;;;;;;;'’’16s5s23s-gac-aca
;16-gca-2355;;;;;;;;;;;;;;'’’16s5s23s
;16-atc-235;;;;;;;;;;;;;;
;3*16s23s5s-22,13,9aas;;;;;;;;;;;;;;'’’1-3
;2*16-gca-235-22,13aas;;;;;;;;;;;;;;16s-atc-23s-aac
;;;;;;;;;;;;;;;16s-gcaatc-23s5s-ttc-tgc
cd011;'’’16s5s23s;6;51;21;30;;;;;;;;;;'’’16s5s-gca-23-aac-gaa-tgc
;'’’16s5s23s-gac-aca;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;'’’16s5s-atc-23s;;;;;;;;;;;;;;'’’16s5s23s-gac-aca
;'’’agc-16s5s23s-6aas;;;;;;;;;;;;;;2*16s23s5s-atgi-gca
;'’’tca-tcc-16s5s23s-5aas;;;;;;;;;;;;;;16s23s5s-ttc-gac-gaa
;'’’16s5s-gca-23-aac-gaa-tgc;;;;;;;;;;;;;;2*16s23s-aac-5s
;;;;;;;;;;;;;;;
cd013;16s23s5s;3;52;4;48;;;;;;;;;;'’’différents
;2*16-gca-atc-235;;;;;;;;;;;;;;2*16s23s-aac-5s
;;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
cd032;'’’NCBI # gtRNAdb;;93;18;75;;;;;;;;;;
;7*16s23s5s;16;;;;;;;;;;;;;'’’cds
;2*16s23s5s-atgi-gca;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;16s23s5s-ttc-gac-gaa;;;;;;;;;;;;;;
;2*16s23s-aac-5s;;;;;;;;;;;;;;'’’5s en trop
;16s-atc-23s-aac;;;;;;;;;;;;;;16235-aaa-cds-5s-aaa
;16s-gca-23s5s;;;;;;;;;;;;;;16-gca-2355
;16235-aaa-cds-5s-aaa;;;;;;;;;;;;;;5s-ttc
;16s-gcaatc-23s5s-ttc-tgc;;;;;;;;;;;;;;5s
;5s-ttc;45;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd045-59;;;;;;;;Notes 2
cd045;3*16s23s5s;10;87;22;65;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-atgi-gca;;;;;;'’’sans;8;;;4;2;;1;'’’avant
;16s23s5s-aaa;;;;;;'’’1-3;15;;1;2;1;;1;gca-atc-gga-16s23s5s
;16s23s-aac-5s-aac;;;;;;'’’4-8;;;1;;;;;5s-atgi-gca-16-gca-atc-235-aac-aac
;16s23s5s-ttc-5s-ttc-aaa;;;;;;'’’9-23;;;;;;;;
;16s-gca-atc-235-6aas;;;;;;'’’24-43;;;;;;;;'’’1-3
;gca-atc-gga-16s23s5s;;;;;36;'’’total;23;0;2;6;3;0;2;3*16s23s5s-aaa
;16s-gca-atc-23s-aac;;;;;;;;;;;;;;3*16s23s5s-aac
;;;;;;;;;;;;;;;2*16s23s5s-ttc
cd047;16s23s5s;5;53;6;47;;;;;;;;;;16s23s5s-ggc
;16s23s5s-aac;;;;;;;;;;;;;;16s23s5s-ttc-tgc
;16s23s5s-ttc;;;;;;;;;;;;;;16s23s5s-aac-aac
;16s23s5s-aac-aac;;;;;;;;;;;;;;2*16s23s5s-atgi-gca
;16s5s-atgi-gca;;;;;;;;;;;;;;16s23s-aac-5s-aac
;;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
cd055;3*16-gca-235;8;65;9;56;;;;;;;;;;2*16-gca-235-aac
;16-gca-235-aac;;;;;;;;;;;;;;16-atc-235-tgg
;16-atc-235-tgg;;;;;;;;;;;;;;16-gca-atc-235-aac
;16-atc-235;;;;;;;;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;;;'’’incomplets
;16s23s5s;;;;;;;;;;;;;;16s5s-atgi-gca
;;;;;;;;;;;;;;;16s-gca-atc-23s-aac
cd057;16s23s5s;9;80;17;63;;;;;;;;;;
;16s23s5s-atgi-gca;;;;;;;;;;;;;;'’’différents
;16s23s5s-ggc;;;;;;;;;;;;;;16s23s-aac-5s-aac
;2*16s23s5s-aaa;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-ttc;;;;;;;;;;;;;;
;16s23s5s-ttc-tgc;;;;;;;;;;;;;;'’’5s en trop
;16-gca-atc-235-aac;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;5s-atgi-gca-16 –;;;;;;;;;;;;;;5s-atgi-gca-16-gca-atc-235-aac-aac
;gca-atc-235-aac-aac;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;
cd059;2*16s23s5s;6;59;5;54;;;;;;;;;;
;16-atc-235;;;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;;;
;16-gca-235-aac;38;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd060-64;;;;;;;;Notes 3
cd060;16s23s5s;7;63;10;53;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-atgi-gca;;;;;;'’’sans;8;;;;;;1;'’’avant
;16-gca-atc-235-atgi-gca;;;;;;'’’1-3;16;;2;;2;;1;atgf-16s23s5s
;16-atc-235-ttc;;;;;;'’’4-8;1;;1;;;;;atgi-gca-16s23s5s-aac
;16s23s5s-aac;;;;;;'’’9-23;;;;;;;;
;16s23s5s-aaa;;;;;;'’’24-43;;;;;;;;'’’1-3
;16s23s;;;;;32;'’’total;25;0;3;0;2;0;2;16s23s5s-atgi
;;;;;;;;;;;;;;;2*16s23s5s-aac
cd062;2*16s23s5s;9;74;13;61;;;;;;;;;;2*16s23s5s-ttc
;16s23s5s-atgi;;;;;;;;;;;;;;5*16s23s5s-aaa
;16s23s5s-aaa;;;;;;;;;;;;;;3*16s23s5s-atgi-gca
;16s23s5s-ttc;;;;;;;;;;;;;;16s23s-aac-5s-aac
;16-gca-atc-235-aac;;;;;;;;;;;;;;16s23s5s-atgi-gca-aac
;atgf-16s23s5s;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-atgi-gca-aac;;;;;;;;;;;;;;16-atc-235-ttc
;16-gca-atc-23s;;;;;;;;;;;;;;16-atc-235-ttc-tgc
;5s-ttc;;;;;;;;;;;;;;16-gca-atc-235-aac
;;;;;;;;;;;;;;;16-gca-atc-235-atgi-gca
cd063;4*16s23s5s;10;81;18;63;;;;;;;;;;
;16s23s-aac-5s-aac;;;;;;;;;;;;;;'’’incomplets
;16-gca-atc-23-aac;;;;;;;;;;;;;;16s23s
;16s23s5s-ttc-5s-ttc-aaa;;;;;;;;;;;;;;16-gca-atc-23s
;16s23s5s-aaa;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;16-gca-atc-235-6 aas;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
cd064;16s23s5s;9;77;17;60;;;;;;;;;;16s23s-aac-5s-aac
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;2*16s23s5s-aaa;;;;;;;;;;;;;;'’’5s en trop
;16s23s5s-ttc;;;;;;;;;;;;;;5s-ttc
;16-atc-235-ttc-tgc;;;;;;;;;;;;;;16s23s5s-ttc-5s-ttc-aaa
;16s23s5s-aac;;;;;;;;;;;;;;
;atgi-gca-16s23s5s-aac;;;;;;;;;;;;;;
;16s23s5s-5aas;35;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd067-92;;;;;;;;Notes 4
cd067;2*16s23s5s-atc-gca;10;96;16;80;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;16s23s5s-gaa, aaa, aac, ttc;;;;;;'’’sans;9;5;0;5;;1;;'’’1-3
;16-gca-atc-235-ttc, aaa;;;;;;'’’1-3;16;;4;;;;;3*16s23s5s-aaa
;16-gca-atc-23-aac;;;;;;'’’4-8;;;;;;;;3*16s23s5s-ttc
;16-gca-atc-235 –;;;;;;'’’9-23;;;;;;;;4*16s23s5s-aac
;aac-5s-ttc-tgc;;;;;;'’’24-43;;;;;;;;16s23s5s-gaa
;;;;;;40;'’’total;25;5;4;5;0;1;0;2*16s23s5s-atgi-gca
cd071;3*16s23s5s-aac;9;66;12;64;;;;;;;;;;3*16s23s5s-atc-gca
;16-gca-atc-235-ttc;;;;;;;;;;;;;;16-gca-atc-235-aaa
;16s23s5s-ttc, aaa;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s23s5s;;;;;;;;;;;;;;2*16-gca-atc-235-ttc
;16s23s5s-atc-gca;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
;16s23s5s-atgi-gca;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’incomplets
cd079;16s23s5s-atgi-gca;4;53;9;44;;;;;;;;;;8aas-16s
;16s23s5s-aaa;;;;;;;;;;;;;;16s-atc-23s
;16s23s5s-ttc;;;;;;;;;;;;;;16-gca-atc-23-aac
;16s-atc-23s;;;;;;;;;;;;;;
;16s°-atc-235-atgi-gca;;;;;;;;;;;;;;'’’autres incomplets
;23s5s-aaa;;;;;;;;;;;;;;23s5s-aaa
;;;;;;;;;;;;;;;16s°-atc-235-atgi-gca
cd083;16s23s5s;2;48;2;46;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
cd084;2*16-gca-235;4;54;4;50;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;'’’cds
;16atcgca-cds-235;;;;;;;;;;;;;;16atcgca-cds-235
;;;;;;;;;;;;;;;
cd089;2*16atcgca235;5;76;6;70;;;;;;;;;;'’’5s en trop
;2*16-gca-235;;;;;;;;;;;;;;16-gca-atc-235-aac-5s-ttc-tgc 
;16s23s5s;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'''autres
cd092;5*16s23s5s;9;68;13;55;;;;;;;;;;16atcgca-cds-235
;2*16atcgca235;;;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;;;
;8aas-16s;43;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd095-118;;;;;;;;Notes 5
cd095;'’’3*16-5s-23s;10;70;16;54;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;'’’16s-5s-atcgca-23s-gta-tta;;;;;;'’’sans;6;1;;2;1;5;2;'’’avant
;'’’16-5s-atcgca-23-aac;;;;;;'’’1-3;2;6;;;1;1;1;'’’gac-ttc-ggc-16s-5s-23s
;'’’2*16-5s-atgf-23s;;;;;;'’’4-8;4;;;;;1;1;'’’15aas-16s5s-atcgca-23s
;16-gcc-235-gta;;;;;;'’’9-23;2;;;4;;1;2;'’’cgg-tgg-16s5s-gcc-23s-5aas
;'’’gac-ttc-ggc-16s-5s-23s;;;;;;'’’24-43;;;;;;;;'’’ttc-cds-16s5s-atc-23s-aac-atgf
;16s-23s;;;;;43;'’’total;14;7;0;6;2;8;6;tcc-16s-cds-235-19aas
;;;;;;;;;;;;;;;tcg-16s23s-gca-5s-12aas
cd102;2*16-gca-235;7;69;55;14;;;;;;;;;;
;2*16s23s5s;;;;;;;;;;;;;;'’’autres
;2*16-gca-235-22,21aas;;;;;;;;;;;;;;16-gcc-235-gta
;16s23s5s-8aas;;;;;;;;;;;;;;'’’2*16s5s-gcc-23s
;;;;;;;;;;;;;;;'’’2*16s5s-gcc-23s-19, 5aas
cd112;16s23s-gca-5s-gta-tac-gga-cga;;;;;;;;;;;;;;'’’2*16-5s-atgf-23s
;tcc-16s-cds-235-19aas;;;;;;;;;;;;;;16s-cds-235
;16s-cds-235;4;48;39;9;;;;;;;;;;'’’3*16-5s-23s
;tcg-16s23s-gca-5s-12aas;;;;;;;;;;;;;;'’’16s-5s-atcgca-23s-gta-tta
;;;;;;;;;;;;;;;'’’16-5s-atcgca-23-aac
cd113;16s-atc-235;4;48;32;16;;;;;;;;;;'’’16s5s-atcgca-23s-aac-atgf
;16s23s5s;;;;;;;;;;;;;;'’’16s5s-atc-23s-aac
;16s-gca-235-11 aas;;;;;;;;;;;;;;
;16s-gca-235-18 aas;;;;;;;;;;;;;;'’’1-3
;;;;;;;;;;;;;;;16-gcc-235-gta
cd114;16atcgca235;4;59;21;38;;;;;;;;;;'’’16s5s-atc-23s-aac
;2*16atcgca235-acc;;;;;;;;;;;;;;'’’16-5s-atcgca-23-aac
;16s23s5s-13 aas;;;;;;;;;;;;;;3*16atcgca235-acc
;;;;;;;;;;;;;;;'’’16s-5s-atcgca-23s-gta-tta
cd116;16s23s5s-aac;5;78;35;43;;;;;;;;;;'’’16s5s-atcgca-23s-aac-atgf
;16s23s5s-caa-gaa-tac-ggc;;;;;;;;;;;;;;16s23s5s-aac
;16atcgca235-acc;;;;;;;;;;;;;;'’’16s5s23s-aaa-acc-ctc
;16s23s5s-8 aas;;;;;;;;;;;;;;
;16s23s5s-21 aas;;;;;;;;;;;;;;'’’incomplets
;;;;;;;;;;;;;;;16s-23s
cd118;'’’2*16s5s-gcc-23s;10;109;67;42;;;;;;;;;;
;'’’16s5s-gcc-23s-19aas;;;;;;;;;;;;;;'’’cds
;'’’16s5s-gcc-23s-5aas;;;;;;;;;;;;;;16s-cds-235
;'’’16s5s23s-aaa-acc-ctc;;;;;;;;;;;;;;tcc-16s-cds-235-19aas
;'’’16s5s-atc-23s-aac;;;;;;;;;;;;;;'’’ttc-cds-16s5s-atc-23s-aac-atgf
;'’’16s5s-atcgca-23s-aac-atgf;;;;;;;;;;;;;;
;'’’15aas-16s5s-atcgca-23s;44;;;;;;;;;;;;;'’’différents
;'’’cgg-tgg-16s5s-gcc-23s-5aas;;;;;;;;;;;;;;16s23s-gca-5s-gta-tac-gga-cga
;'’’ttc-cds-16s5s-atc-23s-aac-atgf;;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd133-153;;;;;;;;Notes 6
cd133;3*16s23s5s;10;85;75;10;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;2*16s-gca-235;;;;;;'’’sans;9;;;2;;;;'’’1-3
;16s23s-gga-5s;;;;;;'’’1-3;4;;;1;;;;16’-gca-235-tta-atgi
;16s23s5s-43aas;;;;;;'’’4-8;;;;;;;;2*16s23s-gga-5s
;16s23s5s-18aas;;;;;;'’’9-23;5;;;1;;;;16s23s5s-tta-atgi
;16s-gca-235-9aas;;;;;;'’’24-43;1;;;;;;;16s23s5s-gtg-gaa-cgg
;16s23s-aca;;;;;23;'’’total;19;0;0;4;0;0;0;
;;;;;;;;;;;;;;;'’’incomplets
cd136;3*16s23s5s;16;110;99;11;;;;;;;;;;2*16s23s-aca
;16s’-gca-23s°-16s°-23s    ;;;;;;;;;;;;;;16s’-gca-23s°-16s°-23s    
;16s°-gca-23s’;;;;;;;;;;;;;;16s-cds-23s°-5s-43aas
;16s23s-gga-5s;;;;;;;;;;;;;;16s23s°-cds
;16s23s-aca;;;;;;;;;;;;;;3*16s-23s°
;16s-cds-23s°-5s-43aas;;;;;;;;;;;;;;16s
;cds-cds-23s°-5s-18aas;;;;;;;;;;;;;;
;16s°-23s°-5s-9aas;;;;;;;;;;;;;;'’’autres incomplets
;;;;;;;;;;;;;;;16s°-gca-23s’
;16s23s5s-19aas;;;;;;;;;;;;;;23s5s
;16s23s5s-tta-atgi;;;;;;;;;;;;;;16s°-23s°-23s’-5s
;16s23s5s;;;;;;;;;;;;;;16s°gca-23s°
;16’-gca-235-tta-atgi;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’cds
;23s5s;;;;;;;;;;;;;;16s-cds-23s°-5s-43aas
;16s;;;;;;;;;;;;;;cds-cds-23s°-5s-18aas
;;;;;;;;;;;;;;;16s23s°-cds
;16s23s°-cds;;;;;;;;;;;;;;
;3*16s-23s°;;;;;;;;;;;;;;'’’différents
;;;;;;;;;;;;;;;2*16s23s-gga-5s
;16s°-23s°-23s’-5s;;;;;;;;;;;;;;
;23s°-5s;;;;;;;;;;;;;;'’’5s en trop
;16s°gca-23s°;;;;;;;;;;;;;;cds-cds-23s°-5s-18aas
;;;;;;;;;;;;;;;16s°-23s°-5s-9aas
cd153;2*16s23s5s;6;98;40;58;;;;;;;;;;23s°-5s
;16s23s5s-gtg-gaa-cgg;;;;;;;;;;;;;;
;2*16s23s5s-12aas;;;;;;;;;;;;;;
;16s23s5s-13aas;32;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Cd154-174;;;;;;;;Notes 7
cd154;2*16s-gcc-235;4;55;6;49;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;2*16atcgca235;;;;;;'’’sans;13;7;;;;5;;'’’avant
;;;;;;;'’’1-3;3;1;2;;;1;1;cag-gag-16atcgca235-aac
cd155;16atcgca235;4;48;2;46;;'’’4-8;;;1;;;1;;
;16s23s5s;;;;;;'’’9-23;;;;;;;;'’’autres
;16s23s°23s5s;;;;;;'’’24-43;;;;;;;;2*16s-gcc-235
;16s23s°23s5s-5s-5s;;;;;35;'’’total;16;8;3;0;0;7;1;2*16-cds-atcgca-23s16s°5s
;;;;;;;;;;;;;;;16s-cds-16s°-23s-cds-5s
cd156;16s23s5s;2;47;2;45;;;;;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;16atcgca235;;;;;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
;;;;;;;;;;;;;;;
cd157;16s23s5s-aac;2;106;4;102;;;;;;;;;;'’’1-3
;16-gcaatc-235-aac;;;;;;;;;;;;;;16s23s5s-aac
;;;;;;;;;;;;;;;16s23s5s-aac-ggg
cd158;2*16s23s5s;3;53;3;50;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
;16atcgca235-aac;;;;;;;;;;;;;;16atcgca235-aac
;;;;;;;;;;;;;;;2*16-gcaatc-235-aac
cd159;16atcgca235;2;51;7;44;;;;;;;;;;
;cag-gag-16atcgca235-aac;;;;;;;;;;;;;;'’’cds
;;;;;;;;;;;;;;;2*16-cds-atcgca-23s16s°5s
cd160;2*16-cds-atcgca-23s16s°5s;;53;4;49;;;;;;;;;;16s-cds-16s°-23s-cds-5s
;16s-cds-16s°-23s-cds-5s;3;;;;;;;;;;;;;
;;;;;;;;;;;;;;;'’’différents
cd161;2*16s23s5s;4;57;10;47;;;;;;;;;;16s23s°23s5s
;16s-23s°-gca-atc-23s-16s°-5s-6aas;;;;;;;;;;;;;;16s23s°23s5s-5s-5s
;23s°-16s-16s°-23s-5s-aac-ggg;;;;;;;;;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;;;;;;;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
cd170;3*16s23s5s;5;58;10;48;;;;;;;;;;
;16s23s5s-aac-ggg;;;;;;;;;;;;;;'’’5s en trop
;16-gcaatc-235-6aas;;;;;;;;;;;;;;16s23s°23s5s-5s-5s
;;;;;;;;;;;;;;;
cd173;2*16atcgca235;2;48;4;44;;;;;;;;;;
;;;;;;;;;;;;;;;
cd174;2*16s23s5s;3;53;3;50;;;;;;;;;;
;16-gcaatc-235-aac;34;;;;;;;;;;;;;
lien;blocs;16s;total aas;avec;sans;total page;Total;;;;;;;;
;;;;;;;;'’’16s23s5s;'’’atcgca;'’’gcaatc;'’’gca;'’’atc;'’’autres;'’’avant 16s;
;;;;;;;'’’sans;68;14;2;15;5;11;4;
;;;;;;;'’’1-3;63;7;10;4;5;2;4;
;'’’Moyenne;;68;21;48;;'’’4-8;6;1;4;0;0;2;4;
;'’’ecartype;;19;23;19;;'’’9-23;12;0;0;7;0;1;2;
;'’’max;;110;99;102;;'’’24-43;1;0;0;0;0;0;0;
;'’’min;;47;2;9;254;'’’total;150;22;16;26;10;16;14;
;;;;;;;Dont 16s5s-*-23s;5;3;0;1;2;6;6;

clostridia notes[modifier | modifier le wikicode]

Liens aux notes[modifier | modifier le wikicode]
1-3;1-3;1-3;1-3;1-3;1-3;1-3
16s-atc-23s-aac;3*16s23s5s-aaa;16s23s5s-atgi;3*16s23s5s-aaa;16-gcc-235-gta;16’-gca-235-tta-atgi;16s23s5s-aac
16s-gcaatc-23s5s-ttc-tgc;3*16s23s5s-aac;2*16s23s5s-aac;3*16s23s5s-ttc;16s5s-atc-23s-aac;2*16s23s-gga-5s;16s23s5s-aac-ggg
16s5s-gca-23-aac-gaa-tgc;2*16s23s5s-ttc;2*16s23s5s-ttc;4*16s23s5s-aac;16-5s-atcgca-23-aac;16s23s5s-tta-atgi;23s°-16s-16s°-23s-5s-aac-ggg
16235-aaa-cds-5s-aaa;16s23s5s-ggc;5*16s23s5s-aaa;16s23s5s-gaa;3*16atcgca235-acc;16s23s5s-gtg-gaa-cgg;16atcgca235-aac
16s5s23s-gac-aca;16s23s5s-ttc-tgc;3*16s23s5s-atgi-gca;2*16s23s5s-atgi-gca;16s-5s-atcgca-23s-gta-tta;;2*16-gcaatc-235-aac
2*16s23s5s-atgi-gca;16s23s5s-aac-aac;16s23s-aac-5s-aac;3*16s23s5s-atc-gca;16s5s-atcgca-23s-aac-atgf;;
16s23s5s-ttc-gac-gaa;2*16s23s5s-atgi-gca;16s23s5s-atgi-gca-aac;16-gca-atc-235-aaa;16s23s5s-aac;;
2*16s23s-aac-5s;16s23s-aac-5s-aac;16s23s5s-ttc-5s-ttc-aaa;16-gca-atc-23-aac;16s5s23s-aaa-acc-ctc;;
;16s23s5s-ttc-5s-ttc-aaa;16-atc-235-ttc;2*16-gca-atc-235-ttc;;;
;2*16-gca-235-aac;16-atc-235-ttc-tgc;16-gca-atc-235-aac-5s-ttc-tgc ;;;
;16-atc-235-tgg;16-gca-atc-235-aac;;;;
;16-gca-atc-235-aac;16-gca-atc-235-atgi-gca;;;;
avant;avant;avant;avant;avant;avant;avant
5aas-16s-gcaatc-235-6aas;gca-atc-gga-16s23s5s;atgf-16s23s5s;;gac-ttc-ggc-16s-5s-23s;;cag-gag-16atcgca235-aac
agc-16s5s23s-6aas;5s-atgi-gca-16-gca-atc-235-aac-aac;atgi-gca-16s23s5s-aac;;15aas-16s5s-atcgca-23s;;
tca-tcc-16s5s23s-5aas;;;;cgg-tgg-16s5s-gcc-23s-5aas;;
;;;;ttc-cds-16s5s-atc-23s-aac-atgf;;
;;;;tcc-16s-cds-235-19aas;;
;;;;tcg-16s23s-gca-5s-12aas;;
autres;autres;autres;autres;autres;autres;autres
16s5s-atc-23s;;;16atcgca-cds-235;16-gcc-235-gta;;2*16s-gcc-235
16s5s-gca-23-aac-gaa-tgc;;;;2*16s5s-gcc-23s;;2*16-cds-atcgca-23s16s°5s
16s5s23s-gac-aca;;;;2*16s5s-gcc-23s-19, 5aas;;16s-cds-16s°-23s-cds-5s
16s5s23s;;;;2*16-5s-atgf-23s;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;16s-cds-235;;23s°-16s-16s°-23s-5s-aac-ggg
;;;;3*16-5s-23s;;
;;;;16s-5s-atcgca-23s-gta-tta;;
;;;;16-5s-atcgca-23-aac;;
;;;;16s5s-atcgca-23s-aac-atgf;;
;;;;16s5s-atc-23s-aac;;
différents;différents;différents;différents;différents;différents;différents
2*16s23s-aac-5s;16s23s-aac-5s-aac;16s23s5s-ttc-5s-ttc-aaa;16-gca-atc-235-aac-5s-ttc-tgc ;16s23s-gca-5s-gta-tac-gga-cga;2*16s23s-gga-5s;16s23s°23s5s
16235-aaa-cds-5s-aaa;16s23s5s-ttc-5s-ttc-aaa;16s23s-aac-5s-aac;;;;16s23s°23s5s-5s-5s
;;;;;;16s-23s°-gca-atc-23s-16s°-5s-6aas
;;;;;;23s°-16s-16s°-23s-5s-aac-ggg
incomplets;incomplets;incomplets;incomplets;incomplets;incomplets;incomplets
;16s5s-atgi-gca;16s23s;8aas-16s;16s-23s;2*16s23s-aca;
;16s-gca-atc-23s-aac;16-gca-atc-23s;16s-atc-23s;;16s’-gca-23s°-16s°-23s    ;
;;16-gca-atc-23-aac;16-gca-atc-23-aac;;16s-cds-23s°-5s-43aas;
;;;;;16s23s°-cds;
;;;;;3*16s-23s°;
;;;;;16s;
autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets;autres incomplets
;;;23s5s-aaa;;16s°-gca-23s’;
;;;16s°-atc-235-atgi-gca;;23s5s;
;;;;;16s°-23s°-23s’-5s;
;;;;;16s°gca-23s°;
cds;cds;cds;cds;cds;cds;cds
16235-aaa-cds-5s-aaa;;;16atcgca-cds-235;16s-cds-235;16s-cds-23s°-5s-43aas;2*16-cds-atcgca-23s16s°5s
;;;;tcc-16s-cds-235-19aas;cds-cds-23s°-5s-18aas;16s-cds-16s°-23s-cds-5s
;;;;ttc-cds-16s5s-atc-23s-aac-atgf;16s23s°-cds;
5s en trop;5s en trop;5s en trop;5s en trop;5s en trop;5s en trop;5s en trop
16235-aaa-cds-5s-aaa;16s23s5s-ttc-5s-ttc-aaa;5s-ttc;16-gca-atc-235-aac-5s-ttc-tgc ;;cds-cds-23s°-5s-18aas;16s23s°23s5s-5s-5s
16-gca-2355;5s-atgi-gca-16-gca-atc-235-aac-aac;16s23s5s-ttc-5s-ttc-aaa;;;16s°-23s°-5s-9aas;
5s-ttc;;;;;23s°-5s;
5s;;;;;;
Cumuls notes[modifier | modifier le wikicode]
30.11.19 Tanger;;;;;;;;;
cumuls Notes;;;;;;;;;
;;;;;;;;;
avant;;;incomplets;;;Type 1-3;;tRNAs;nbre
atgf-16s23s5s;;;16s23s*2;;;16s23s5s;;aaa;11
gca-atc-gga-16s23s5s;;;16s23s-aca*2;;;;;aac;11
atgi-gca-16s23s5s-aac;;;16-gcaatc-23s;;;;;ttc;7
;;;16s-gcaatc-23s-aac*3;;;;;ggc;1
cag-gag-16-atcgca-235-aac;;;16s-atc-23s;;;;;atgi;1
5aas-16s-gcaatc-235-6aas;;;16s’-gca-23s°-16s°-23s    ;;;;;gaa;1
5s-atgi-gca-16-gcaatc-235-aac-aac;;;;;;;;atgi-gca;9
tcg-16s23s-gca-5s-12aas;;;16s5s-atgi-gca;;;;;atc-gca;3
;;;16s-cds-23s°-5s-43aas;;;;;ttc-tgc;1
tcc-16s-cds-235-19aas;;;;;;;;aac-aac;1
;;;16s;;;;;tta-atgi;1
gac-ttc-ggc-16s5s23s;;;8aas-16s;;;;;aac-ggg;1
tca-tcc-16s5s23s-5aas;;;16s-23s° *3;;;;;gac-aca;1
agc-16s5s23s-6aas;;;16s23s°-cds;;;;;aaa-cds-5s-aaa;1
15aas-16s5s-atcgca-23s;;;;;;;;atgi-gca-aac;1
ttc-cds-16s5s-atc-23s-aac-atgf;;;autres incomplets;;;;;gtg-gaa-cgg;1
cgg-tgg-16s5s-gcc-23s-5aas;;;23s5s-aaa;;;;;ttc-gac-gaa;1
;;;23s5s;;;;;ttc-5s-ttc-aaa;2
autres;;;16s°-23s°-23s’-5s;;;;;aaa-acc-ctc;1
16s5s23s*4;;;16s°-atc-235-atgi-gca;;;;;;
16s5s23s-gac-aca;;;16s°-gca-23s’;;;16s23s-gga-5s;;gga;2
16-5s-atcgca-23-aac;;;16s°gca-23s°;;;;;aac;2
16s-5s-atcgca-23s-gta-tta;;;;;;16s23s-aac-5s-aac;;aac-aac;2
16s5s-atcgca-23s-aac-atgf;;;cds;;;23s°-16s-16s°-23s5s;;aac-ggg;1
16s5s-gca-23-aac-gaa-tgc;;;16s-cds-235;;;;;;
16s5s-atc-23s;;;tcc-16s-cds-235-19aas;;;;;;
16s5s-atc-23s-aac;;;16-atcgca-cds-235;;;16-atcgca-235;;aac;4
;;;;;;;;aac;1
16s-gcc-235*2;;;16s-cds-23s°-5s-43aas;;;;;gta-tta;1
16-gcc-235-gta;;;16s-cds-16s°-23s-cds-5s;;;;;aac-atgf;1
16s5s-gcc-23s*2;;;16-cds-atcgca-23s16s°5s*2;;;;;;
16s5s-gcc-23s-19, 5aas*2;;;;;;16-gcaatc-235;;aac;4
16-5s-atgf-23s*2;;;16235-aaa-cds-5s-aaa;;;;;ttc;2
;;;ttc-cds-16s5s-atc-23s-aac-atgf;;;;;aaa;1
16s-cds-235;;;;;;;;atgi-gca;1
16-atcgca-cds-235;;;16s23s°-cds;;;;;ttc-tgc;1
16-cds-atcgca-23s16s°5s*2;;;cds-cds-23s°-5s-18aas;;;;;aac-5s-ttc-tgc ;1
16s-cds-16s°-23s-cds-5s;;;;;;16-gcaatc-23-aac;;aac;1
23s°-16s-16s°-23s-5s-aac-ggg;;;5s en trop;;;;;;
16s-23s°-gca-atc-23s-16s°-5s-6aas;;;16s23s5s-ttc-5s-ttc-aaa*2;;;16s-atc-235;;aac;1
;;;16-gca-2355;;;;;tgg;1
différents;;;16-gca-atc-235-aac-5s-ttc-tgc ;;;;;ttc;1
16s23s-gga-5s*2;;;5s-atgi-gca-16-gca-atc-235-aac-aac;;;;;ttc-tgc;1
16s23s-aac-5s*2;;;;;;16s-atc-23-aac;;aac;1
16s23s-aac-5s-aac*2;;;16s°-23s°-5s-9aas;;;;;;
16s23s5s-ttc-5s-ttc-aaa*2;;;16s23s°23s5s-5s-5s;;;16-gca-235;;aac;2
16s23s-gca-5s-gta-tac-gga-cga;;;;;;;;aac-gaa-tgc;1
;;;cds-cds-23s°-5s-18aas;;;16s’-gca-235;;tta-atgi;1
16-gcaatc-235-aac-5s-ttc-tgc ;;;16235-aaa-cds-5s-aaa;;;;;;
16s-23s°-gcaatc-23s-16s°-5s-6aas;;;;;;16-gcc-235;;gta;1
;;;23s°-5s;;;;;;
16s23s°23s5s;;;2*5s-ttc;;;total;;;91
16s23s°23s5s-5s-5s;;;5s;;;;;;
23s°-16s-16s°-23s5s-aac-ggg;;;;;;;;;
16235-aaa-cds-5s-aaa;;;;;;;;;

clostridia typage[modifier | modifier le wikicode]

clostridia blocs intégrés[modifier | modifier le wikicode]
avant inversé;;16s23s5s;atcgca;gcaatc;gca;atc;gcc;atgf;autres-cds;total
-;'’’sans;68;14;2;15;5;4;2;5;115
5;'’’1-3;63;7;10;4;5;1;0;1;91
5;'’’4-8;6;1;4;0;;1;;1;13
4;'’’9-23;12;;;7;;1;;;20
;'’’24-43;1;;;;;;;;1
14;'’’total;150;22;16;26;10;7;2;7;240
6;Dont 16s5s-*-23s;5;3;0;1;2;4;2;0;17
clostridia blocs 1-3[modifier | modifier le wikicode]
total 1-3;;16s23s5s;;16s-*-23s5s;
aac;39;aac;22;aac;17
ttc;19;aaa;16;ttc;6
aaa;17;gca;13;tgc;4
gca;14;ttc;13;atgi;2
atgi;13;atgi;11;gta;2
tgc;5;5s;3;tta;2
5s;4;atc;3;5s;1
gaa;4;gaa;3;aaa;1
atc;3;ggg;3;atgf;1
ggg;3;gac;2;gaa;1
tta;3;gga;2;gca;1
gac;2;aca;1;tgg;1
gga;2;acc;1;total;39
gta;2;cds;1;;
aca;1;cgg;1;;
acc;1;ctc;1;;
atgf;1;ggc;1;;
cds;1;gtg;1;;
cgg;1;tgc;1;;
ctc;1;tta;1;;
ggc;1;total;100;;
gtg;1;;;;
tgg;1;;;;
total;139;;;;
clostridia blocs 4-8[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs 4-8
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
cd002;cd064;cd118;cd001;cd002;cd045;cd063;cd161;cd170;cd092;cd102;cd116
4;5;5;6;6;6;6;6;6;8;8;8
16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;5s;gca;atc;gca;gca;23s°;gca;;23s;23s
5s;5s;gcc;atc;gca;atc;atc;gca;atc;;5s;5s
;;23s;23s;23s;23s;23s;atc;23s;;;
;;;5s;5s;5s;5s;23s;5s;;;
;;;;;;;16s°;;;;
;;;;;;;5s;;;;
caa;gaa;caa;aac;aac;gaa;gaa;aac;aac;gac;gaa;caa
gaa;cta;aaa;gaa;caa;cta;cta;gaa;gaa;tca;gta;gaa
tac;ggc;gaa;gac;gta;gga;gga;atgi;atgi;acc;gac;gta
ggc;gga;gta;aca;gac;aga;aga;gac;gac;agc;aca;gac
;aga;gac;tac;aca;caa;caa;ttc;ttc;aac;tac;aca
;;;aaa;aaa;gag;gag;acg;acg;gga;cta;aaa
;;;;;;;;;tgc;ggc;gga
;;;;;;;;;tta;gga;cca
clostridia blocs 9-23[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs 9-23
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
cd002;cd003;cd133;cd136;cd113;cd002;cd153;cd153;cd003;cd003;cd114;cd153;cd113;cd133;cd136;cd118;cd136;cd102;cd116;cd003;cd003;cd102;cd133;cd136
9;9;9;9;11;12;12;12;13;13;13;13;18;18;18;19;19;21;21;22;22;22;43;43
16s;16s;16s;16s°;16s;16s;16s;16s;16s;16s;16s;16s;16s;16s;cds;16s;16s;16s;16s;16s;16s;16s;16s;16s
23s;23s;gca;23s°;gca;23s;23s;23s;gca;23s;23s;23s;gca;23s;23s°;5s;23s;gca;23s;23s;gca;gca;23s;cds
5s;5s;23s;5s;23s;5s;5s;5s;23s;5s;5s;5s;23s;5s;5s;gcc;5s;23s;5s;5s;23s;23s;5s;23s°
;;5s;;5s;;;;5s;;;;5s;;;23s;;5s;;;5s;5s;;5s
;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;
caa;gaa;aac;aac;aac;caa;aac;cag;aac;aac;caa;aag;aac;aac;aac;tcc;aac;aac;caa;atgf;aac;aac;aac;aac
gaa;gta;tta;tta;tta;gaa;ggc;gag;tta;tta;aaa;gag;tta;gaa;gaa;ccg;tta;atgf;gaa;gaa;tta;tta;tta;tta
gta;aca;atgf;atgf;atgf;gta;atgj;ctc;atgf;atgf;atgf;atgj;atgf;gta;gta;gga;atgf;gaa;gta;gta;atgf;atgf;atgf;atgf
gac;gga;gaa;gaa;atgj;gac;ttc;ctg;atgj;gaa;gga;ttc;gaa;gac;gac;cac;gaa;gta;gac;gac;gaa;gaa;gaa;gaa
aca;aga;gga;gga;gaa;aca;tac;acc;gaa;gta;atgj;tac;gta;aca;aca;tgc;gga;gac;aca;aca;gta;gta;gga;gga
aaa;caa;gta;gta;gta;aaa;ggc;cgt;gta;gac;agc;ggc;gac;tac;tac;gtc;gta;aca;aaa;gga;gac;gac;gta;gta
atgf;aaa;gac;gac;gac;atgf;gtc;cgg;gac;aca;gaa;gcc;aca;gga;gga;ttc;gac;tac;atgf;aga;aca;aca;gac;gac
gga;atc;ggc;ggc;aca;ttc;gac;tgg;tac;tac;gta;gtc;tac;aga;aga;tac;aca;gga;ttc;caa;tac;cta;aca;aca
cca;ttc;aga;aga;tac;cta;ctg;cac;cta;cta;gac;gac;gga;caa;caa;caa;tac;aga;cta;aaa;cta;ggc;tac;tac
;;;;ggc;gga;atc;gcc;ggc;ggc;acc;ctg;aga;aaa;aaa;aaa;cta;caa;gga;tca;ggc;aga;cta;cta
;;;;cgt;aga;acg;ccc;cac;aaa;gcc;acc;gaa;tca;tca;gaa;aga;aaa;aga;agc;aaa;caa;aga;aga
;;;;;cac;tcg;ccg;tgc;atc;tac;atc;aaa;agc;agc;gta;caa;tca;cac;cca;cta;aaa;caa;caa
;;;;;;;;cgt;ttc;ggc;atgf;tca;cca;cca;gac;tca;ttc;gaa;atgi;agc;tca;tca;tca
;;;;;;;;;;;;agc;tgg;tgg;agc;ttc;atgj;gta;tgg;cca;agc;ttc;ttc
;;;;;;;;;;;;atgi;cca;cca;ccc;atgj;atgi;gcc;cca;atgi;cca;atgj;atgj
;;;;;;;;;;;;ttc;atc;atc;ctg;atgi;cca;aaa;atc;tgg;atc;atgi;atgi
;;;;;;;;;;;;tgg;ttc;ttc;ggc;cca;cac;atgf;ttc;cca;atgi;cca;cca
;;;;;;;;;;;;cgg;atg;atgj;cgt;cac;aaa;ttc;atgj;atc;tgg;cac;aca
;;;;;;;;;;;;;;;acc;aaa;tgc;gga;atgf;ttc;cca;aaa;aaa
;;;;;;;;;;;;;;;;;cta;aga;gac;atgf;atgi;tgc;tgc
;;;;;;;;;;;;;;;;;cgt;cac;aca;atgj;ttc;aac;aac
;;;;;;;;;;;;;;;;;;;gga;gga;atgj;tta;tta
;;;;;;;;;;;;;;;;;;;;;;atgf;atgf
;;;;;;;;;;;;;;;;;;;;;;gaa;gaa
;;;;;;;;;;;;;;;;;;;;;;gga;gga
;;;;;;;;;;;;;;;;;;;;;;gta;gta
;;;;;;;;;;;;;;;;;;;;;;gac;gac
;;;;;;;;;;;;;;;;;;;;;;aca;aca
;;;;;;;;;;;;;;;;;;;;;;tac;tac
;;;;;;;;;;;;;;;;;;;;;;cta;cta
;;;;;;;;;;;;;;;;;;;;;;ggc;ggc
;;;;;;;;;;;;;;;;;;;;;;aga;aga
;;;;;;;;;;;;;;;;;;;;;;caa;caa
;;;;;;;;;;;;;;;;;;;;;;aaa;aaa
;;;;;;;;;;;;;;;;;;;;;;tca;tca
;;;;;;;;;;;;;;;;;;;;;;ttc;ttc
;;;;;;;;;;;;;;;;;;;;;;atgj;atgj
;;;;;;;;;;;;;;;;;;;;;;atgi;atgi
;;;;;;;;;;;;;;;;;;;;;;cac;cac
;;;;;;;;;;;;;;;;;;;;;;aaa;aaa
;;;;;;;;;;;;;;;;;;;;;;tgc;tgc
;;;;;;;;;;;;;;;;;;;;;;cgt;cgt
;;;;;;;;;;;;;;;;;;;;;;gta;gta
clostridia blocs avant[modifier | modifier le wikicode]
  • Lien fiche: clostridia blocs avant
  • Légende
    - s° ribosomal RNA rRNA prediction is too short
    - s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends
;;;;;;cd112;;;cd112
cd011;cd011;cd118;cd001;;;14;;;20
7;7;17;13;;cd002;tcg;;cd136;tcc
agc;tca;tgc;gta;;12;16s;;19;16s
16s;tcc;gtc;gac;;16s;23s;;16s;cds
5s;16s;tac;ttc;;23s;gca;;23s;23s
23s;5s;caa;ggc;;5s;5s;;5s;5s
gac;23s;aaa;tgc;;caa;gaa;;aac;aac
gta;aac;gaa;16s;;gaa;gta;;tta;tta
aca;gaa;aac;gca;;gta;gac;;atgf;atgf
tac;atgi;atgf;atc;;gac;aca;;gaa;gaa
atgf;gta;agc;23s;;aca;tac;;gga;gta
ttc;tta;atgj;5s;;aaa;gga;;gta;gac
;;ggc;aac;;atgf;aaa;;gac;aca
;;cgt;gaa;;ttc;aag;;aca;cta
;;ccc;gac;;cta;agc;;tac;ggc
;;ctg;aca;;gga;cca;;cta;aga
;;ggc;tac;;aga;atc;;aga;caa
;;16s;aaa;;cac;tgg;;caa;aaa
;;5s;;;;;;tca;tca
;;atc;;;;;;ttc;ttc
;;gca;;;;;;atgj;atgj
;;23s;;;;;;atgi;atgi
;;;;;;;;cca;cac
;;;;;;;;cac;tgc
;;;;;;;;aaa;agg
clostridia total blocs longs[modifier | modifier le wikicode]
clostridia total blocs longs;;effectifs;;;;;;;clostridia total blocs longs;;Pour 1000;;;;;
tot;;568;;atgf;;26;;;tot;;1000;;atgf;;46;
att;;act;;aat;;agt;;;att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;;;ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;;;gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;;;ttt;;tct;;tat;;tgt;
atc;10;acc;5;aac;26;agc;12;;atc;18;acc;9;aac;46;agc;21
ctc;1;ccc;3;cac;12;cgt;8;;ctc;2;ccc;5;cac;21;cgt;14
gtc;4;gcc;4;gac;38;ggc;21;;gtc;7;gcc;7;gac;67;ggc;37
ttc;25;tcc;3;tac;24;tgc;11;;ttc;44;tcc;5;tac;42;tgc;19
atgi;15;aca;28;aaa;31;aga;21;;atgi;26;aca;49;aaa;55;aga;37
cta;18;cca;17;caa;24;cga;0;;cta;32;cca;30;caa;42;cga;0
gta;35;gca;0;gaa;40;gga;28;;gta;62;gca;0;gaa;70;gga;49
tta;16;tca;14;taa;0;tga;0;;tta;28;tca;25;taa;0;tga;0
atgj;18;acg;3;aag;2;agg;1;;atgj;32;acg;5;aag;4;agg;2
ctg;5;ccg;2;cag;1;cgg;2;;ctg;9;ccg;4;cag;2;cgg;4
gtg;0;gcg;0;gag;4;ggg;0;;gtg;0;gcg;0;gag;7;ggg;0
ttg;0;tcg;2;tag;0;tgg;8;;ttg;0;tcg;4;tag;0;tgg;14

bacilli-clostridia[modifier | modifier le wikicode]

B-C total blocs longs[modifier | modifier le wikicode]

+ grande variation du pour 1000;;;Bacilli-clostridia;;atgf;4;
att;;act;;aat;;agt;
ctt;;cct;;cat;;cgc;
gtt;;gct;;gat;;ggt;
ttt;;tct;;tat;;tgt;
;;;;;;;
atc;56;acc;30;aac;9;agc;3
ctc;355;ccc;-5;cac;43;cgt;233
gtc;-5;gcc;-6;gac;-18;ggc;56
ttc;-22;tcc;225;tac;-32;tgc;-13
;;;;;;;
atgi;-131;aca;1;aaa;-14;aga;-6366
cta;-3;cca;47;caa;-7;cga;0
gta;4;gca;3602;gaa;-32;gga;-69
tta;20;tca;11;taa;0;tga;0
;;;;;;;
atgj;-73;acg;-4;aag;-4;agg;-2
ctg;-40;ccg;-4;cag;-2;cgg;-4
gtg;0;gcg;0;gag;-7;ggg;1
ttg;1830;tcg;-2;tag;0;tgg;70

Autres firmicutes[modifier | modifier le wikicode]

Autres firmicutes blocs[modifier | modifier le wikicode]

autres firmicutes blocs;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;en004-9;;;;;Notes
en002;3*16s23s5s;;3;53;0;53;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;5s;;;;;;;'''sans;19;4;;3;'''1-3
;;;;;;;;'''1-3;4;2;;;16s23s5s-cds-tgc-taa 
;;;;;;;;'''4-8;;;;;16s23s5s-cds-tac-caa
en003;16s23s5s-CDS-tgc-taa ;;;40;2;38;;'''9-23;1;3;;;16235-aac-gaa-acg
;;;1;;;;;'''24-43;;;;;16atcgca235-tgg-cgt
;;;;;;;36;'''total;24;9;0;3;16atcgca235-aac
en004;16s23s5s;;7;77;63;14;;;;;;;
;16atcgca235-9aas;;;;;;;;;;;;'''cds
;2*16atcgca235-12aas;;;;;;;;;;;;16s23s5s-cds-tgc-taa 
;16235-19aas;;;;;;;;;;;;16s23s5s-cds-tac-caa
;16s23s5s-cds-tac-caa;;;;;;;;;;;;
;16235-aac-gaa-acg;;;;;;;;;;;;'''5s en trop
;;;;;;;;;;;;;16s23s5s-5s
;;;;;;;;;;;;;5s
en005;4*16s23s5s;;6;60;4;56;;;;;;;
;2*16atcgca235;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en006;3*16s23s5s;;3;53;0;53;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en008;4*16s23s5s;;7;65;6;59;;;;;;;
;2*16-gca-235;;;;;;;;;;;;
;16atcgca235-tgg-cgt;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;;;;;;;;;;;
en009;3*16s23s5s;;9;77;9;68;;;;;;;
;16s23s5s-aac;;;;;;;;;;;;
;16atcgca235-aac;;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;
;16-gca-235;;;;;;;;;;;;
;16s23s5s-5s;;;;;;;;;;;;
;;;36;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;en010-13;;;;;Notes
en010;6*16s23s5s;;15;99;28;71;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;3*16atcgca235;;;;;;;'''sans;15;4;1;1;'''1-3
;16-gca-235;;;;;;;'''1-3;2;2;1;1;16-gca-235-aac
;16s23s5s-5s;;;;;;;'''4-8;;;;;16-gcaatc-235-cac-tgg-agc
;16-gca-235-aac;;;;;;;'''9-23;1;;1;;16atcgca235-aac
;16atcgca235-aac;;;;;;;'''24-43;;;;;16atcgca235-tgg-cgt
;16s23s5s-acc;;;;;;29;'''total;18;6;3;2;16s23s5s-acc
;16s-23s°;;;;;;;;;;;;16s23s5s-cac-tgg
;gga-5s-5aas-ncRNA-9aas;;;;;;;;;;;;
;;;;;;;;;;;;;'''incomplets
en011;4*16s23s5s;;7;73;20;53;;;;;;;16s23s
;16-gcaatc-235-cac-tgg-agc;;;;;;;;;;;;16s-23s°
;16-gcaatc-2355-13 aas;;;;;;;;;;;;
;16s23s;;;;;;;;;;;;'''5s en trop
;;;;;;;;;;;;;16s23s5s-5s
en012;16s23s5s;;4;55;16;39;;;;;;;gga-5s-5aas-ncRNA-9aas
;16-gca-atc-235;;;;;;;;;;;;16-gcaatc-2355-13 aas
;16s23s5s-cac-tgg;;;;;;;;;;;;
;16s23s5s-12aas;;;;;;;;;;;;
;;;;;;;;;;;;;
en013;2*16s23s5s;;4;49;6;43;;;;;;;
;16atcgca235;;;;;;;;;;;;
;16atcgca235-tgg-cgt;;;;;;;;;;;;
;;;;;;;;;;;;;
;;;30;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total pages;total;;;;;Notes
;;;;701;154;547;;;'''16s23s5s;'''atcgca;'''gcaatc;'''gca;
;;;;;;;;'''sans;34;8;1;4;
;;;;;;;;'''1-3;6;4;1;1;
;'''Moyenne;;;64;14;50;;'''4-8;0;0;0;0;
;'''ecartype;;;17;19;16;;'''9-23;2;3;1;0;
;'''max;;;99;63;71;;'''24-43;;;;;
;'''min;;;40;0;14;65;'''total;42;15;3;5;

Noms firmicutes[modifier | modifier le wikicode]

;2.9.19 Paris;fait vers le 20.8.19;;;;;;
Firmicutes;;;;;génomes;ruptures;faits;total
NCBI 1;https://www.ncbi.nlm.nih.gov/nuccore/NZ_CP009902;;;;total;324;86;850
NCBI 2;https://www.ncbi.nlm.nih.gov/nuccore/NC_000964.3;;;;bacilli;189;32;663
;;;;;clostridia;123;43;174
notes;x*y;KEGG;;;autres;12;11;13
rRNAs;(5S, 16S, 23S);;;;total tRNAs;61644;;
;;;;;;;;
ruptures;notes;rRNAs;fait;code;tRNAs;génomes;;
1;;444;1;bc001;60;Aerococcus urinae ACS-120-V-Col10a ;;
1;;666;1;bc002;65;Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ;;
;;;;bc003;64;Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1 ;;
1;;666;1;bc004;56;Amphibacillus xylanus NBRC 15112 ;;
1;;;;bc005;77;Anoxybacillus flavithermus WK1 ;;
1;;;;bc006;87;Bacillus amyloliquefaciens CC178 ;;
;;;;bc007;94;Bacillus amyloliquefaciens DSM 7 ;;
;;10,10,10;1;bc008;95;Bacillus amyloliquefaciens IT-45 ;;
;;;;bc009;85;Bacillus amyloliquefaciens L-H15 ;;
;;;;bc010;92;Bacillus amyloliquefaciens L-S60 ;;
;;;;bc011;94;Bacillus amyloliquefaciens LFB112 ;;
;;;;bc012;72;Bacillus amyloliquefaciens LL3 ;;
;;;;bc013;72;Bacillus amyloliquefaciens SQR9 ;;
1;;10,8,10;1;bc014;89;Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19 ;;
1;;10,9,10;1;bc015;89;Bacillus amyloliquefaciens subsp. plantarum AS43.3 ;;
;;;;bc016;95;Bacillus amyloliquefaciens subsp. plantarum CAU B946 ;;
;;;;bc017;90;Bacillus amyloliquefaciens subsp. plantarum FZB42 ;;
;;;;bc018;92;Bacillus amyloliquefaciens subsp. plantarum NAU-B3 ;;
;;;;bc019;81;Bacillus amyloliquefaciens subsp. plantarum NJN6 ;;
;;;;bc020;77;Bacillus amyloliquefaciens subsp. plantarum TrigoCor1448 ;;
;;;;bc021;86;Bacillus amyloliquefaciens subsp. plantarum UCMB5033 UCMB-5033 ;;
;;;;bc022;89;Bacillus amyloliquefaciens subsp. plantarum UCMB5036 ;;
;;;;bc023;89;Bacillus amyloliquefaciens subsp. plantarum UCMB5113 ;;
;;;;bc024;92;Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2 ;;
;;666;1;bc025;70;Bacillus amyloliquefaciens TA208 ;;
;;;;bc026;75;Bacillus amyloliquefaciens XH7 ;;
;;;;bc027;88;Bacillus amyloliquefaciens Y2 ;;
1;;;;bc028;96;Bacillus anthracis 2000031021 ;;
;NCBI 1;11,11,11;1;bc029;112;Bacillus anthracis 2002013094 ;;
;;;;bc030;95;Bacillus anthracis A0157 ;;
;;;;bc031;96;Bacillus anthracis A1144 ;;
;;;;bc032;95;Bacillus anthracis Ames A0462 ;;
;;;;bc033;98;Bacillus anthracis Ames BA1004 ;;
1;;10,10,10;1;bc034;94;Bacillus anthracis BA1015 ;;
;;;;bc035;96;Bacillus anthracis BA1035 ;;
;;;;bc036;95;Bacillus anthracis BFV ;;
;;;;bc037;83;Bacillus anthracis Canadian bison ;;
;;;;bc038;95;Bacillus anthracis Cvac02 ;;
;;;;bc039;107;Bacillus anthracis delta Sterne ;;
;;;;bc040;95;Bacillus anthracis Han ;;
;;;;bc041;96;Bacillus anthracis HYU01 ;;
;;;;bc042;96;Bacillus anthracis K3 ;;
;;;;bc043;101;Bacillus anthracis Ohio ACB ;;
;;;;bc044;98;Bacillus anthracis PAK-1 ;;
;;;;bc045;96;Bacillus anthracis Pasteur ;;
;;;;bc046;95;Bacillus anthracis Pollino ;;
;;;;bc047;94;Bacillus anthracis RA3 ;;
;;;;bc048;97;Bacillus anthracis SK-102 ;;
;;;;bc049;95;Bacillus anthracis str. A0248 ;;
;;;;bc050;93;Bacillus anthracis str. A16 ;;
;;;;bc051;93;Bacillus anthracis str. A16R ;;
;;;;bc052;33;Bacillus anthracis str. A2012 ;;
;;;;bc053;95;Bacillus anthracis str. Ames ;;
;;;;bc054;95;Bacillus anthracis str. Ames Ancestor A2084 ;;
;;;;bc055;97;Bacillus anthracis str. CDC 684 ;;
;;;;bc056;96;Bacillus anthracis str. H9401 ;;
;2*95;;;bc057;190;Bacillus anthracis str. Sterne ;;
;;;;bc058;96;Bacillus anthracis str. SVA11 ;;
;;;;bc059;99;Bacillus anthracis str. Turkey32 ;;
;;;;bc060;96;Bacillus anthracis str. V770-NP-1R ;;
;;;;bc061;95;Bacillus anthracis str. Vollum ;;
;;;;bc062;95;Bacillus anthracis Vollum 1B ;;
1;;777;1;bc063;75;Bacillus atrophaeus 1942 ;;
;;;;bc064;81;Bacillus atrophaeus NRS 1221A ;;
;;888;1;bc065;80;Bacillus atrophaeus subsp. globigii BSS ;;
1;;13,13,13;1;bc066;95;Bacillus bombysepticus str. Wang ;;
1;;10,10,10;1;bc067;83;Bacillus cellulosilyticus DSM 2522 ;;
1;2*106;;;bc068;212;Bacillus cereus 03BB102 ;;
;;;;bc069;105;Bacillus cereus 03BB108 ;;
;;;;bc070;107;Bacillus cereus 03BB87 ;;
;;;;bc071;108;Bacillus cereus 3a ;;
;;;;bc072;106;Bacillus cereus AH187 ;;
;;;;bc073;97;Bacillus cereus AH820 ;;
;;14,14,14;1;bc074;118;Bacillus cereus Al Hakam ;;
;;;;bc075;99;Bacillus cereus ATCC 10987 ;;
;;;;bc076;108;Bacillus cereus ATCC 14579 ;;
;;;;bc077;107;Bacillus cereus ATCC 4342 ;;
;;;;bc078;108;Bacillus cereus B4264 ;;
;;;;bc079;102;Bacillus cereus biovar anthracis str. CI ;;
;;;;bc080;105;Bacillus cereus D17 ;;
;96+103;;;bc081;199;Bacillus cereus E33L ;;
;;;;bc082;105;Bacillus cereus F837/76 ;;
;;;;bc083;102;Bacillus cereus FM1 ;;
;;;;bc084;106;Bacillus cereus FORC 005 ;;
;;;;bc085;107;Bacillus cereus FRI-35 ;;
;;;;bc086;92;Bacillus cereus FT9 ;;
;;;;bc087;105;Bacillus cereus G9241 ;;
;;;;bc088;99;Bacillus cereus G9842 ;;
;;;;bc089;106;Bacillus cereus NC7401 ;;
;;13,13,13;1;bc090;95;Bacillus cereus Q1 ;;
;;;;bc091;106;Bacillus cereus S2-8 ;;
1;;;;bc092;75;Bacillus clausii KSM-K16 ;;
1;;;;bc093;73;Bacillus coagulans 2-6 ;;
;;;;bc094;85;Bacillus coagulans 36D1 ;;
;;;;bc095;86;Bacillus coagulans DSM 1 ATCC 7050 ;;
;;;;bc096;85;Bacillus coagulans HM-08 ;;
1;;13,13,13;1;bc097;107;Bacillus cytotoxicus NVH 391-98 ;;
1;;;;bc098;78;Bacillus halodurans C-125 ;;
1;;;;bc099;88;Bacillus infantis NRRL B-14911 ;;
1;;;;bc100;69;Bacillus lehensis G1 ;;
1;;;;bc101;73;Bacillus licheniformis 9945A ;;
;;;;bc102;73;Bacillus licheniformis BL-09 ;;
;74*2;;;bc103;148;Bacillus licheniformis DSM 13 ATCC 14580 ;;
1;;;;bc104;116;Bacillus megaterium DSM 319 ;;
;;;;bc105;128;Bacillus megaterium NBRC 15308 ATCC 14581 ;;
;bmq;;;bc106;142;Bacillus megaterium QM B1551 ;;
;;;;bc107;119;Bacillus megaterium WSH-002 ;;
1;;;;bc108;92;Bacillus methanolicus MGA3 ;;
1;;;;bc109;82;Bacillus methylotrophicus JS25R ;;
1;bmyc;;;bc110;118;Bacillus mycoides 219298 ;;
;;;;bc111;107;Bacillus mycoides ATCC 6462 ;;
1;;;;bc112;78;Bacillus pseudofirmus OF4 ;;
1;;;;bc113;81;Bacillus pumilus MTCC B6033 ;;
;;;;bc114;70;Bacillus pumilus SAFR-032 ;;
;;;;bc115;70;Bacillus pumilus W3 ;;
1;;;;bc116;69;Bacillus selenitireducens MLS10 ;;
1;;;;bc117;91;Bacillus sp. 1NLA3E ;;
1;;;;bc118;87;Bacillus sp. BH072 ;;
1;;;;bc119;86;Bacillus sp. BS34A ;;
1;;;;bc120;86;Bacillus sp. JS ;;
1;;;;bc121;86;Bacillus sp. LM 4-2 ;;
1;;;;bc122;83;Bacillus sp. OxB-1 ;;
1;;;;bc123;84;Bacillus sp. Pc3 ;;
1;;;;bc124;81;Bacillus sp. WP8 ;;
1;gst;12,12,12;1;bc125;123;Bacillus sp. X12014 ;;
1;;;;bc126;87;Bacillus sp. YP1 ;;
1;;;;bc127;72;Bacillus subtilis ATCC 13952 ;;
;;;;bc128;72;Bacillus subtilis ATCC 19217 ;;
;;;;bc129;59;Bacillus subtilis B-1 ;;
;;;;bc130;92;Bacillus subtilis BEST7003 ;;
;NCBI 2;;;bc131;130;Bacillus subtilis BEST7613 ;;
;;;;bc132;86;Bacillus subtilis Bs-916 ;;
;;;;bc133;86;Bacillus subtilis BS49 ;;
;;;;bc134;83;Bacillus subtilis BSn5 ;;
;;;;bc135;71;Bacillus subtilis HJ5 ;;
;;;;bc136;86;Bacillus subtilis KCTC 1028 ;;
;;;;bc137;86;Bacillus subtilis PS832 ;;
;;;;bc138;86;Bacillus subtilis PY79 ;;
;;;;bc139;86;Bacillus subtilis QB928 ;;
;;;;bc140;84;Bacillus subtilis SG6 ;;
;;;;bc141;88;Bacillus subtilis subsp. natto BEST195 ;;
;;;;bc142;77;Bacillus subtilis subsp. spizizenii NRS 231 ;;
;;;;bc143;77;Bacillus subtilis subsp. spizizenii str. W23 ;;
;;;;bc144;92;Bacillus subtilis subsp. spizizenii TU-B-10 ;;
;;;;bc145;86;Bacillus subtilis subsp. subtilis 3NA ;;
;;;;bc146;86;Bacillus subtilis subsp. subtilis 6051-HGW ;;
;2*86;10,10,10;1;bc147;172;Bacillus subtilis subsp. subtilis str. 168 ;;
;;;;bc148;86;Bacillus subtilis subsp. subtilis str. AG1839 ;;
;;;;bc149;89;Bacillus subtilis subsp. subtilis str. BAB-1 ;;
;;;;bc150;86;Bacillus subtilis subsp. subtilis str. BSP1 ;;
;;;;bc151;86;Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 ;;
;;;;bc152;80;Bacillus subtilis subsp. subtilis str. OH 131.1 ;;
;;;;bc153;86;Bacillus subtilis subsp. subtilis str. RO-NN-1 ;;
;;;;bc154;77;Bacillus subtilis T30 ;;
;;;;bc155;77;Bacillus subtilis XF-1 ;;
1;;;;bc156;105;Bacillus thuringiensis 97-27 ;;
;;;;bc157;104;Bacillus thuringiensis BMB171 ;;
;btg;14,14,14;1;bc158;142;Bacillus thuringiensis Bt407 ;;
;;;;bc159;99;Bacillus thuringiensis HD-771 ;;
;;;;bc160;122;Bacillus thuringiensis HD-789 ;;
;;;;bc161;134;Bacillus thuringiensis HD1002 ;;
;;;;bc162;104;Bacillus thuringiensis HD1011 ;;
;;;;bc163;104;Bacillus thuringiensis HD571 ;;
;;;;bc164;105;Bacillus thuringiensis HD682 ;;
;;15,15,15;1;bc165;78;Bacillus thuringiensis MC28 ;;
;;;;bc166;86;Bacillus thuringiensis serovar chinensis CT-43 ;;
;;;;bc167;108;Bacillus thuringiensis serovar finitimus YBT-020 ;;
;;;;bc168;115;Bacillus thuringiensis serovar galleriae HD-29 ;;
;;;;bc169;105;Bacillus thuringiensis serovar konkukian str. 97-27 ;;
;;;;bc170;108;Bacillus thuringiensis serovar kurstaki HD 1 ;;
;;;;bc171;98;Bacillus thuringiensis serovar kurstaki str. HD-1 ;;
;;;;bc172;104;Bacillus thuringiensis serovar kurstaki str. HD73 ;;
;99+108;;;bc173;207;Bacillus thuringiensis serovar kurstaki str. YBT-1520 ;;
;;;;bc174;98;Bacillus thuringiensis serovar morrisoni BGSC 4AA1 ;;
;;;;bc175;86;Bacillus thuringiensis serovar thuringiensis str. IS5056 ;;
;;;;bc176;104;Bacillus thuringiensis str. Al Hakam ;;
;;;;bc177;95;Bacillus thuringiensis YBT-1518 ;;
1;;;;bc178;98;Bacillus toyonensis BCT-7112 ;;
1;;;;bc179;108;Bacillus weihenstephanensis KBAB4 ;;
;;;;bc180;79;Bacillus weihenstephanensis WSBC 10204 ;;
1;bbe;;;bc181;127;Brevibacillus brevis NBRC 100599 NBRC 100599 47 ;;
1;blr;;;bc182;113;Brevibacillus laterosporus LMG 15441 ;;
1;;;;bc183;59;Carnobacterium maltaromaticum LMA28 ;;
1;;;;bc184;67;Carnobacterium sp. 17-4 ;;
1;;;;bc185;74;Carnobacterium sp. WN1359 ;;
1;;;;bc186;60;Enterococcus casseliflavus EC20 ;;
1;;;;bc187;57;Enterococcus faecalis 62 ;;
;;;;bc188;63;Enterococcus faecalis ATCC 29212 ;;
;;;;bc189;65;Enterococcus faecalis D32 ;;
;;;;bc190;64;Enterococcus faecalis DENG1 ;;
;;;;bc191;60;Enterococcus faecalis OG1RF ;;
;;;;bc192;65;Enterococcus faecalis str. Symbioflor 1 ;;
;;;;bc193;71;Enterococcus faecalis V583 ;;
1;;;;bc194;47;Enterococcus faecium Aus0004 ;;
;;;;bc195;76;Enterococcus faecium Aus0085 AUS0085 ;;
;;;;bc196;64;Enterococcus faecium DO ;;
;;;;bc197;48;Enterococcus faecium NRRL B-2354 ;;
;;;;bc198;65;Enterococcus faecium T110 ;;
1;;;;bc199;72;Enterococcus hirae ATCC 9790 ;;
1;;;;bc200;66;Enterococcus mundtii QU 25 QU25 ;;
1;;;;bc201;33;Enterococcus sp. 7L76 ;;
1;;;;bc202;67;Exiguobacterium antarcticum B7 Eab7 ;;
1;;;;bc203;69;Exiguobacterium sibiricum 255-15 ;;
1;;;;bc204;68;Exiguobacterium sp. AT1b ;;
1;;;;bc205;61;Exiguobacterium sp. MH3 ;;
1;;;;bc206;88;Geobacillus kaustophilus HTA426 ;;
1;;;;bc207;89;Geobacillus sp. C56-T3 ;;
1;;;;bc208;88;Geobacillus sp. GHH01 ;;
1;;;;bc209;89;Geobacillus sp. JF8 ;;
1;;;;bc210;93;Geobacillus sp. WCH70 ;;
1;;;;bc211;92;Geobacillus sp. Y4.1MC1 ;;
1;;;;bc212;89;Geobacillus sp. Y412MC52 ;;
1;;;;bc213;89;Geobacillus sp. Y412MC61 ;;
1;;;;bc214;88;Geobacillus thermodenitrificans NG80-2 ;;
1;;;;bc215;91;Geobacillus thermoglucosidasius C56-YS93 ;;
1;;;;bc216;89;Geobacillus thermoleovorans CCB US3 UF5 ;;
1;;;;bc217;69;Halobacillus halophilus DSM 2266 ;;
1;jeo;;;bc218;124;Jeotgalibacillus sp. D5 ;;
1;;;;bc219;56;Jeotgalicoccus sp. 13MG44 air ;;
1;;;;bc220;60;Kyrpidia tusciae DSM 2912 ;;
1;;;;bc221;63;Lactobacillus acidophilus 30SC ;;
;;;;bc222;61;Lactobacillus acidophilus FSI4 ;;
;;;;bc223;61;Lactobacillus acidophilus La-14 ;;
;;;;bc224;61;Lactobacillus acidophilus NCFM ;;
1;;;;bc225;60;Lactobacillus amylovorus GRL 1112 ;;
;;;;bc226;62;Lactobacillus amylovorus GRL1118 ;;
1;;;;bc227;65;Lactobacillus brevis ATCC 367 ;;
;;;;bc228;49;Lactobacillus brevis BSO 464 ;;
;;;;bc229;64;Lactobacillus brevis KB290 ;;
1;;;;bc230;61;Lactobacillus buchneri CD034 ;;
;;;;bc231;63;Lactobacillus buchneri NRRL B-30929 ;;
1;;;;bc232;57;Lactobacillus casei 12A ;;
;;;;bc233;59;Lactobacillus casei ATCC 334 ;;
;;;;bc234;61;Lactobacillus casei BD-II ;;
;;;;bc235;61;Lactobacillus casei BL23 ;;
;;;;bc236;59;Lactobacillus casei LC2W ;;
;;;;bc237;61;Lactobacillus casei LOCK919 ;;
;;;;bc238;60;Lactobacillus casei str. Zhang ;;
;;;;bc239;59;Lactobacillus casei subsp. casei ATCC 393 ;;
;;;;bc240;61;Lactobacillus casei W56 ;;
1;;;;bc241;64;Lactobacillus crispatus ST1 ;;
1;;;;bc242;89;Lactobacillus delbrueckii subsp. bulgaricus 2038 ;;
;;;;bc243;95;Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 JCM 1002 ;;
;;999;1;bc244;98;Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;
;;;;bc245;98;Lactobacillus delbrueckii subsp. bulgaricus ND02 ;;
1;;;;bc246;58;Lactobacillus fermentum CECT 5716 ;;
;;;;bc247;58;Lactobacillus fermentum F-6 ;;
;;;;bc248;58;Lactobacillus fermentum IFO 3956 ;;
1;;;;bc249;75;Lactobacillus gasseri ATCC 33323 JCM 1131 ;;
1;;;;bc250;64;Lactobacillus helveticus CNRZ32 ;;
;;;;bc251;61;Lactobacillus helveticus DPC 4571 ;;
;;;;bc252;63;Lactobacillus helveticus H10 ;;
;;;;bc253;61;Lactobacillus helveticus H9 ;;
;;;;bc254;61;Lactobacillus helveticus KLDS1.8701 ;;
;;;;bc255;61;Lactobacillus helveticus R0052 ;;
1;;;;bc256;56;Lactobacillus hokkaidonensis LOOC260 ;;
1;;;;bc257;55;Lactobacillus johnsonii DPC 6026 ;;
;;;;bc258;54;Lactobacillus johnsonii FI9785 ;;
;;;;bc259;54;Lactobacillus johnsonii N6.2 ;;
;;;;bc260;78;Lactobacillus johnsonii NCC 533 ;;
1;;;;bc261;60;Lactobacillus kefiranofaciens ZW3 ;;
1;;;;bc262;92;Lactobacillus mucosae LM1 ;;
1;;;;bc263;61;Lactobacillus paracasei N1115 ;;
;;;;bc264;59;Lactobacillus paracasei subsp. paracasei 8700 2 ;;
;;;;bc265;61;Lactobacillus paracasei subsp. paracasei JCM 8130 ;;
1;;;;bc266;69;Lactobacillus plantarum 16 ;;
;;;;bc267;67;Lactobacillus plantarum B21 ;;
;;;;bc268;62;Lactobacillus plantarum JDM1 ;;
;;;;bc269;72;Lactobacillus plantarum subsp. plantarum P-8 ;;
;;;;bc270;71;Lactobacillus plantarum subsp. plantarum ST-III ;;
;;;;bc271;74;Lactobacillus plantarum WCFS1 ;;
;;;;bc272;65;Lactobacillus plantarum ZJ316 ;;
1;;;;bc273;68;Lactobacillus reuteri DSM 20016 ;;
;;;;bc274;70;Lactobacillus reuteri I5007 ;;
;;;;bc275;65;Lactobacillus reuteri JCM 1112 ;;
;;;;bc276;70;Lactobacillus reuteri SD2112 ;;
;;;;bc277;70;Lactobacillus reuteri TD1 ;;
1;;;;bc278;60;Lactobacillus rhamnosus ATCC 8530 ;;
;;;;bc279;59;Lactobacillus rhamnosus GG ATCC 53103 ;;
;;;;bc280;57;Lactobacillus rhamnosus GG GG ATCC 53103 ;;
;;;;bc281;61;Lactobacillus rhamnosus Lc 705 ;;
;;;;bc282;59;Lactobacillus rhamnosus LOCK900 ;;
;;;;bc283;62;Lactobacillus rhamnosus LOCK908 ;;
1;;;;bc284;67;Lactobacillus ruminis ATCC 27782 ;;
1;;;;bc285;65;Lactobacillus sakei subsp. sakei 23K ;;
1;;;;bc286;77;Lactobacillus salivarius CECT 5713 ;;
;;;;bc287;77;Lactobacillus salivarius JCM1046 ;;
1;;;;bc288;61;Lactobacillus sanfranciscensis TMW 1.1304 ;;
1;;;;bc289;56;Lactobacillus sp. wkB8 ;;
1;;;;bc290;63;Lactococcus garvieae ATCC 49156 ;;
;;;;bc291;63;Lactococcus garvieae Lg2 ;;
1;;;;bc292;62;Lactococcus lactis AI06 ;;
1;;;;bc293;64;Lactococcus lactis subsp. cremoris A76 ;;
;;;;bc294;62;Lactococcus lactis subsp. cremoris KW2 ;;
;;;;bc295;64;Lactococcus lactis subsp. cremoris MG1363 ;;
;;;;bc296;64;Lactococcus lactis subsp. cremoris NZ9000 ;;
;;;;bc297;62;Lactococcus lactis subsp. cremoris SK11 ;;
;;;;bc298;61;Lactococcus lactis subsp. cremoris UC509.9 ;;
1;;;;bc299;66;Lactococcus lactis subsp. lactis CV56 ;;
;;;;bc300;63;Lactococcus lactis subsp. lactis Il1403 IL1403 ;;
;;;;bc301;65;Lactococcus lactis subsp. lactis IO-1 ;;
;;;;bc302;69;Lactococcus lactis subsp. lactis KF147 ;;
;;;;bc303;66;Lactococcus lactis subsp. lactis KLDS 4.0325 ;;
;;;;bc304;69;Lactococcus lactis subsp. lactis NCDO 2118 ;;
;;;;bc305;64;Lactococcus lactis subsp. lactis S0 ;;
1;;;;bc306;65;Leuconostoc carnosum JB16 ;;
1;;;;bc307;70;Leuconostoc citreum KM20 ;;
1;;;;bc308;67;Leuconostoc gelidum JB7 ;;
;;;;bc309;67;Leuconostoc gelidum subsp. gasicomitatum LMG 18811 ;;
1;;;;bc310;68;Leuconostoc kimchii IMSNU 11154 ;;
1;;;;bc311;69;Leuconostoc mesenteroides KFRI-MG ;;
;;;;bc312;71;Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ;;
;;;;bc313;71;Leuconostoc mesenteroides subsp. mesenteroides J18 ;;
1;;;;bc314;67;Leuconostoc sp. C2 ;;
1;;;;bc315;67;Listeria ivanovii subsp. ivanovii PAM 55 ;;
;;;;bc316;67;Listeria ivanovii subsp. ivanovii WSLC 3010 ;;
;;;;bc317;67;Listeria ivanovii subsp. londoniensis WSLC 30151 ;;
;;;;bc318;67;Listeria ivanovii subsp. londoniensis WSLC 30167 ;;
;;;;bc319;67;Listeria ivanovii WSLC3009 ;;
1;;;;bc320;67;Listeria monocytogenes 07PF0776 ;;
;;;;bc321;58;Listeria monocytogenes 08-5578 ;;
;;;;bc322;58;Listeria monocytogenes 08-5923 ;;
;;;;bc323;67;Listeria monocytogenes 10403S ;;
;;;;bc324;49;Listeria monocytogenes 6179 ;;
;;;;bc325;67;Listeria monocytogenes ATCC 19117 ;;
;;;;bc326;67;Listeria monocytogenes C1-387 ;;
;;;;bc327;67;Listeria monocytogenes CFSAN006122 ;;
;;666;1;bc328;67;Listeria monocytogenes EGD ;;
;;;;bc329;67;Listeria monocytogenes Finland 1998 Finland 1988 ;;
;;;;bc330;67;Listeria monocytogenes FSL R2-561 ;;
;;;;bc331;67;Listeria monocytogenes HCC23 ;;
;;;;bc332;65;Listeria monocytogenes IZSAM Lm hs2008 ;;
;;;;bc333;59;Listeria monocytogenes J0161 ;;
;;;;bc334;67;Listeria monocytogenes J1-220 ;;
;;;;bc335;67;Listeria monocytogenes J1776 ;;
;;;;bc336;58;Listeria monocytogenes J1816 ;;
;;;;bc337;67;Listeria monocytogenes J1817 ;;
;;;;bc338;67;Listeria monocytogenes J1926 ;;
;;;;bc339;67;Listeria monocytogenes J2-031 ;;
;;;;bc340;58;Listeria monocytogenes J2-064 ;;
;;;;bc341;67;Listeria monocytogenes J2-1091 ;;
;;;;bc342;67;Listeria monocytogenes L312 ;;
;;;;bc343;67;Listeria monocytogenes L99 ;;
;;;;bc344;67;Listeria monocytogenes La111 ;;
;;;;bc345;67;Listeria monocytogenes Lm60 ;;
;;;;bc346;67;Listeria monocytogenes M7 ;;
;;;;bc347;67;Listeria monocytogenes N1-011A ;;
;;;;bc348;67;Listeria monocytogenes N2306 ;;
;;;;bc349;67;Listeria monocytogenes N53-1 ;;
;;;;bc350;67;Listeria monocytogenes NE dc2014 ;;
;;;;bc351;67;Listeria monocytogenes NTSN ;;
;;;;bc352;67;Listeria monocytogenes R2-502 ;;
;;;;bc353;58;Listeria monocytogenes R479a ;;
;;;;bc354;67;Listeria monocytogenes serotype 4b str. CLIP 80459 Clip80459 ;;
;;;;bc355;67;Listeria monocytogenes serotype 4b str. F2365 4b F2365 ;;
;;;;bc356;67;Listeria monocytogenes serotype 4b str. LL195 ;;
;;;;bc357;67;Listeria monocytogenes serotype 7 str. SLCC2482 ;;
;;;;bc358;67;Listeria monocytogenes SLCC2372 ;;
;;;;bc359;67;Listeria monocytogenes SLCC2376 ;;
;;;;bc360;67;Listeria monocytogenes SLCC2378 ;;
;;;;bc361;65;Listeria monocytogenes SLCC2479 ;;
;;;;bc362;67;Listeria monocytogenes SLCC2540 ;;
;;;;bc363;67;Listeria monocytogenes SLCC2755 ;;
;;;;bc364;67;Listeria monocytogenes SLCC5850 ;;
;;;;bc365;68;Listeria monocytogenes SLCC7179 ;;
;;;;bc366;67;Listeria monocytogenes WSLC1001 ;;
;;;;bc367;67;Listeria monocytogenes WSLC1042 ;;
1;;;;bc368;67;Listeria seeligeri serovar 1/2b str. SLCC3954 ;;
1;;;;bc369;66;Listeria welshimeri serovar 6b str. SLCC5334 ;;
1;;;;bc370;107;Lysinibacillus fusiformis RB-21 ;;
1;;;;bc371;86;Lysinibacillus sphaericus C3-41 ;;
1;;;;bc372;98;Lysinibacillus varians GY32 ;;
1;;;;bc373;50;Macrococcus caseolyticus JCSC5402 ;;
1;;;;bc374;61;Melissococcus plutonius ATCC 35311 ;;
;;;;bc375;55;Melissococcus plutonius DAT561 ;;
1;;;;bc376;71;Oceanobacillus iheyensis HTE831 ;;
1;;;;bc377;45;Oenococcus kitaharae DSM 17330 ;;
1;;;;bc378;46;Oenococcus oeni PSU-1 ;;
1;;;;bc379;90;Paenibacillus beijingensis DSM 24997 ;;
1;;;;bc380;86;Paenibacillus borealis DSM 13188 ;;
1;;;;bc381;87;Paenibacillus durus DSM 1735 ;;
1;;;;bc382;89;Paenibacillus graminis DSM 15220 ;;
1;;;;bc383;81;Paenibacillus larvae subsp. larvae DSM 25430 ;;
1;pmq;14,14,14;1;bc384;175;Paenibacillus mucilaginosus 3016 ;;
;pmw;;;bc385;152;Paenibacillus mucilaginosus K02 ;;
;;;;bc386;113;Paenibacillus mucilaginosus KNP414 ;;
1;;;;bc387;88;Paenibacillus odorifer DSM 15391 ;;
1;;;;bc388;107;Paenibacillus polymyxa CF05 ;;
;;;;bc389;90;Paenibacillus polymyxa CR1 ;;
;;;;bc390;91;Paenibacillus polymyxa E681 ;;
;;;;bc391;111;Paenibacillus polymyxa M1 ;;
;;;;bc392;109;Paenibacillus polymyxa Sb3-1 ;;
;ppm;14,13,13;1;bc393;165;Paenibacillus polymyxa SC2 ;;
;;;;bc394;112;Paenibacillus polymyxa SQR-21 SQR21 ;;
1;;;;bc395;82;Paenibacillus sabinae T27 ;;
1;;;;bc396;86;Paenibacillus sp. FSL H7-0357 ;;
1;;;;bc397;93;Paenibacillus sp. FSL H7-0737 ;;
1;;;;bc398;87;Paenibacillus sp. FSL P4-0081 ;;
1;;;;bc399;90;Paenibacillus sp. FSL R5-0345 ;;
1;;;;bc400;90;Paenibacillus sp. FSL R5-0912 ;;
1;;;;bc401;85;Paenibacillus sp. FSL R7-0273 ;;
1;;;;bc402;85;Paenibacillus sp. FSL R7-0331 ;;
1;;;;bc403;90;Paenibacillus sp. IHBB 10380 ;;
1;;;;bc404;89;Paenibacillus sp. JDR-2 ;;
1;;;;bc405;73;Paenibacillus sp. Y412MC10 ;;
1;;;;bc406;88;Paenibacillus stellifer DSM 14472 ;;
1;;;;bc407;90;Paenibacillus terrae HPL-003 ;;
1;;;;bc408;57;Pediococcus claussenii ATCC BAA-344 ;;
1;;;;bc409;55;Pediococcus pentosaceus ATCC 25745 ;;
1;;;;bc410;51;Pediococcus pentosaceus SL4 ;;
;;;;bc411;60;Planococcus sp. PAMC 21323 ;;
1;;;;bc412;97;Solibacillus silvestris StLB046 ;;
1;;755;1;bc413;63;Staphylococcus aureus 04-02981 ;;
;;;;bc414;58;Staphylococcus aureus 08BA02176 ;;
;;;;bc415;56;Staphylococcus aureus 144 S7 ;;
;;;;bc416;62;Staphylococcus aureus 2395 USA500 ;;
;;;;bc417;54;Staphylococcus aureus 25b MRSA ;;
;;;;bc418;54;Staphylococcus aureus 26b MRSA ;;
;;;;bc419;54;Staphylococcus aureus 27b MRSA ;;
;;;;bc420;54;Staphylococcus aureus 29b MRSA ;;
;;;;bc421;54;Staphylococcus aureus 31b MRSA ;;
;;;;bc422;54;Staphylococcus aureus 33b ;;
;;;;bc423;61;Staphylococcus aureus 502A ;;
;;;;bc424;31;Staphylococcus aureus 71A S11 ;;
;;;;bc425;58;Staphylococcus aureus 79 S10 ;;
;;;;bc426;31;Staphylococcus aureus 93b S9 ;;
;;;;bc427;62;Staphylococcus aureus Bmb9393 ;;
;;;;bc428;61;Staphylococcus aureus CA-347 ;;
;;;;bc429;58;Staphylococcus aureus FCFHV36 ;;
;;;;bc430;61;Staphylococcus aureus ILRI Eymole1/1 ;;
;;;;bc431;58;Staphylococcus aureus M1 ;;
;;;;bc432;53;Staphylococcus aureus NRS 100 ;;
;;;;bc433;61;Staphylococcus aureus RF122 ;;
;;;;bc434;52;Staphylococcus aureus SA17 S6 ;;
1;;;;bc435;60;Staphylococcus aureus subsp. aureus 11819-97 ;;
;;;;bc436;53;Staphylococcus aureus subsp. aureus 55/2053 ;;
;;;;bc437;58;Staphylococcus aureus subsp. aureus 6850 ;;
;;;;bc438;58;Staphylococcus aureus subsp. aureus 71193 ;;
;;;;bc439;60;Staphylococcus aureus subsp. aureus ATCC 25923 ;;
;;;;bc440;58;Staphylococcus aureus subsp. aureus CN1 ;;
;;;;bc441;53;Staphylococcus aureus subsp. aureus COL ;;
;;;;bc442;61;Staphylococcus aureus subsp. aureus ECT-R 2 ;;
;;;;bc443;60;Staphylococcus aureus subsp. aureus ED133 ;;
;;;;bc444;62;Staphylococcus aureus subsp. aureus ED98 ;;
;;;;bc445;60;Staphylococcus aureus subsp. aureus FORC 001 ;;
;;;;bc446;62;Staphylococcus aureus subsp. aureus Gv69 ;;
;;;;bc447;59;Staphylococcus aureus subsp. aureus H-EMRSA-15 ;;
;;;;bc448;61;Staphylococcus aureus subsp. aureus HO 5096 0412 ;;
;;;;bc449;61;Staphylococcus aureus subsp. aureus JH1 ;;
;;;;bc450;60;Staphylococcus aureus subsp. aureus JH9 ;;
;;;;bc451;58;Staphylococcus aureus subsp. aureus JKD6159 ;;
;;;;bc452;61;Staphylococcus aureus subsp. aureus LGA251 ;;
;;;;bc453;60;Staphylococcus aureus subsp. aureus M013 ;;
;;;;bc454;60;Staphylococcus aureus subsp. aureus MRSA252 ;;
;;;;bc455;59;Staphylococcus aureus subsp. aureus MSHR1132 ;;
;;;;bc456;60;Staphylococcus aureus subsp. aureus MSSA476 ;;
;;;;bc457;61;Staphylococcus aureus subsp. aureus Mu3 ;;
;;;;bc458;61;Staphylococcus aureus subsp. aureus Mu50 ;;
;;;;bc459;61;Staphylococcus aureus subsp. aureus MW2 ;;
;;;;bc460;63;Staphylococcus aureus subsp. aureus N315 ;;
;;;;bc461;61;Staphylococcus aureus subsp. aureus NCTC 8325 ;;
;;;;bc462;61;Staphylococcus aureus subsp. aureus SA268 ;;
;;;;bc463;61;Staphylococcus aureus subsp. aureus SA40 ;;
;;;;bc464;60;Staphylococcus aureus subsp. aureus SA957 ;;
;;;;bc465;506;Staphylococcus aureus subsp. aureus ST228 ;;
;;;;bc466;61;Staphylococcus aureus subsp. aureus ST398 ;;
;;;;bc467;61;Staphylococcus aureus subsp. aureus ST772-MRSA-V DAR4145 ;;
;;;;bc468;84;Staphylococcus aureus subsp. aureus str. JKD6008 ;;
;;;;bc469;61;Staphylococcus aureus subsp. aureus str. Newman ;;
;;;;bc470;55;Staphylococcus aureus subsp. aureus T0131 ;;
;;;;bc471;61;Staphylococcus aureus subsp. aureus TCH60 ;;
;;;;bc472;62;Staphylococcus aureus subsp. aureus TW20 ;;
;;;;bc473;54;Staphylococcus aureus subsp. aureus USA300 FPR3757 ;;
;;;;bc474;61;Staphylococcus aureus subsp. aureus USA300 TCH1516 ;;
;;;;bc475;61;Staphylococcus aureus subsp. aureus VC40 ;;
;;;;bc476;62;Staphylococcus aureus subsp. aureus Z172 ;;
;;;;bc477;61;Staphylococcus aureus UA-S391 USA300 ;;
;;;;bc478;61;Staphylococcus aureus USA300-ISMMS1 ;;
;;;;bc479;59;Staphylococcus aureus XN108 ;;
1;;;;bc480;61;Staphylococcus carnosus subsp. carnosus TM300 ;;
1;;;;bc481;58;Staphylococcus epidermidis 949 S8 ;;
;;;;bc482;61;Staphylococcus epidermidis ATCC 12228 ;;
;;;;bc483;61;Staphylococcus epidermidis PM221 ;;
;;;;bc484;61;Staphylococcus epidermidis RP62A ;;
;;;;bc485;60;Staphylococcus epidermidis SEI ;;
1;;;;bc486;62;Staphylococcus haemolyticus JCSC1435 ;;
;;;;bc487;62;Staphylococcus haemolyticus Sh29/312/L2 ;;
1;;;;bc488;59;Staphylococcus hyicus ATCC 11249 ;;
1;;;;bc489;61;Staphylococcus lugdunensis HKU09-01 ;;
;;;;bc490;56;Staphylococcus lugdunensis N920143 ;;
1;;;;bc491;49;Staphylococcus pasteuri SP1 ;;
1;;;;bc492;68;Staphylococcus pseudintermedius E140 ;;
;;;;bc493;58;Staphylococcus pseudintermedius ED99 ;;
;;;;bc494;59;Staphylococcus pseudintermedius HKU10-03 ;;
1;;;;bc495;60;Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ;;
1;;;;bc496;59;Staphylococcus warneri SG1 ;;
1;;;;bc497;55;Staphylococcus xylosus HKUOPL8 ;;
;;;;bc498;59;Staphylococcus xylosus SMQ-121 ;;
1;;777;1;bc499;80;Streptococcus agalactiae 09mas018883 ;;
;;;;bc500;72;Streptococcus agalactiae 138P ;;
;;;;bc501;71;Streptococcus agalactiae 138spar ;;
;;;;bc502;72;Streptococcus agalactiae 2-22 ;;
;;;;bc503;80;Streptococcus agalactiae 2603V/R ;;
;;;;bc504;80;Streptococcus agalactiae A909 ;;
;;;;bc505;80;Streptococcus agalactiae CNCTC 10/84 ;;
;;;;bc506;80;Streptococcus agalactiae COH1 ;;
;;;;bc507;82;Streptococcus agalactiae GBS1-NY ;;
;;;;bc508;80;Streptococcus agalactiae GBS2-NM ;;
;;;;bc509;80;Streptococcus agalactiae GBS6 ;;
;;;;bc510;77;Streptococcus agalactiae GD201008-001 ;;
;;;;bc511;81;Streptococcus agalactiae ILRI005 ;;
;;;;bc512;79;Streptococcus agalactiae ILRI112 ;;
;;;;bc513;81;Streptococcus agalactiae NGBS061 ;;
;;;;bc514;81;Streptococcus agalactiae NGBS572 ;;
;;;;bc515;80;Streptococcus agalactiae SA20-06 ;;
1;;;;bc516;58;Streptococcus anginosus C1051 ;;
;;;;bc517;58;Streptococcus anginosus C238 ;;
;;;;bc518;59;Streptococcus anginosus SA1 ;;
;;;;bc519;67;Streptococcus anginosus subsp. whileyi MAS624 ;;
1;;;;bc520;59;Streptococcus constellatus subsp. pharyngis C1050 ;;
;;;;bc521;59;Streptococcus constellatus subsp. pharyngis C232 ;;
;;;;bc522;59;Streptococcus constellatus subsp. pharyngis C818 ;;
1;;;;bc523;57;Streptococcus dysgalactiae subsp. equisimilis 167 ;;
;;;;bc524;57;Streptococcus dysgalactiae subsp. equisimilis AC-2713 ;;
;;;;bc525;57;Streptococcus dysgalactiae subsp. equisimilis ATCC 12394 ;;
;;;;bc526;57;Streptococcus dysgalactiae subsp. equisimilis GGS 124 ;;
;;;;bc527;57;Streptococcus dysgalactiae subsp. equisimilis RE378 ;;
1;;;;bc528;66;Streptococcus equi subsp. equi 4047 ;;
;;;;bc529;57;Streptococcus equi subsp. zooepidemicus ATCC 35246 ;;
;;;;bc530;51;Streptococcus equi subsp. zooepidemicus CY ;;
;;;;bc531;57;Streptococcus equi subsp. zooepidemicus H70 ;;
1;;;;bc532;57;Streptococcus equi subsp. zooepidemicus MGCS10565 ATCC BAA1716 ;;
;;;;bc533;61;Streptococcus gallolyticus subsp. gallolyticus ATCC 43143 ;;
;;;;bc534;81;Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069 ;;
;;;;bc535;72;Streptococcus gallolyticus UCN34 ;;
1;;;;bc536;60;Streptococcus gordonii str. Challis substr. CH1 ;;
1;;;;bc537;69;Streptococcus infantarius subsp. infantarius CJ18 ;;
1;;;;bc538;45;Streptococcus iniae ISET0901 ;;
;;;;bc539;45;Streptococcus iniae ISNO ;;
;;;;bc540;47;Streptococcus iniae SF1 ;;
;;;;bc541;58;Streptococcus iniae YSFST01-82 ;;
1;;;;bc542;60;Streptococcus intermedius B196 ;;
;;;;bc543;60;Streptococcus intermedius C270 ;;
;;;;bc544;67;Streptococcus intermedius JTH08 ;;
1;;;;bc545;60;Streptococcus lutetiensis 033 ;;
1;;;;bc546;71;Streptococcus macedonicus ACA-DC 198 ;;
1;;;;bc547;61;Streptococcus mitis B6 ;;
1;;;;bc548;65;Streptococcus mutans GS-5 ;;
;;;;bc549;65;Streptococcus mutans LJ23 ;;
;;;;bc550;65;Streptococcus mutans NN2025 ;;
;;;;bc551;65;Streptococcus mutans UA159 ;;
;;;;bc552;65;Streptococcus mutans UA159-FR ;;
1;;;;bc553;51;Streptococcus oligofermentans AS 1.3089 ;;
1;;;;bc554;61;Streptococcus oralis Uo5 ;;
1;;;;bc555;62;Streptococcus parasanguinis ATCC 15912 ;;
;;;;bc556;62;Streptococcus parasanguinis FW213 ;;
1;;;;bc557;60;Streptococcus parauberis KCTC 11537 ;;
;;;;bc558;58;Streptococcus parauberis NCFD 2020 ;;
1;;;;bc559;60;Streptococcus pasteurianus ATCC 43144 ;;
1;;;;bc560;60;Streptococcus pneumoniae 670-6B ;;
;;;;bc561;59;Streptococcus pneumoniae 70585 ;;
;;;;bc562;59;Streptococcus pneumoniae A026 ;;
;;;;bc563;58;Streptococcus pneumoniae AP200 ;;
;;;;bc564;58;Streptococcus pneumoniae ATCC 700669 ;;
;;;;bc565;58;Streptococcus pneumoniae CGSP14 ;;
;;;;bc566;59;Streptococcus pneumoniae D39 ;;
;;;;bc567;59;Streptococcus pneumoniae G54 ;;
;;;;bc568;58;Streptococcus pneumoniae gamPNI0373 ;;
;;;;bc569;59;Streptococcus pneumoniae Hungary19A-6 ;;
;;;;bc570;59;Streptococcus pneumoniae INV104 ;;
;;;;bc571;59;Streptococcus pneumoniae INV200 ;;
;;;;bc572;59;Streptococcus pneumoniae JJA ;;
;;;;bc573;60;Streptococcus pneumoniae NT 110 58 ;;
;;;;bc574;59;Streptococcus pneumoniae OXC141 ;;
;;;;bc575;59;Streptococcus pneumoniae P1031 ;;
;;;;bc576;54;Streptococcus pneumoniae PCS8235 ;;
;;;;bc577;59;Streptococcus pneumoniae R6 ;;
;;;;bc578;59;Streptococcus pneumoniae SPN032672 ;;
;;;;bc579;59;Streptococcus pneumoniae SPN033038 ;;
;;;;bc580;59;Streptococcus pneumoniae SPN034156 SNP034156 ;;
;;;;bc581;59;Streptococcus pneumoniae SPN034183 SNP034183 ;;
;;;;bc582;59;Streptococcus pneumoniae SPN994038 SNP994038 ;;
;;;;bc583;59;Streptococcus pneumoniae SPN994039 SNP994039 ;;
;;;;bc584;59;Streptococcus pneumoniae SPNA45 ;;
;;;;bc585;59;Streptococcus pneumoniae ST556 ;;
;;;;bc586;59;Streptococcus pneumoniae Taiwan19F-14 ;;
;;;;bc587;59;Streptococcus pneumoniae TCH8431/19A ;;
;;;;bc588;59;Streptococcus pneumoniae TIGR4 ;;
;;;;bc589;59;Streptococcus pneumoniae TIGR4 ATCC BAA-334 ;;
1;;;;bc590;42;Streptococcus pseudopneumoniae IS7493 ;;
1;;;;bc591;67;Streptococcus pyogenes 1E1 ;;
;;;;bc592;67;Streptococcus pyogenes 7F7 ;;
;;;;bc593;67;Streptococcus pyogenes A20 ;;
;;;;bc594;67;Streptococcus pyogenes Alab49 ;;
;;;;bc595;68;Streptococcus pyogenes ATCC 19615 ;;
;;;;bc596;69;Streptococcus pyogenes HKU QMH11M0907901 ;;
;;;;bc597;69;Streptococcus pyogenes HKU360 ;;
;;;;bc598;67;Streptococcus pyogenes HSC5 ;;
;;;;bc599;57;Streptococcus pyogenes M1 476 ;;
;2*60;;;bc600;120;Streptococcus pyogenes M1 GAS SF370 ;;
;;;;bc601;57;Streptococcus pyogenes M23ND ;;
;;;;bc602;67;Streptococcus pyogenes MGAS10270 ;;
;;;;bc603;67;Streptococcus pyogenes MGAS10394 ;;
;;;;bc604;67;Streptococcus pyogenes MGAS10750 ;;
;;;;bc605;57;Streptococcus pyogenes MGAS15252 ;;
;;;;bc606;57;Streptococcus pyogenes MGAS1882 ;;
;;;;bc607;68;Streptococcus pyogenes MGAS2096 ;;
;;;;bc608;67;Streptococcus pyogenes MGAS315 ;;
;;;;bc609;67;Streptococcus pyogenes MGAS5005 ;;
;;;;bc610;67;Streptococcus pyogenes MGAS6180 ;;
;;;;bc611;68;Streptococcus pyogenes MGAS8232 ;;
;;;;bc612;68;Streptococcus pyogenes MGAS9429 ;;
;;;;bc613;67;Streptococcus pyogenes NZ131 ATCC BAA-1633 ;;
;;;;bc614;57;Streptococcus pyogenes SSI-1 ;;
;;;;bc615;66;Streptococcus pyogenes STAB1102 ;;
;;;;bc616;67;Streptococcus pyogenes STAB901 ;;
;;;;bc617;59;Streptococcus pyogenes STAB902 ;;
;;;;bc618;66;Streptococcus pyogenes str. Manfredo ;;
1;;;;bc619;68;Streptococcus salivarius 57.I ;;
;;;;bc620;68;Streptococcus salivarius CCHSS3 ;;
;;;;bc621;68;Streptococcus salivarius JIM8777 ;;
;;;;bc622;68;Streptococcus salivarius NCTC 8618 ;;
1;;;;bc623;61;Streptococcus sanguinis SK36 ;;
1;;;;bc624;60;Streptococcus sp. I-G2 ;;
1;;;;bc625;86;Streptococcus sp. I-P16 ;;
1;;;;bc626;69;Streptococcus sp. VT 162 ;;
1;;;;bc627;56;Streptococcus suis 05HAS68 ;;
;;;;bc628;56;Streptococcus suis 05ZYH33 ;;
;;;;bc629;59;Streptococcus suis 6407 ;;
;;;;bc630;56;Streptococcus suis 98HAH33 ;;
;;;;bc631;56;Streptococcus suis A7 ;;
;;;;bc632;56;Streptococcus suis BM407 ;;
;;;;bc633;56;Streptococcus suis D12 ;;
;;;;bc634;54;Streptococcus suis D9 ;;
;;;;bc635;49;Streptococcus suis GZ1 ;;
;;;;bc636;62;Streptococcus suis JS14 ;;
;;;;bc637;56;Streptococcus suis P1/7 ;;
;;;;bc638;56;Streptococcus suis S735 ;;
;;;;bc639;56;Streptococcus suis SC070731 ;;
;;;;bc640;56;Streptococcus suis SC84 ;;
;;;;bc641;59;Streptococcus suis SS12 ;;
;;;;bc642;58;Streptococcus suis ST1 ;;
;;;;bc643;56;Streptococcus suis ST3 ;;
;;;;bc644;56;Streptococcus suis T15 ;;
;;;;bc645;56;Streptococcus suis TL13 ;;
;;;;bc646;56;Streptococcus suis YB51 ;;
1;;;;bc647;55;Streptococcus thermophilus ASCC 1275 ;;
;;;;bc648;67;Streptococcus thermophilus CNRZ1066 ;;
;;;;bc649;67;Streptococcus thermophilus JIM 8232 ;;
;;;;bc650;67;Streptococcus thermophilus LMD-9 ;;
;;;;bc651;67;Streptococcus thermophilus LMG 18311 ;;
;;;;bc652;57;Streptococcus thermophilus MN-ZLW-002 ;;
;;;;bc653;57;Streptococcus thermophilus ND03 ;;
;;;;bc654;67;Streptococcus thermophilus SMQ-301 ;;
1;;555;1;bc655;59;Streptococcus uberis 0140J ;;
1;;888;1;bc656;56;Terribacillus aidingensis MP602 ;;
1;;555;1;bc657;62;Tetragenococcus halophilus NBRC 12172 ;;
1;;555;1;bc658;61;Thermobacillus composti KWC4 ;;
1;;777;1;bc659;54;Virgibacillus sp. SK37 ;;
1;;766;1;bc660;75;Weissella ceti WS08 ;;
;;;;bc661;71;Weissella ceti WS105 ;;
;;;;bc662;77;Weissella ceti WS74 ;;
1;;;;bc663;56;Weissella koreensis KACC 15510 ;;
1;;;;en001;55;Erysipelothrix rhusiopathiae str. Fujisawa ;;
;;433;1;en002;53;Erysipelothrix rhusiopathiae SY1027 ;;
1;;111;1;en003;40;Faecalitalea cylindroides T2-87 ;;
1;;777;1;en004;77;Lactobacillus salivarius UCC118 ;;
1;;666;1;en005;60;Acidaminococcus fermentans DSM 20731 ;;
1;;333;1;en006;53;Acidaminococcus intestini RyC-MR95 ;;
1;;;;en007;51;Megamonas hypermegale ART12/1 ;;
1;;777;1;en008;65;Megasphaera elsdenii DSM 20460 ;;
1;;10,9,9;1;en009;77;Pelosinus fermentans JBW45 ;;
1;;16,15,14;1;en010;99;Pelosinus sp. UFO1 ;;
1;;777;1;en011;73;Selenomonas ruminantium subsp. lactilytica TAM6421 ;;
1;;444;1;en012;55;Selenomonas sputigena ATCC 35185 ;;
1;;444;1;en013;49;Veillonella parvula DSM 2008 ;;
1;;655;1;cd001;62;Acetobacterium woodii DSM 1030 ;;
1;;555;1;cd002;67;Acetohalobium arabaticum DSM 5501 ;;
1;;11,10,10;1;cd003;110;Alkaliphilus metalliredigens QYMF ;;
1;;;;cd004;88;Alkaliphilus oremlandii OhILAs ;;
1;;;;cd005;51;Ammonifex degensii KC4 ;;
1;;;;cd006;48;Anaerococcus prevotii DSM 20548 ;;
1;;;;cd007;27;butyrate-producing bacterium SM4/1 ;;
;;;;cd008;57;butyrate-producing bacterium SS3/4 ;;
;;;;cd009;53;butyrate-producing bacterium SSC/2 ;;
1;;;;cd010;60;Butyrivibrio fibrisolvens 16/4 ;;
1;;666;1;cd011;51;Butyrivibrio proteoclasticus B316 ;;
1;;;;cd012;56;Caldanaerobacter subterraneus subsp. tengcongensis MB4 ;;
1;;333;1;cd013;52;Caldicellulosiruptor bescii DSM 6725 ;;
1;;;;cd014;50;Caldicellulosiruptor hydrothermalis 108 ;;
1;;;;cd015;51;Caldicellulosiruptor kristjanssonii I77R1B ;;
1;;;;cd016;48;Caldicellulosiruptor kronotskyensis 2002 ;;
1;;;;cd017;47;Caldicellulosiruptor lactoaceticus 6A ;;
1;;;;cd018;46;Caldicellulosiruptor obsidiansis OB47 ;;
1;;;;cd019;49;Caldicellulosiruptor owensensis OL ;;
1;;;;cd020;48;Caldicellulosiruptor saccharolyticus DSM 8903 ;;
1;;;;cd021;41;Candidatus Arthromitus sp. SFB-mouse-Japan ;;
;;;;cd022;40;Candidatus Arthromitus sp. SFB-mouse-NL ;;
;;;;cd023;40;Candidatus Arthromitus sp. SFB-mouse-Yit ;;
1;;;;cd024;39;Candidatus Arthromitus sp. SFB-rat-Yit ;;
1;;;;cd025;47;Candidatus Desulforudis audaxviator MP104C ;;
1;;;;cd026;53;Carboxydothermus hydrogenoformans Z-2901 ;;
1;;;;cd027;75;Clostridium acetobutylicum ATCC 824 ;;
;;;;cd028;75;Clostridium acetobutylicum DSM 1731 ;;
;;;;cd029;77;Clostridium acetobutylicum EA 2018 ;;
1;;;;cd030;69;Clostridium autoethanogenum DSM 10061 ;;
1;;;;cd031;79;Clostridium baratii str. Sullivan ;;
1;;17,16,16;1;cd032;70;Clostridium beijerinckii 59B ;;
;;;;cd033;95;Clostridium beijerinckii ATCC 35702 SA-1 ;;
;;;;cd034;95;Clostridium beijerinckii NCIMB 8052 ;;
1;;;;cd035;84;Clostridium botulinum 111 ;;
;;;;cd036;70;Clostridium botulinum 202F ;;
;;;;cd037;81;Clostridium botulinum A str. ATCC 19397 ;;
;;;;cd038;80;Clostridium botulinum A str. ATCC 3502 ;;
;;;;cd039;81;Clostridium botulinum A str. Hall ;;
;;;;cd040;81;Clostridium botulinum A2 str. Kyoto ;;
;;;;cd041;81;Clostridium botulinum A3 str. Loch Maree ;;
;;;;cd042;77;Clostridium botulinum B str. Eklund 17B NRP ;;
;;;;cd043;82;Clostridium botulinum B1 str. Okra ;;
;;;;cd044;83;Clostridium botulinum Ba4 str. 657 ;;
;;10,10,10;1;cd045;87;Clostridium botulinum BKT015925 ;;
;;;;cd046;73;Clostridium botulinum CDC 1436 ;;
;;554;1;cd047;53;Clostridium botulinum CDC 297 ;;
;;;;cd048;79;Clostridium botulinum E3 str. Alaska E43 ;;
;;;;cd049;72;Clostridium botulinum F str. 230613 ;;
;;;;cd050;82;Clostridium botulinum F str. Langeland ;;
;;;;cd051;72;Clostridium botulinum H04402 065 ;;
;;;;cd052;79;Clostridium botulinum NCTC 8266 ;;
;;;;cd053;79;Clostridium botulinum NCTC 8550 ;;
;;;;cd054;76;Clostridium botulinum Prevot 594 ;;
1;;888;1;cd055;65;Clostridium cellulolyticum H10 ATCC 35319 ;;
1;;;;cd056;60;Clostridium cellulosi ;;
1;;10,9,9;1;cd057;80;Clostridium cellulovorans 743B ;;
1;;;;cd058;50;Clostridium cf. saccharolyticum K10 ;;
1;;666;1;cd059;61;Clostridium clariflavum DSM 19732 ;;
1;;677;1;cd060;63;Clostridium kluyveri DSM 555 ;;
;;;;cd061;63;Clostridium kluyveri NBRC 12016 ;;
1;;999;1;cd062;74;Clostridium ljungdahlii DSM 13528 ;;
1;;10,10,10;1;cd063;81;Clostridium novyi NT ;;
1;;999;1;cd064;77;Clostridium pasteurianum BC1 ;;
;2*81;;;cd065;162;Clostridium pasteurianum DSM 525 ATCC 6013 ;;
1;;;;cd066;93;Clostridium perfringens ATCC 13124 ;;
;;10,10,10;1;cd067;96;Clostridium perfringens str. 13 ;;
1;;;;cd068;85;Clostridium saccharobutylicum DSM 13864 ;;
;;;;cd069;68;Clostridium saccharolyticum WM1 ;;
1;;;;cd070;71;Clostridium saccharoperbutylacetonicum N1-4HMT ;;
1;;999;1;cd071;66;Clostridium scatologenes ATCC 25775 ;;
1;;;;cd072;84;Clostridium sordellii ATCC9714 ;;
;;;;cd073;85;Clostridium sordellii JGS6382 ;;
1;;;;cd074;62;Clostridium sp. BNL1100 ;;
1;;;;cd075;53;Clostridium sp. SY8519 ;;
1;;;;cd076;81;Clostridium sporogenes NCIMB 10696 ;;
1;2*49;;;cd077;98;Clostridium stercorarium subsp. stercorarium DSM 8532 ;;
1;;;;cd078;60;Clostridium sticklandii DSM 519 ;;
1;;546;1;cd079;53;Clostridium tetani 12124569 ;;
;;;;cd080;54;Clostridium tetani E88 Massachusetts substr. E88 ;;
1;;;;cd081;46;Coprococcus catus GD/7 ;;
1;;;;cd082;28;Coprococcus sp. ART55/1 ;;
1;;222;1;cd083;48;Coprothermobacter proteolyticus DSM 5265 ;;
1;;444;1;cd084;54;Dehalobacter restrictus DSM 9455 PER-K23 ;;
1;;;;cd085;53;Dehalobacter sp. CF ;;
1;;;;cd086;53;Dehalobacter sp. DCA ;;
1;;;;cd087;76;Desulfitobacterium dehalogenans ATCC 51507 ;;
1;;;;cd088;73;Desulfitobacterium dichloroeliminans LMG P-21439 ;;
1;;555;1;cd089;76;Desulfitobacterium hafniense DCB-2 ;;
;;;;cd090;63;Desulfitobacterium hafniense Y51 ;;
1;;;;cd091;73;Desulfitobacterium metallireducens DSM 15288 853-15A ;;
1;;898;1;cd092;68;Desulfosporosinus acidiphilus SJ4 ;;
1;;;;cd093;82;Desulfosporosinus meridiei DSM 13257 ;;
1;;;;cd094;77;Desulfosporosinus orientis DSM 765 ;;
1;;9,10,10;1;cd095;70;Desulfotomaculum acetoxidans DSM 771 ;;
1;;;;cd096;66;Desulfotomaculum carboxydivorans CO-1-SRB ;;
1;;;;cd097;67;Desulfotomaculum gibsoniae DSM 7213 ;;
1;;;;cd098;49;Desulfotomaculum kuznetsovii DSM 6115 ;;
1;;;;cd099;74;Desulfotomaculum reducens MI-1 ;;
1;;;;cd100;67;Desulfotomaculum ruminis DSM 2154 ;;
1;;;;cd101;60;Ethanoligenens harbinense YUAN-3 ;;
1;;777;1;cd102;69;Eubacterium acidaminophilum DSM 3953 ;;
1;;;;cd103;47;Eubacterium eligens ATCC 27750 ;;
1;;;;cd104;60;Eubacterium limosum KIST612 ;;
1;;;;cd105;60;Eubacterium rectale ATCC 33656 ;;
;;;;cd106;44;Eubacterium rectale DSM 17629 ;;
;;;;cd107;53;Eubacterium rectale M104/1 ;;
1;;;;cd108;50;Eubacterium siraeum 70/3 ;;
;;;;cd109;38;Eubacterium siraeum V10Sc8a ;;
1;;;;cd110;60;Faecalibacterium prausnitzii L2-6 L2/6 ;;
1;;;;cd111;71;Faecalibacterium prausnitzii SL3/3 ;;
1;;444;1;cd112;48;Filifactor alocis ATCC 35896 ;;
1;;444;1;cd113;48;Finegoldia magna ATCC 29328 ;;
1;;444;1;cd114;59;Halanaerobium hydrogeniformans ;;
1;;;;cd115;55;Halanaerobium praevalens DSM 2228 ;;
1;;555;1;cd116;78;Halobacteroides halobius DSM 5150 ;;
1;;;;cd117;57;Halothermothrix orenii H 168 DSM 9562 ;;
1;hmo;10,10,10;1;cd118;109;Heliobacterium modesticaldum Ice1 ATCC 51547 ;;
1;;;;cd119;61;Lachnoclostridium phytofermentans ISDg ;;
1;;;;cd120;46;Mageeibacillus indolicus UPII9-5 ;;
1;;;;cd121;51;Mahella australiensis 50-1 BON ;;
1;;;;cd122;52;Moorella thermoacetica ATCC 39073 ;;
1;;;;cd123;52;Natranaerobius thermophilus JW/NM-WN-LF ;;
1;;;;cd124;72;Oscillibacter valericigenes Sjm18-20 ;;
1;;;;cd125;42;Parvimonas micra KCOM 1535 ChDC B708 ;;
1;;;;cd126;53;Pelotomaculum thermopropionicum SI ;;
1;;;;cd127;67;Peptoclostridium difficile 2007855 ;;
;;;;cd128;89;Peptoclostridium difficile 630 ;;
;;;;cd129;91;Peptoclostridium difficile 630 cultivar NCTC 13307 /strain ;;
;;;;cd130;91;Peptoclostridium difficile 630Derm ;;
;;;;cd131;80;Peptoclostridium difficile BI1 ;;
;;;;cd132;22;Peptoclostridium difficile BI9 ;;
;;9,10,10;1;cd133;85;Peptoclostridium difficile CD196 ;;
;;;;cd134;66;Peptoclostridium difficile CF5 ;;
;;;;cd135;88;Peptoclostridium difficile M120 ;;
;;14,16,13;1;cd136;110;Peptoclostridium difficile M68 ;;
;;;;cd137;67;Peptoclostridium difficile R20291 ;;
1;;;;cd138;53;Peptoniphilus sp. 1-1 ;;
1;;;;cd139;58;Roseburia hominis A2-183 ;;
1;;;;cd140;52;Roseburia intestinalis M50/1 ;;
;;;;cd141;66;Roseburia intestinalis XB6B4 ;;
1;;;;cd142;57;Ruminiclostridium thermocellum ATCC 27405 ;;
;;;;cd143;57;Ruminiclostridium thermocellum DSM 1313 ;;
1;;;;cd144;79;Ruminococcus albus 7 DSM 20455 ;;
1;;;;cd145;57;Ruminococcus bicirculans 80/3 ;;
1;;;;cd146;36;Ruminococcus bromii L2-63 ;;
1;;;;cd147;45;Ruminococcus champanellensis 18P13 JCM 17042 ;;
1;;;;cd148;46;Ruminococcus obeum A2-162 ;;
1;;;;cd149;47;Ruminococcus sp. SR1/5 ;;
1;;;;cd150;47;Ruminococcus torques L2-14 ;;
1;;;;cd151;57;Sulfobacillus acidophilus DSM 10332 ;;
;;;;cd152;56;Sulfobacillus acidophilus TPY ;;
1;;666;1;cd153;98;Symbiobacterium thermophilum IAM 14863 IAM14863 ;;
1;;444;1;cd154;55;Syntrophobotulus glycolicus DSM 8271 ;;
1;;533;1;cd155;48;Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 ;;
1;;222;1;cd156;47;Syntrophothermus lipocalidus DSM 12680 ;;
1;2*53;222;1;cd157;106;Tepidanaerobacter acetatoxydans Re1 ;;
1;;333;1;cd158;53;Thermacetogenium phaeum DSM 12270 ;;
1;;222;1;cd159;51;Thermaerobacter marianensis DSM 12885 ;;
1;;333;1;cd160;53;Thermincola potens JR ;;
1;;444;1;cd161;57;Thermoanaerobacter brockii subsp. finnii Ako-1 ;;
1;;;;cd162;56;Thermoanaerobacter italicus Ab9 ;;
1;;;;cd163;58;Thermoanaerobacter kivui DSM 2030 ;;
1;;;;cd164;59;Thermoanaerobacter mathranii subsp. mathranii str. A3 ;;
1;;;;cd165;57;Thermoanaerobacter pseudethanolicus ATCC 33223 39E ;;
1;;;;cd166;56;Thermoanaerobacter sp. X513 ;;
1;;;;cd167;54;Thermoanaerobacter sp. X514 ;;
1;;;;cd168;57;Thermoanaerobacter wiegelii Rt8.B1 ;;
1;;;;cd169;58;Thermoanaerobacterium saccharolyticum JW/SL-YS485 ;;
1;;555;1;cd170;58;Thermoanaerobacterium thermosaccharolyticum DSM 571 ;;
;;;;cd171;58;Thermoanaerobacterium thermosaccharolyticum M0795 ;;
1;;;;cd172;58;Thermoanaerobacterium xylanolyticum LX-11 ;;
1;;222;1;cd173;48;Thermodesulfobium narugense DSM 14796 ;;
1;;333;1;cd174;53;Thermosediminibacter oceani DSM 16646 ;;

génomes bacilli[modifier | modifier le wikicode]

60;Aerococcus urinae ACS-120-V-Col10a ;;;;56;Amphibacillus xylanus NBRC 15112 ;;;;95;Bacillus amyloliquefaciens IT-45 ;;;;;;;;;89;Bacillus amyloliquefaciens subsp. amyloliquefaciens KHG19 ;;;;;;89;Bacillus amyloliquefaciens subsp. plantarum AS43.3 ;;;;;;70;Bacillus amyloliquefaciens TA208 ;;;;112;Bacillus anthracis 2002013094 ;;;;;;;;;94;Bacillus anthracis BA1015 ;;;;;;;;;75;Bacillus atrophaeus 1942 ;;;;80;Bacillus atrophaeus subsp. globigii BSS ;;;;95;Bacillus bombysepticus str. Wang ;;;;;;;;83;Bacillus cellulosilyticus DSM 2522 ;;;;;;118;Bacillus cereus Al Hakam ;;;;;;;95;Bacillus cereus Q1 ;;;;;;;;;107;Bacillus cytotoxicus NVH 391-98 ;;;;;;;;;;;;123;Bacillus sp. X12014 ;;;;;;;;;;;;;;;;;;;86;Bacillus subtilis subsp. subtilis str. 168 ;;;;;;;;142;Bacillus thuringiensis Bt407 ;;;;;;;;;78;Bacillus thuringiensis MC28 ;;;;;;;;98;Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ;;;;67;Listeria monocytogenes EGD ;;;;;;175;Paenibacillus mucilaginosus 3016 ;;;;;;;;;;165;Paenibacillus polymyxa SC2 ;;;;;;63;Staphylococcus aureus 04-02981 ;;;;;80;Streptococcus agalactiae 09mas018883 ;;;;59;Streptococcus uberis 0140J ;;;;;;;;56;Terribacillus aidingensis MP602 ;;;;;62;Tetragenococcus halophilus NBRC 12172 ;;;;;;;;61;Thermobacillus composti KWC4 ;;;;;;;;54;Virgibacillus sp. SK37 ;;;;;75;Weissella ceti WS08 ;;;;;
bc001;444;Chromosome ;;;bc004;666;Chromosome ;;;bc008;10,10,10;Chromosome;;;;;;;;bc014;10,8,10;Chromosome;16s°;court;;;bc015;10,9,10;Chromosome;;;;;bc025;666;Chromosome;;;bc029;11,11,11;Chromosome;;;;;;;;bc034;10,10,10;Chromosome;;;;;;;;bc063;777;Chromosome;;;bc065;888;Chromosome;;;bc066;13,13,13;Chromosome;;;;;;;bc067;10,10,10;Chromosome;;;;;bc074;14,14,14;Chromosome;;;;;;bc090;13,13,13;Chromosome;;;;;;;;bc097;13,13,13;Chromosome;;;;;;;;;;;bc125;12,12,12;Chromosome;;;;;;;;;;;;;;;;;;bc147;10,10,10;Chromosome;;;;;;;bc158;14,14,14;Chromosome;;;;;;;;bc165;15,15,15;Chromosome;;;;;;;bc244;999;Chromosome;;;bc328;666;Chromosome;;;;;bc384;14,14,14;Chromosome;;;;;;;;;bc393;14,13,13;Chromosome;;;;;bc413;755;Chromosome;;;;bc499;777;Chromosome;;;bc655;555;Chromosome ;;;;;;;bc656;888;Chromosome;;;;bc657;555;Chromosome;;;;;;;bc658;555;Chromosome;;;;;;;bc659;777;Chromosome;;;;bc660;766;Chromosome;;;;
16s23s5s;;;;;2*16s23s5s;;;;;2*16atcgca235;;;;;;;;;;4*16s23s5s;;;;;;;3*16s23s5s;;;;;;;2*16s23s5s;;;;;4*16s23s5s;;;;;;;;;;5*16s23s5s;;;;;;;;;;16s23s5s;;;;;3*16s23s5s;;;;;8*16s23s5s;;;;;;;;;7*16s23s5s;;;;;;;5*16s23s5s;;;;;;;;7*16s23s5s;;;;;;;;;;5*16s23s5s;;;;;;;;;;;;;16s23s5s;;;;;;;;;;;;;;;;;;;;3*16s23s5s   encadrés;;;;;;;;;5*16s23s5s;;;;;;;;;;10*16s23s5s;;;;;;;;;4*16atcgca235;;;;;2*16s23s5s dont un encadré ici;;;;;;;5*16s23s5s;;;;;;;;;;;7*16s23s5s;;;;;;;16atcgca235;;;;;;2*16-gca-235-aac;;;;;2*16-gca-235-aac-cgt;;;dir : direct;;;;;;4*16s23s5s;;;;;;16s23s5s;;;;;;;;;16s23s5s;;;;;;;;;4*16s23s5s;;;;;;16atcgca235;;;;;;
16atcgca235-aac-acc;;;;;16atcgca235-aac-acc;;;;;2*16s23s5s;;;;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;;;16atcgca235;;;;;;;16atcgca235;;;;;2*16atcgca235;;;;;;;;;;16atcgca235-15aas;;;;;;;;;;2*16atcgca235;;;;;16s23s5s-atgf-gac;;;;;4*16s23s5s-22,19,15,8 aas;;;;;;;;;16atcgca235-9aas;;;;;;;16s23s5s-atgf-gac;;;;;;;;16atcgca235;;;;;;;;;;2*16atcgca235;;;;;;;;;;;;;2*16atcgca235;;;;;;;;;;;;;;;;;;;;2*16atcgca235;;;;;;;;;2*16atcgca235;;;;;;;;;;16s23s5s-gaa;;;;;;;;;16atcgca235-5aas;;;;;2*16s23s5s-21,9;;;;;;;9*16s23s5s-23  22  19  17  16  12  11  9  9;;;;;;;;;;;16s-gca-235;;;;;;;16atcgca-235-26aas;;;;;;5*16-gca-235-17,15,12,9,4 aas;;;;;16s-gca-235-17, 12, 7 aas;;;comp : complement;;;;;;16s23s5s-aac-acc;;;;;;16s23s5s-aac;;;;;;;;;16s-5s-23s-atgf-ctc-ctg;;;;;;;;;16atcgca235-aac-acc;;;;;;16s23s5s;;;;;;
16atcgca235-22aas;;;;;16s23s5s-atgf-gac;;;;;5*16s23s5s-21,16,9,9,5 aas;;;;;;;;;;16s°atcgca235;;;;;;;16s23s5s-21,16,9,7 aas  ;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;4*16s23s5s-20,19,11,9 aas;;;;;;;;;;3*16s23s5s-22,20,9aas;;;;;;;;;;16s23s5s-aac-acc;;;;;16s23s5s-aac-acc;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;2*16s23s5s-16,16aas;;;;;;;2*16atcgca235;;;;;;;;4*16s23s5s-22,20,15,9 aas;;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;;;;;suite3-16s23s5s;;;;;;;;;;;;;;;;;;;;cgt-gga-16s23s5s-atgf-gac;;;;;;;;;suite2-16s23s5s;;;;;;;;;;3*16s23s5s-20,15,9;;;;;;;;;2*16s23s5s dont un encadré ici;;;;;16atcgca235-14aas;;;;;;;;;;;;;;;;;;16s-5s-atcgca-23s-8aas;;;;;;;16s23s5s-6aas;;;;;;;interc;;interc;;;;;;;;;;;16atcgca235;;;;;;2*16s-gca-235-25, 8aas ;;;;;;;;;2*16s-5s-atcgca-23s-9,5aas;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;16s23s5s-6aas:gta-gac-tgg-cac-ttg-cca;;;;;;
16s23s5s-12aas;;;;;16s23s5s-9aas;;;;;cgt gga 16s23s5s atgf gac;;;;;;;;;;16s23s5s-x aas  et 16atcgca235-x aas;;;;;;;16s23s5s-atgf-gac;;;;;;;16s23s5s-x aas;;;;;33aas-16s23s5s-atgf-gac;;;;;;;;;;11aas-16s23s5s-atgf-gac;;;;;;;;;;16s23s5s-atgf-gac;;;;;3*16s23s5s-21,16,9 aas;;;;;interc;;interc;;interc;;interc;;;interc;;interc;;interc;;;5*16s23s5s-22,20,15,9,9 aas;;;;;;;;11aas-16s23s5s-atgf-gac;;;;;;;;;;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;;;;10aas-16s23s5s-atgf-gac;;;;;;;;;;;;;;;;;;;;16s23s5s-21, 16, 9, 6aas;;;;;;;;;5*16s23s5s-22,20,15,9,9aas;;;;;;;;;;12aas-16s23s5s-atgf-gac;;;;;;;;;16s23s5s-6, 5aas;;;;;16atcgca235-aac-acc;;;;;;;;interc;;interc;;interc;;interc;;interc;;16s-5s-atcgca-23s-5s-11aas;;;;;;;5s-8aas-16s-atc-235;;;;;;16s;47;16s;47;;;interc;;;interc;;;;;11aas-16s23s5s-atgf-gac;;;;;;16s23s5s-12aas;;;;;;;;;16s-5s-23s-14aas;;;;;;;;;16s23s5s-14aas;;;;;;2*16atcgca235-17aas, 4aas-5s-aac;;;;;;
interc;;interc;;;16s23s5s-13aas;;;;;interc;;interc;;interc;;interc;;;;interc;;interc;;interc;;;16s°atcgca235;;;;;;;interc;-;interc;;;interc;;;interc;;;interc;;;;interc;;interc;;interc;;interc;;;;2*16s23s5s-21,16 aas;;;;;interc;;interc;;;140;16s;140;16s;5;gaa;3;aac;;159;16s;303;16s;71;aaa;;13aas-16s23s5s;;;;;;;;interc;;interc;;interc;;interc;;;;°;interc;;;;;;;;;;;;7*16s23s5s-21,16,14,12,10,9,9;;;;;;;;;;;;;;;;;;;;;interc;;à enlever;interc;;;interc;;12aas-16s23s5s-atgf-gac;;;;;;;;;;Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 20  15  9,  sauf  14 avec 12aas-16s23s5s-atgf-gac.;;;;;;;;;;interc;;interc;;;interc;;interc;;interc;;cds;342;cds;677;cds;537;cds;373;cds;324;;3*16s23s5s-11, 17, 21 aas;;;;;;;ctc-gga-16s23s5s;;;;;;gca;153;gca;155;;dir    ;361;cds;amino acid permease;;;;;;16s23s5s-13aas;;;;;;;interc;;;;;;;;;interc;;;;;;;;;interc;;;;;gga-16atcgca235-gta;;;;;;
203;16s;16;gaa;;interc;;interc;;;170;16s;246;ttg;4;gca;16;cca;;;3;gaa;-2934;16s°;228;16s;;interc;-;interc;-;interc;;;3;gaa;228;16s;;139;16s;;10;gca;;3;gac;comp;;10;ttg;140;16s;1;gaa;3;gac;comp;;interc;;interc;;;176;16s;4;gaa;;96;23s;97;23s;7;agc;8;agc;;13;atc;67;23s;32;gaa;;interc;;interc;;;interc;;;141;16s;140;16s;6;gaa;3;aac;direct;;comp;753;cds;efflux RND transporter permease subunit;;;;;;;;;;Les blocs sont emboités. Ils sont tous 16s23s5s. Met avec atgj. Quand les blocs se suivent j’ajoute une ligne pour le 16s suivant.;;;;;;;;;;;;;;;;;;;;16s;164;;cgt;13;;gaa;25;;Les blocs sont emboités. Ils sont tous de type 16s23s5s-xaas, 22 20  15  9  9,  sauf  14 avec 12aas-16s23s5s-atgf-gac.;;;;;;;;;;;interc;;;;;;;;cds;161;cds;298;;16s;244;gaa;5;ttg;45;;ctc;28;16s;268;16s;252;16s;260;16s;258;;;interc;;interc;;interc;;23s°5s;;;;;;23s;72;23s;72;;dir    ;66;16s;;;;;;;;interc;;;;;comp;208;cds;methionine adenosyltransferase;;;;;;dir    ;368;cds;MFS transporter;;;;;;dir     ;175;cds;SprT family protein;*;;;interc;;;;;
75;23s;12;ttc;;388;16s;483;16s;;47;23s;7;tta;16;cca;32;cgt;;;3;agc;98;23s;47;23s;;3;gaa;170;16s;170;16s;;3;agc;98;23s;;97;23s;;5;ggc;;12;atgf;comp;;14;tgc;97;23s;8;aac;12;atgf;comp;;176;16s;4;gaa;;106;23s;3;agc;;8;5s;4;5s;7;aac;5;gaa;;176;gca;8;5s;5;agc;;1;gaa;10;ttg;;10;gca;;96;23s;97;23s;7;agc;8;agc;direct;;dir     ;242;16s;;;;;;;;;;;Première boîte, les blocs sont tous 16s23s5s-xaas,   21  16  12  9.;;;;;;;;;;;;;;;;;;;;23s;55;;gga;159;;agc;3;;;interc;;;;;;;;;dir    ;139;cds;hp;;;;;;gta;3;5s;68;;23s;80;agc;34;tgc;19;;tcc;12;23s;95;23s;94;23s;168;23s;166;;cds;392;cds;1 116;cds;726;;;interc;à elever;interc;;;5s;3;5s;3;;dir    ;193;gca;dir    ;592;cds;50S ribosomal protein L17;*;;dir    ;167;cds;SprT family protein;;;comp;7;gaa;;;;;;;dir    ;101;16s;;;;;;;dir     ;3;aac;;;;dir    ;434;cds;lysine--tRNA ligase;;;
13;5s;22;gac;;186;23s;201;23s;;23;5s;6;tgc;11;cgt;296;ggc;;;10;aac;9;5s;23;5s;;3;agc;97;23s;47;23s;;10;aac;9;5s;;4;5s;;5;aaa;;46;5s;comp;;5;ggc;4;5s;10;atc;45;5s;comp;;106;23s;3;agc;;9;5s;17;aac;;2;aac;4;gta;10;atc;25;gta;;67;23s;3;aac;1;aac;;3;aac;14;tgc;;9;cca;;8;5s;5;5s;7;aac;4;gaa;direct;;dir     ;222;23s;°;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;5s;20;;16s;167;;aac;10;;comp;680;cds;L-lactate dehydrogenase;;;;;;;dir    ;141;16s;;;;;;;gaa;138;23s;208;;5s;13;aac;6;ggc;5;;atgf;14;5s;55;5s;43;5s;9;5s;31;;16s;207;16s;207;gga;9;;ttg;38;5s;70;comp;;gta;2;gta;2;;dir    ;200;23s;dir    ;66;16s;;;;dir    ;2;aac;;;;comp;24;agc;dir     ;230;cds;site-specific integrase;*;;dir    ;63;5s;comp;132;cds;undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase;*;;dir     ;7;agc;;;;dir    ;84;16s;;;;
34;aac;41;atgf;;4;5s;11;5s;;29;gta;53;ggc;14;tta;2;acc;;;15;atc;5;aac;5;gta;;10;aac;9;5s;23;5s;;15;atc;5;aac;;4;gta;;65;caa;;141;23s;comp;;63;caa;4;gta;6;tgg;141;23s;comp;;9;5s;17;aac;;5;acc;15;atc;;17;tcc;9;aca;13;gga;3;atgf;;8;5s;11;tcc;32;atc;;10;atc;5;ggc;;3;cgt;;2;aac;8;gta;10;atc;46;gta;direct;;dir     ;4;5s;dir   ;465;101;cds;SprT family protein;;;;;;comp;466;;cds;1,4-alpha-glucan branching protein GlgB;;;;;;;;;;;;;;;;gta;4;;23s;55;;atc;15;;comp;6;gaa;dir    ;113;cds;hp;;;;dir    ;97;23s;;interc;;;;;atgj;6;16s;436;;gta;8;atc;25;caa;29;;atgj;14;atc;19;atc;19;aac;6;aac;6;;23s;76;23s;76;cca;22;;gga;103;23s;468;comp;;gac;2;gac;2;;dir    ;15;5s;dir    ;193;gca;;;;dir    ;8;agc;;;;comp;19;atc;comp;18;ttg;;;;dir    ;21;atc;comp;15;tac;;;;dir     ;25;gaa;;;;dir    ;6;atc;;;;
13;tcc;9;gaa;;3;gta;4;aac;;37;aca;9;caa;24;ggc;45;aac;;;8;gga;36;tcc;36;aca;;15;atc;5;aac;5;gta;;9;gga;35;tcc;;9;aca;;17;tac;;75;16s;comp;;19;cac;9;aca;9;aca;75;16s;comp;;5;aac;15;atc;;35;tcc;9;gga;;4;gaa;22;cac;10;aaa;87;gac;;5;gta;150;gaa;39;gga;;3;tgg;65;caa;;16;tta;;17;tcc;11;tac;13;gga;87;gac;direct;;dir     ;9;gta;dir   ;72;6;aac;;;;;;;comp;5;;gaa;;;;;;;;;;;;;;;;;aca;36;;5s;13;;gga;10;;comp;7;agc;dir    ;140;16s;;;;;dir    ;4;5s;dir    ;403;cds;hp;;;tcc;8;cds;-8;;aca;41;gga;23;cac;15;;agc;8;gca;16;gca;17;tcc;38;tcc;38;;5s;34;5s;82;cgt;5;;gga;7;16s;118;comp;;aaa;9;aaa;9;;dir    ;18;gta;dir    ;200;23s;;;;dir    ;30;gaa;;;;comp;9;gga;comp;41;tgc;;;;dir    ;179;gca;comp;10;ttc;;;;dir     ;5;gac;;;;dir    ;202;gca;;interc;;
21;gaa;12;agc;;21;aca;43;tcc;;10;aaa;29;cac;6;cta;47;5s;;;20;cac;10;gaa;6;aaa;;8;gga;36;tcc;36;aca;;21;cac;10;gaa;;22;cac;;5;gta;;1;gga;comp;;7;tgg;22;cac;8;ttc;1;gga;comp;;35;tcc;9;gga;;10;gaa;24;cac;;26;gta;29;cta;14;aca;5;caa;;18;aca;261;gta;3;cgt;;16;aca;12;cac;;29;ggc;;5;gaa;4;caa;10;aaa;5;caa;direct;;dir     ;10;tac;dir   ;91;6;agc;°;interc;;;;;comp;3;;agc;comp;808;;cds;SIS domain-containing protein;;;;;;;;;;;;aaa;6;;atgf;60;;cac;17;;comp;7;aac;dir    ;97;23s;;;;;dir    ;8;gta;comp;141;16s;;;;aac;7;cds;138;;aaa;5;cac;28;tgg;7;;tcg;4;gaa;9;gaa;8;gaa;11;gaa;11;;atc;22;gca;4;ggc;10;;tgc;5;gga;21;comp;;cta;10;cta;10;;dir    ;73;gac;dir    ;15;5s;;;;dir    ;5;gac;;;;comp;4;ttc;comp;11;caa;;;;dir    ;85;23s;comp;21;gac;;;;dir     ;263;caa;;;;dir    ;103;23s;dir     ;452;cds;hp
14;gta;10;atc;;7;aaa;32;gaa;;9;ctg;10;tgg;36;aaa;170;23s;;;10;ttc;7;gta;24;cta;;20;cac;10;gaa;6;aaa;;11;ttc;7;gta;;29;cta;;24;gaa;;4;cca;comp;;10;tac;29;cta;4;gac;4;cca;comp;;10;gaa;24;cac;;7;gta;14;ttc;;3;atgf;16;ggc;13;ttc;16;aaa;;14;aaa;55;atgf;6;ggc;;10;ttc;14;tgg;;13;cta;;24;gta;14;aaa;14;aca;17;aaa;direct;;dir     ;5;caa;dir   ;75;5;gaa;dir     ;381;cds;lysine--tRNA ligase;*;;comp;149;;aac;comp;17;;aac;;;;;;;;;;;;;cta;40;;gac;:4;;ttc;12;;comp;10;atc;dir    ;5;5s;;;;;dir    ;12;tac;comp;98;23s;;;;5s;69;gac;3;;cta;14;ttc;4;tac;20;;acc;4;tac;20;gta;5;gta;17;gta;17;;gca;4;aac;3;cta;11;;caa;11;ctc;:2;comp;;aca;35;aca;28;;dir    ;5;aaa;dir    ;9;gta;;;;dir    ;16;caa;;;;comp;43;gac;comp;2;cac;;;;dir    ;3;aac;comp;5;gta;;;;dir     ;17;aaa;;;;dir    ;4;5s;dir     ;84;16s;
12;gac;3;gga;;18;cta;31;atgf;;19;ggc;11;tac;5;aca;:5;16s;;;6;gac;9;atgf;14;ggc;;11;ttc;7;gta;24;cta;;6;gac;11;atgf;;16;ggc;;4;acc;;3;cgt;comp;;18;aca;16;ggc;20;atgf;98;cgt;comp;;7;gta;14;ttc;;38;atgf;39;gac;;9;gac;3;tta;3;gac;93;ctc;;48;cta;33;gac;10;caa;;3;gac;10;tac;;13;aaa;;3;atgf;29;cta;12;ttc;97;ctc;direct;;dir     ;13;aaa;dir   ;76;35;gta;dir     ;242;16s;;;;comp;4;;atc;comp;70;;atc;comp;517;;cds;kinase/pyrophosphorylase;;;;;;;;ggc;14;;;;;gac;11;;comp;13;gga;dir    ;8;gta;;;;;dir    ;4;caa;comp;8;5s;;;;23s;126;gta;2;;ggc;21;gac;4;ttc;4;;gca;119;aac;3;aca;10;atgf;13;atgf;15;;aac;34;tcc;19;aaa;4;;cac;2;;;;;ggc;8;atc;10;;dir    ;10;cta;dir    ;31;gga;;;;dir    ;77;aaa;;;;comp;47;atgf;comp;5;tgg;;;;dir    ;24;acc;comp;156;atgj;;;;dir     ;34;cta;;;;dir    ;2;gta;dir     ;6;other;
7;ttc;17;gac;;45;ggc;26;gac;;9;tta;3;aca;23;gta;;;;;19;atgf;10;gac;11;tta;;6;gac;7;atgf;14;ggc;;19;atgf;12;gac;;3;tta;;9;aac;;16;tta;comp;;9;ttc;3;tta;54;tca;16;ctc;comp;;38;atgf;39;gac;;15;gac;36;atgf;;18;ttc;10;cgt;27;atgf;4;cgt;;25;ggc;10;ttc;19;cac;;24;atgf;14;aca;;5;aca;;9;gac;16;ggc;1;gac;4;cgt;direct;;dir     ;29;cta;dir   ;76;74;gac;dir     ;144;23s;;;;comp;17;;gga;comp;9;;tgc;comp;4;;atc;;;;;;;;;tta;9;;16s;167;;atgf;17;;comp;10;aaa;dir    ;11;tac;;;;;dir    ;18;aaa fin;comp;2;aac;;;;gca;69;cgt;35;;tta;12;atgf;42;gac;6;;ncRNA;36;gta;19;tac;18;gac;49;gac;67;;atgj;3;gaa;9;caa;55;;tgg;15;5s;12;direct;;tta;11;gaa;13;;dir    ;13;aca;dir    ;16;atc;;;;dir    ;58;ctc;;;;comp;16;tca;comp;4;tac;;;;dir    ;40;gaa;comp;166;23s;;;;dir     ;58;ctc;;;;dir    ;42;aaa;dir     ;203;gca;
29;tac;11;atgf;;3;tta;7;ttc;;17;cgt;10;ttc;47;5s;;;;;7;tca;3;ttc;16;cgt;;19;atgf;10;gac;11;tta;;7;tca;3;ttc;;10;cgt;;82;5s;;29;ggc;comp;;3;gac;10;cgt;20;tca;5;aaa;comp;;15;gac;36;atgf;;5;ttc;6;tca;;10;aca;16;cca;62;tca;1;cca;;3;tta;62;aca;6;tgg;;93;tca;9;ttc;;4;gta;;18;ttc;3;tta;27;atgf;1;cca;direct;;dir     ;10;ggc;dir   ;75;5;caa;dir     ;4;5s;;;;comp;22;;cac;comp;31;;caa;comp;9;;gga;dir;351;;cds;hp;;;;cgt;27;;23s;111;;tca;6;;comp;14;aca;dir    ;4;caa;;;;;dir    ;31;cta deb;comp;18;tcc;;;;atc;105;ggc;19;;cgt;10;tca;22;atgf;21;;cca;6;gac;20;aac;4;ttc;4;acg;11;;agc;31;gta;29;gta;11;;tac;5;gta;16;direct;;cgt;7;tca;10;;dir    ;8;ggc;dir    ;5;caa;;;;dir    ;9;cgt;;;;comp;13;gaa;comp;22;ttc;;;;dir    ;6;caa;comp;22;gca;;;;dir     ;5;cgt;;;;dir    ;76;aca;dir     ;90;23s;
27;tgg;18;tca;;4;cgt;28;tac;;4;cca;7;gac;170;23s;;;;;2;atgi;11;aca;4;cca;;7;tca;3;ttc;16;cgt;;2;atgi;11;aca;;16;cca;;141;23s;;14;cta;comp;;24;atgf;15;cca;16;gca;88;caa;comp;;5;ttc;6;tca;;18;aca;2;atgi;;7;tac;20;gca;4;atgi;75;gga;;64;cgt;20;tac;28;tac;;15;tca;3;gac;;87;5s;;10;aca;10;cgt;17;tca;75;gga;direct;;dir     ;3;tta;dir   ;73;15;aaa;dir     ;5;gta;;;;comp;38;;ttc;comp;32;;cac;comp;7;;tgg;dir;307;;16s;;;;;cca;9;;5s;9;;atgi;2;;comp;9;ttc;dir    ;15;aaa;;;;;dir    ;16;ggc;comp;4;gaa;;;;16s;547;cca;3;;cca;19;atgi;11;gta;56;;cgt;104;ttc;15;gta;21;aca;13;cac;10;;gaa;6;atgf;25;gaa;11;;aca;7;aca;6;direct;;cca;15;atgf;2;;dir    ;18;tta;dir    ;10;tca;;;;dir    ;35;cca;;;;comp;17;atc;comp;3;gac;;;;dir    ;9;aaa;comp;63;atc;;;;dir     ;33;cca;;;;dir    ;8;tta;dir     ;5;5s;
7;cac;9;atgi;;24;cca;11;tgg;;19;gca;7;atgf;:9;16s;;;;;20;atgj;10;tac;:9;gca;;2;atgi;11;aca;4;cca;;20;atgj;10;tac;;20;gca;;:9;16s;;5;aaa;comp;;5;gta;20;gca;10;cca;46;gac;comp;;18;aca;2;atgi;;10;tac;21;atgj;;20;tgg;54;tca;20;atgj;140;16s;;7;cca;23;tgg;5;gac;;14;gca;24;atgf;;139;23s;;7;tac;15;cca;4;atgi;141;16s;direct;;dir     ;4;cgt;dir   ;81;3;cta;dir     ;10;aca;;;;comp;3;;gac;comp;28;;tac;comp;24;;tac;dir;91;;23s;;;;;gca;170;;aac;5;;atgj;19;;comp;3;gac;dir    ;29;cta;;;;;dir    ;3;tta;comp;26;gta;;;;cds;:7;aac;7;;gca;341;atgj;42;gaa;33;;ggc;7;aaa;10;atgf;12;tac;8;caa;5;;gta;10;gac;13;acc;3;;ttc;18;aaa;33;direct;;atgj;19;ttc;11;;dir    ;3;cgt;dir    ;21;atgf;;;;dir    ;20;gga;;;;comp;1;gga;comp;13;gta;;;;dir    ;133;cta;comp;104;5s;;;;dir     ;5;gga;;;;dir    ;37;cgt;dir     ;8;aac;
74;caa;14;atgj;;:9;gca;32;cac;;2;atgj;10;gta;;;à enlever d’ici, mis en 2aas;;;;4;gca;29;tgg;;;;20;atgj;10;tac;:9;gca;;4;gca;29;tgg;;54;tca;;;;;87;caa;comp;;17;gaa;4;atgj;3;cgt;4;gta;comp;;10;tac;21;atgj;;25;tgg;6;gca;;63;cac;20;tca;15;gca;44;23s;;:11;gca;10;cac;12;tca;;10;cca;5;gta;;:9;16s;;19;tgg;20;gca;20;atgj;45;23s;direct;;dir     ;10;cca;dir   ;86;91;ctc;dir     ;14;aaa;;;;comp;29;;atgf;comp;17;;gac;comp;15;;tca;dir;7;;5s;;;;;16s;164;;tcc;34;;gca;5;;comp;28;atgf;dir    ;16;ggc;;;;;dir    ;10;cgt;comp;3;atgf;;;;;;5s;68;;16s;244;gca;22;tcc;6;;ctg;9;ctg;3;gac;34;tgg;13;aaa;17;;atgf;25;aca;4;aac;18;;gac;21;ggc;7;direct;;atgi;15;tac;6;;dir    ;5;cca;dir    ;17;ttc;;;;dir    ;97;atc;;;;comp;40;gac;comp;11;gaa;;;;dir    ;9;ggc;comp;319;16s;;;;dir     ;226;atc;;;;dir    ;26;cca;dir     ;82;acg;
11;tgc;5;gca;;;;6;caa;;7;atgi;36;gaa;4;gca;10;gac;comp;;17;cca;9;cac;;;;4;gca;29;tgg;;;;18;cca;9;cac;;20;cta;;1;gaa;;46;gac;comp;;2;tcc;17;atgi;16;tta;8;gaa;comp;;25;tgg;6;gca;;9;cac;14;cca;;5;caa;3;atgf;10;cca;12;5s;;;;7;caa;25;atgj;;3;cgt;10;gaa;;;;;63;cac;51;tca;16;gca;12;5s;direct;;dir     ;14;gca;dir   ;77;4;cgt;dir     ;29;cta;;;;comp;17;;tca;comp;104;;tca;comp;19;;atgj;dir;161;;gta;;;;;23s;55;;gaa;9;;cca;15;;comp;17;tca;dir    ;3;tta;;;;;dir    ;15;cca;comp;11;gac;;;;cds;200;23s;208;;23s;80;cca;10;aac;14;;aaa;9;ggc;12;cac;13;cac;26;ggc;40;;gac;50;tac;102;5s;76;;atgf;14;tta;5;direct;;tca;10;tgg;14;;dir    ;24;atgj;dir    ;5;tac;;;;dir    ;173;16s;;;;comp;47;atgf;comp;47;tcc;;;;dir    ;7;cgt;comp;:7;cds;SigmaK-factor processing regulatory protein BofA;*;;dir     ;309;16s;;;;dir    ;24;atgj;dir     ;33;gta;
:12;ttg;4;cca;;;;25;ggc;;19;tca;5;tcc;16;cca;19;atgf;comp;;9;cgt;53;caa;170;16s;;17;cca;9;cac;;;;9;cgt;50;caa;;1;atgf;;8;aac;;4;gta;comp;;8;aac;27;tca;29;ggc;3;agc;comp;;9;cac;14;cca;;47;caa;11;cgt;;14;ggc;8;gac;3;cgt;3;atgf;;;;6;ggc;5;gca;;16;tta;5;tcc;;140;16s;;5;caa;27;tca;10;cca;3;atgf;direct;;dir     ;59;tca;dir   ;77;1;cca;dir     ;10;ggc;;;;comp;12;;atgi;comp;23;;atgj;comp;9;;gca;dir;19;;aca;;;;;5s;:9;;gta;9;;cgt;9;;comp;4;atgi;dir    ;10;cgt;;;;;dir    ;20;gca;comp;18;ttc;;;;gac;26;16s;501;;5s;:9;cgt;9;5s;80;;caa;9;tgc;15;caa;8;caa;9;ggc;24;;ttc;22;caa;4;23s;129;;tca;38;cgt;20;direct;;atgf;2;cac;6;;dir    ;6;atgi;dir    ;11;tgg;;;;dir    ;288;23s;;;;comp;29;tca;comp;5;aac;;;;dir    ;157;gga;;;;;;;dir     ;119;23s;;;;dir    ;35;tca;dir     ;139;aca;
;;18;cgt;;;;5;tgc;;7;atgf;9;aac;11;cgt;47;5s;comp;;19;tta;6;ggc;47;23s;;9;cgt;52;caa;170;16s;;20;tta;6;ggc;;12;gac;;11;atc;;1;gaa;comp;;96;5s;1;atgf;14;cta;:13;aac;comp;;47;caa;11;cgt;;5;ggc;14;tta;;10;tgc;9;ttc;16;tta;174;gac;;;;30;tgc;67;5s;;29;ggc;9;aac;;98;23s;;14;ggc;3;atgf;3;cgt;:13;gac;direct;;dir     ;19;tca;dir   ;71;71;gga;dir     ;3;tta;;;;comp;19;;atgj;comp;17;;cca;comp;9;;cca;dir;9;;aaa;;;;;;;;atgf;11;;tta;14;;comp;20;atgj;dir    ;15;cca;;;;;dir    ;56;tca;comp;10;aca;;;;gaa;3;cds;:6;;;;tta;14;23s;172;;cac;17;cgt;5;aaa;17;ggc;12;ttg;5;;aca;5;aaa;12;gca;20;;gac;10;cca;23;direct;;ttc;20;caa;10;;dir    ;10;tca;dir    ;8;cac;;;;dir    ;21;5s;;;;comp;16;atgi;comp;78;5s;;;;dir    ;:11;cds;phosphoenolpyruvate carboxylase;;;;;;dir     ;180;5s;;;;dir    ;3;atgf;dir     ;5;5s;
;;32;tta;;;;:13;ttg;;10;gac;99;5s;14;tta;228;23s;comp;;9;ggc;7;tgc;46;5s;;19;tta;6;ggc;47;23s;;9;ggc;7;tgc;;14;ttc;;6;tgg;;8;aac;comp;;77;23s;12;gac;4;aaa;;;;;5;ggc;14;tta;;6;tgc;42;ggc;;:15;ttg;3;aca;29;ggc;:14;;;;;41;tta;316;23s;;16;cta;92;5s;;4;5s;;10;tgc;9;gac;16;tta;;;;;dir     ;3;atgf;dir   ;1554;242;16s;dir     ;8;cgt;;;;comp;17;;gca;comp;12;;cgt;comp;5;;tta;dir;8;;cta;;;;;16s;164;;gac;12;;ggc;5;;comp;15;gca;dir    ;20;gca;;;;;dir    ;20;tca;comp;7;tac;;;;gta;2;;;;à enlever;;ggc;15;gca;46;;gac;12;cca;158;ctc;13;tgc;10;cca;19;;tac;16;cta;10;atc;38;;tca;9;gca;121;direct;;gga;34;ttg;:16;;dir    ;21;atgf;dir    ;22;caa;;;;dir    ;70;atgf;;;;comp;22;atgj;comp;218;23s;;;;;;;;;;;;;dir     ;131;atgf;;;;dir    ;8;gac;dir     ;63;aac;
;;11;ggc;;;;;;;20;ttc;228;23s;24;ggc;97;16s;comp;;10;ctg;245;tta;2;aac;;9;ggc;7;tgc;46;5s;;10;ctg;242;tta;;10;aca;;9;aca;;11;atc;comp;;8;gca;14;ttc;11;caa;10;gca;;;6;tgc;42;ggc;;673;tta;7;cta;;;;10;tgg;22;cta;;;;;;:16;ttg;:16;16s;;4;aaa;140;23s;;6;gta;;:15;ttg;9;ttc;29;ggc;140;16s;;;dir     ;8;gac;dir   ;2926;92;23s;dir     ;10;cca;;;;comp;5;;cca;comp;11;;ggc;comp;8;;ggc;dir;5;;ggc;;;;;23s;55;;ttc;5;;ctg;10;;comp;10;cca;dir    ;53;tca;;;;;dir    ;3;atgf;comp;19;tgg;;;;cgt;35;;;;acc;24;cta;5;atc;127;;gta;4;gca;4;ctg;5;tta;20;gga;1;;cac;18;ggc;5;5s;93;;atgi;28;16s;92;direct;;atc;13;;;;dir    ;11;ttc;dir    ;82;ttg;;;;dir    ;45;gac;;;;comp;14;gca;comp;406;16s;;;;dir     ;94;cds;hp;;;;;;dir     ;211;gac;;;;dir    ;40;ttc;dir     ;:7;cds;hp
;;8;aca;;;;;;;8;cac;:16;16s;6;cta;8;gga;comp;;37;aaa;  :16;ttg;342;acc;;10;ctg;246;tta;2;aac;;37;aaa;:16;ttg;;13;aaa;;9;ttc;;6;tgg;comp;;130;atc;10;aca;8;tac;5;ggc;;;673;tta;7;cta;;:16;ttg;37;aaa;;140;16s;8;atc;9;cac;;;;;;;;;;;11;caa;:15;16s;;9;aca;;;;6;aca;22;cta;82;23s;;;dir     ;14;ttc;dir   ;116;10;5s;dir     ;:9;gca;-;*;;comp;7;;cgt;comp;242;;aaa;comp;10;;cta;dir;13;;tta;;;;;5s;46;;aca;22;;aaa;37;;comp;3;cgt;dir    ;19;tca;;;;;dir    ;8;gac;comp;63;cac;;;;ggc;36;;;;aac;14;aaa;41;16s;:16;;aac;15;acc;5;ggc;14;cgt;3;aga;187;;caa;4;cgt;12;16s;367;;atgj;21;atc;166;direct;;agc;:18;16s;47;;dir    ;32;gga;<>dir    ;:13;cds;AraC family transcriptional regulator;*;;comp;:13;cds;hp;;;comp;3;cca;comp;:12;cds;hp;;;comp;21;ttg;;;;;;;dir     ;:14;cds;thiamine-phosphate kinase;*;;dir    ;17;gga;;;;
;;7;cta;;;;;;;15;gga;;;36;aaa;:4;cgt;comp;;29;aca;;;32;ggc;;37;aaa;:16;ttg;342;acc;;29;aca;;;;10;gga;;4;gac;;9;aca;comp;;:17;16s;13;aaa;5;gta;5;aaa;;;:16;ttg;37;aaa;;;;41;aca;;86;23s;1;aac;4;aca;;;;;;;;;;;9;tac;;;;24;cac;;;;10;tgg;9;cac;9;5s;;;dir     ;6;aca;dir   ;77;3;atgf;;;;;;;comp;5;;tta;comp;104;;aca;comp;186;;aca;dir;17;;cgt;;;;;aac;4;;tac;5;;aca;32;;comp;16;tta;dir    ;3;atgf;;;;;dir    ;10;ttc;comp;5;caa;;;;5s;68;;;;5s;80;aca;8;;;;tac;8;tcg;19;tgc;10;ttg;147;cds;:16;;aaa;15;ttg;7;cds;:13;;gca;17;23s;70;direct;;;;gca;153;;dir    ;7;atc;;;;;;;;;;;;;comp;13;cgt;;;;;;;comp;15;cgt;;;;;;;;;;;;;dir    ;17;gga;;;;
;;4;aaa;;;;;;;10;atc;;;5;aca;;;;;23;gta;;;16;cgt;;29;aca;;;32;ggc;;23;gta;;;;7;atc;;20;atgf;;8;ttc;comp;;;;10;gga;97;5s;65;caa;;;;;41;aca;;176;16s;22;gta;;9;5s;:19;gaa;4;gta;;;;;;;;;;;4;gta;45;5s;comp;29;cta;;;;8;atc;4;aca;4;aac;;;dir     ;11;tgg;dir   ;76;176;gac;;;;;;;comp;9;;ggc;comp;4;;gta;comp;91;;5s;dir;18;;cca;;;;;acc;56;;tgg;24;;gta;20;;comp;29;ggc;dir    ;8;gac;;;;;dir    ;6;aca;comp;14;ggc;;;;23s;208;;;;23s;172;gta;13;;;;aca;5;agc;17;cgt;5;cds;:17;;;;ctg;6;cca;7;;;;cca;9;5s;:9;direct;;16s;47;23s;72;;dir    ;69;agc;;;;;;;dir    ;393;cds;hp;;;comp;15;tta;;;;;;;comp;11;tgc;;;;;;;dir    ;528;cds;hp;;;dir    ;16;gga;;;;
;;10;gta;;;;;;;3;aac;;;23;gta;;;;;47;5s;;;4;cca;;23;gta;;;16;cgt;;47;5s;;;;7;aac;;54;tca;;4;gac;comp;;;;7;atc;141;23s;17;tac;;;;;22;gta;;54;23s;54;5s;;4;aac;;;97;5s;;;;;;;;;;;98;5s;140;23s;comp;16;ggc;;;;1;acc;4;gta;24;acc;;;dir     ;9;atc;dir   ;474;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;comp;9;;cta;comp;41;;gaa;comp;307;;23s;dir;:9;;gca;;;;;ggc;30;;cac;9;;5s;55;;comp;22;cta;dir    ;10;ttc;;;;;dir    ;10;tgg;comp;10;tgc;;;;16s;153;;;;gca;46;5s;81;;;;gaa;15;gtc;5;cca;105;;;cds;83;;ggc;10;gga;1 133;cds;107;;cgt;18;;;;;gca;153;5s;3;;dir    ;:18;cds;rod shape-determining protein MreC;;;;;;dir    ;173;16s;;;;comp;11;ggc;;;;;;;comp;6;ggc;;;;;;;dir    ;329;16s;;;;dir    ;4;gga;;;;
;;75;5s;;;;;;;3;agc;;;47;5s;;;;;81;23s;;;20;gca;;47;5s;;;4;cca;;170;23s;;;;:20;agc;;20;tca;;20;atgf;comp;;;;7;aac;:20;16s;5;gta;;;;;54;5s;;22;5s;176;23s;;24;acc;;;140;23s;;;;;;;;;;;140;23s;75;16s;comp;3;tta;;;;:20;gaa;98;5s;5;gaa;;;dir     ;1;caa;;;;;;;;;;;comp;163;;aaa;comp;91;;5s;comp;555;;16s;dir;-;;16s;suite2;;;;cgt;27;;caa;49;;23s;167;;comp;10;cac;dir    ;3;aca;;;;;dir    ;9;atc;comp;152;ttg;;;;cds;:5;;;;atc;127;23s;244;;;;gcc;9;acg;39;cds;:19;cds;797;gga;5;;tgc;26;cds;:17;cca;7;;tta;10;aaa;3;;;23s;72;gta;2;;;;;;;;;;;dir    ;233;23s;;;;comp;11;aca;;;;;;;comp;10;caa;;;;;;;dir    ;151;23s;;;;dir    ;42;atc;;;;
;;165;23s;;;;;;;:21;gaa;;;170;23s;;;;;14;gca   ;;;:7;atgj;;170;23s;;;20;gca;;:21;16s;;;;;;;16;gca;;54;tca;comp;;;;6;agc;;;24;gaa;;;;;176;23s;;30;gta;:21;16s;;5;gaa;;;:22;16s;;;;;;;;;;;:20;16s;1;gga;comp;10;cgt;;;;;;141;23s;17;gta;;;dir     ;167;gaa;;;;;;;;;;;comp;162;;aca;comp;284;;23s;comp;:12;;cds;exodeoxyribonuclease III;;;;;;;;cca;8;;ggc;5;;16s;:21;;comp;4;aca;dir    ;10;tgg;;;;;dir    ;1;aac;dir    ;:15;cds;DUF3884 family protein;*;;;;;;;16s;:4;16s;:21;;;;atc;54;tcc;41;;;16s;261;cca;16;;cgt;22;;;ttg;12;;ggc;3;caa;9;;;5s;3;gac;2;;dir    ;83;cds;hp;;;;;;dir    ;12;5s;;;;comp;13;cta;;;;;;;comp;20;cac;;;;;;;dir    ;36;5s;;;;dir    ;71;agc;;;;
;;34;gca;;;;;;;;;;;:9;16s;;;;;96;atc;;;;;;:21;16s;;;:7;atgj;;;;;;;10;ttg;;10;cca;;20;tca;comp;;;;:22;gaa;;;4;acc;;;;;:21;16s;;37;aca;;;;17;gta;;;;;;;;;;;;;;;;;3;cca;comp;14;cca;;;;;;:22;16s;65;tac;;;dir     ;:20;cds;CBS domain-containing protein;;;;;;;;;;comp;8;;gta;comp;437;;16s;;;;;;;;;;;;;gca;171;;tgc;7;;;;;comp;4;gta;dir    ;8;atc;;;;;dir    ;132;gaa;;;;;;;;;;;;;;;;;;;5s;112;ctc;283;cds;298;23s;94;cgt;4;;cca;9;cds;412;cgt;5;;cta;3;tac;29;;;gta;5;aaa;9;;comp;16;gaa;;;;;;;dir    ;1;aac;;;;comp;2;aaa;;;;;;;comp;39;tgg;;;;;;;dir    ;2;aac;;;;dir    ;:19;cds;hp;;;
;;75;atc;;;;;;;;;;;;;;;;;:23;16s;;;;;;;;;;;;;;;;;;14;tgc;;3;cgt;;16;gca;comp;;;;;;;;9;aac;;;;;;;;8;aaa;;;;65;tac;;;;;;;;;;;;;;;10;gca;92;cgt;comp;16;gca;;;;;;;;5;caa;;;;;;;;;;;;;;;;comp;145;;5s;comp;:16;;cds;6-phospho-3-hexuloisomerase;;;;;;;;;;;;16s;164;;tta;265;;;;;comp;97;5s;dir    ;1;aac;;;;;dir    ;:20;cds;CBS domain-containing protein;;;;;;;;;;;;;;;;;;23s;258;cds;:22;16s;254;5s;43;ggc;8;;gga;204;16s;108;ggc;35;;aaa;5;gta;7;;;gga;36;cta;10;;comp;50;atc;;;;;;;dir    ;17;tcc;;;;comp;7;gta;;;;;;;comp;89;aca;;;;;;;dir    ;16;tcc;;;;;;;;;;
;;:24;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5;ggc;;16;tta;;10;cca;comp;;;;;;;;82;5s;;;;;;;;42;cta;;;;5;caa;;;;;;;;;;;;;;;5;ggc;3;ctc;comp;4;atgj;;;;;;;;5;aaa;;;< dir;273;cds;group-specific protein;;;;;;;;;;comp;286;;23s;;;;;;;;;;;;;;;;;23s;55;;ttg;:16;;;;;comp;140;23s;dir    ;129;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;16s;403;;;23s;168;atc;11;cta;42;;cds;:21;5s;39;aaa;28;;aca;16;gaa;1;;;atc;10;aca;35;;comp;10;aca;;;;;;;dir    ;20;gaa;;;;comp;79;5s;;;;;;;comp;37;gac;;;;;;;dir    ;4;gaa;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;63;caa;;29;ggc;;3;cgt;comp;;;;;;;;141;23s;;;;;;;;14;ggc;;;;86;aaa;;;;;;;;;;;;;;;5;aaa;15;cta;comp;17;atgi;;;;;;;;10;ggc;;;comp;7;gaa;;;;;;;;;;;comp;506;;16s;;;;;;;;;;;;;;;;;5s;183;;;;;;;;comp;103;16s;dir    ;:20;cds;CBS domain-containing protein;*;;;dir    ;114;cds;SprT family protein;;;;;;;;;;;;;;;;;;cds;:23;cds;104;5s;15;gaa;5;aaa;8;;;;atc;20;gac;26;;gta;11;aac;10;;;gaa;13;ggc;8;;comp;5;cta;;;;;;;dir    ;36;gta;;;;comp;181;23s;;;;;;;comp;41;atgf;;;;;;;dir    ;24;gta;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;19;cac;;22;cta;;16;tta;comp;;;;;;;;:9;16s;;;;;;;;9;tta;;;;:8;gca;;;;;;;;;;;;;;;65;caa;5;aaa;comp;24;tca;;;;;;;;:9;gca;;;comp;4;agc;°;interc;;;;;;;;;dir     ;:21;;cds;MgtC/SapB family protein;;;;;;;;;;;;;;;;16s;164;;;;;;;;comp;:22;;cds;hp;;;;;;dir    ;3;aac;;;;;;;;;;;;;;;;;;;;;ggg;5;agc;29;gtc;5;caa;9;;;;gca;128;atgf;30;;5s;70;5s;70;;;tca;10;tta;11;;comp;73;aaa;;;;;;;dir    ;122;atgf;;;;comp;60;gca;;;;;;;comp;82;gta;;;;;;;dir    ;46;atgf;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;7;tgg;;9;cac;;29;ggc;comp;;;;;;;;;;;;;;;;;14;cgt;;;;;;;;;;;;;;;;;;;;16;tac;85;caa;comp;2;atgf;;;;;;;;;;;;comp;4;aac;comp;344;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;23s;55;;;;;;;;;interc;;;;;;;;;dir    ;8;agc;;;;;;;;;;;;;;;;;;;;;cca;106;atgj;39;atgf;4;tgg;4;;;;23s;130;gta;9;;23s;212;23s;468;;;atgf;2;cgt;7;;comp;18;gac;;;;;;;dir    ;28;gac;;;;comp;538;16s;;;;;;;comp;18;gaa;;;;;;;dir    ;38;gac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;17;tac;;4;aca;;13;cta;comp;;;;;;;;;;;;;;;;;6;cca;;;;;;;;;;;;;;;;;;;;5;gta;2;gac;comp;11;gac;;;;;;;;;;;;comp;11;atc;dir     ;242;16s;;;;;;;;Deuxième boîte, les blocs sont tous 16s23s5s-xaas,  (14  10  12  9), sauf la boîte 12 qui est 10aas-16s23s5s-atgf-gac.;;;;;;;;;;;;;;;;;;;;5s;:6;;;;;;;;dir    ;113;cds;SprT family protein;;;;;;;dir    ;4;gaa;dir    ;224;cds;hp;*;;;;;;;;;;;;;;;;cgt;11;gta;15;tgg;9;atgf;5;;;;agc;28;gaa;17;;gca;18;16s;:6;;;ttc;11;cca;:10;;comp;15;gta;;;;;;;dir    ;8;ttc;;;;comp;:26;cds;lysine--tRNA ligase;;;;;;comp;6;tcc;;;;;;;dir    ;21;ttc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;5;gta;;4;gta;;5;aaa;comp;;;;;;;;;;;;;;;;;:9;gca;;;;;;;;;;;;;;;;;;;;23;gaa;24;atgf;comp;14;ttc;;;;;;;;;;;;comp;13;gga;dir     ;149;23s;°;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;3;aac;;interc;;;;;;dir    ;25;gta;dir    ;141;16s;;;;;;;;;;;;;;;;;;ggc;5;atgf;14;caa;8;gtc;5;;;;atgj;10;tcc;3;;atc;89;;;;;tac;6;;;;comp;200;5s;;;;;;;dir    ;1;tac;;;;;;;;;;;;;comp;146;aac;;;;;;;dir    ;22;tac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;24;gaa;;97;5s;;87;caa;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;acc;5;gta;comp;10;aca;;;;;;;;;;;;comp;10;aaa;dir     ;8;5s;dir     ;218;cds;hp;;*;;dir    ;271;;cds;hp;;;;;dir    ;146;;cds;SprT family protein;;;;;;;;;;;;;;;;dir    ;8;agc;dir    ;372;cds;lysine--tRNA ligase;*;;;dir    ;3;atgf;dir    ;86;23s;;;;;;;;;;;;;;;;;;ctg;13;gac;48;aaa;18;gaa;11;;;;gta;4;aac;18;;16s;:28;;;;;tgg;14;16s;47;;comp;193;23s;;;;;;;dir    ;16;tgg;;;;dir    ;40;cds;ISL3 family transposase;;;;;;comp;97;23s;;;;;;;dir    ;10;tgg;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;acc;;141;23s;;46;gac;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8;aac;8;gaa;comp;12;aaa;;;;;;;;;;;;comp;14;aca;dir     ;5;aac;dir     ;242;16s;;;;;dir    ;284;;16s;;;;;;dir    ;4;;aac;;;;;;;;;;;;;;;;;dir    ;4;gaa;dir    ;140;16s;;;;;dir    ;87;gac;dir    ;9;5s;;;;;;;;;;;;;;;;;;ctc;16;ttc;5;ctg;4;atc;43;;;;aca;19;5s;76;;;;;;;;cac;6;gca;153;;comp;66;gca;;;;;;;dir    ;74;cac;;;;dir    ;69;rpr;;;;;;;comp;104;5s;;;;;;;dir    ;22;cac;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;aac;;:19;16s;;4;gta;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;98;5s;3;agc;comp;11;gga;;;;;;;;;;;;comp;9;ttc;dir     ;12;tcc;dir     ;145;23s;;;;;dir    ;143;;23s;dir    ;254;;cds;hp;dir    ;15;;agc;dir     ;307;;16s;suite2;;;;;;;;;;;;dir    ;26;gta;dir    ;97;23s;;;;;dir    ;5;caa;dir    ;4;aac;;;;;;;;;;;;;;;;;;aaa;10;aca;9;ggc;11;5s;94;;;;gac;77;23s;400;;;;;;;;caa;10;23s;72;;comp;345;16s;;;;;;;dir    ;5;ggc;;;;comp;3;cca;;;;;;;comp;378;16s;;;;;;;dir    ;3;caa;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;96;5s;;;;;8;gaa;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;141;23s;:13;aac;comp;4;atc;;;;;;;;;;;;comp;1;gac;dir     ;5;gaa;dir     ;8;5s;;;;;dir    ;10;;5s;dir    ;142;;16s;;dir    ;49;;gaa;dir     ;91;;23s;;;;;;;;;;;;;dir    ;3;atgf;dir    ;4;5s;;;;;dir    ;16;aaa;dir    ;22;acc;;;;;;;;;;;;;;;;;;tac;28;tac;15;cgt;12;23s;255;;;;ttc;6;16s;493;;;;;;;;ttg;:13;5s;3;;comp;:8;cds;ribosome-associated translation inhibitor RaiA;;;;;;dir    ;15;tgc;;;;comp;13;cgt;;;;;;;comp;:14;cds;hp;;;;;;dir    ;9;ggc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;141;23s;;;;;3;agc;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:9;16s;;;;8;aac;;;;;;;;;;;;comp;19;atgf;dir     ;23;gta;dir     ;4;aac;;;;;dir    ;7;;aac;dir    ;144;;23s;;dir    ;22;;gac;dir     ;7;;5s;;;;;;;;;;;;;dir    ;86;gac;dir    ;4;gta;;;;;dir    ;98;ctc;dir    ;5;gaa;;;;;;;;;;;;;;;;;;ttc;12;aaa;183;cca;577;16s;306;;;;tac;7;cds;:11;;;;;;;;;;gta;5;;;;;;;;;;;dir    ;215;ttg;;;;comp;15;tta;;;;;;;;;;;;;;;;dir    ;7;tgc;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:11;16s;;;;;:35;aac;comp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;6;agc;;;;;;;;;;;;comp;17;tca;dir     ;3;atgf;dir     ;23;acc;;;;;dir    ;18;;tcc;dir    ;10;;5s;;dir    ;8;;caa;dir     ;161;;gta;;;;;;;;;;;;;dir    ;5;caa;dir    ;13;aca;;;;;dir    ;4;cgt;dir    ;16;gta;;;;;;;;;;;;;;;;;;5s;159;cds;:9;cds;:11;cds;:12;;;;aaa;154;;;;;;;;;;;;gga;36;;;;;;;;;;;<>dir    ;:13;cds;hp;;;comp;11;ggc;;;;;;;;;;;;;;;;dir    ;219;ttg;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:22;gaa;;;;;;;;;;;;comp;4;atgi;dir     ;8;gac;dir     ;5;gaa;;;;;dir    ;4;;gaa;dir    ;26;;aac;;dir    ;62;;cta;dir     ;19;;aca;;;;;;;;;;;;;dir    ;17;aaa;dir    ;14;aaa;;;;;dir    ;1;cca;dir    ;65;tac;;;;;;;;;;;;;;;;;;23s;256;;;;;;;;;;cds;:10;;;;;;;;;;;;atc;10;;;;;;;;;;;;;;;;;comp;11;aca;;;;;;;;;;;;;;;;dir    ;:14;cds;ISL3 family transposase;*;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;17;atgj;dir     ;14;ttc;dir     ;9;gta;;;;;dir    ;20;;gta;dir    ;18;;acc;;dir    ;60;;ctc;dir     ;9;;aaa;;;;;;;;;;;;;dir    ;93;ctc;dir    ;29;cta;;;;;dir    ;76;gga;dir    ;5;caa;;;;;;;;;;;;;;;;;;16s;537;;;;;;;;;;;;;;;;;;;;;;;gaa;:5;;;;;;;;;;;;;;;;;comp;13;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;14;gca;dir     ;9;aca;dir     ;63;tac;;;;;dir    ;3;;atgf;dir    ;7;;gaa;;dir    ;16;;cgt;dir     ;8;;cta;;;;;;;;;;;;;dir    ;4;cgt;dir    ;16;ggc;;;;;dir    ;141;16s;dir    ;5;aaa;;;;;;;;;;;;;;;;;;cds;:9;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;2;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;8;cca;dir     ;7;tac;dir     ;5;caa;;;;;dir    ;38;;gac;dir    ;176;;gta;;dir    ;15;;cca;dir     ;5;;ggc;;;;;;;;;;;;;dir    ;1;cca;dir    ;3;tta;;;;;dir    ;45;23s;dir    ;10;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;7;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;3;cgt;dir     ;10;tgg;dir     ;5;aaa;;;;;dir    ;32;;ttc;dir    ;8;;aca;;dir    ;106;;gga;dir     ;13;;tta;;;;;;;;;;;;;dir    ;76;gga;dir    ;8;cgt;;;;;dir    ;12;5s;dir    ;117;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;82;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;10;tta;dir     ;113;cac;dir     ;10;ggc;;;;;dir    ;7;;tac;dir    ;46;;tac;;dir    ;308;;16s;dir     ;17;;cgt;;;;;;;;;;;;;dir    ;139;16s;dir    ;9;cca;;;;;dir    ;2;atgf;dir    ;:9;cds;glycerate kinase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;181;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;29;ggc;dir     ;4;caa;dir     ;97;gca;;;;;dir    ;14;;tgg;dir    ;8;;caa;;dir    ;91;;23s;dir     ;18;;cca;;;;;;;;;;;;;dir    ;46;23s;dir    ;:9;gca;;;;;dir    ;174;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;60;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;18;cta;dir     ;10;ggc;dir     ;:9;cds;glycerate kinase;;*;;dir    ;41;;cac;dir    ;56;;aaa;;dir    ;165;;5s;dir     ;:9;;gca;;;;;;;;;;;;;dir    ;12;5s;dir    ;-;16s;suite2;;;;dir    ;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;596;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;9;cac;dir     ;11;tgc;;;;;;;;dir    ;5;;caa;dir    ;6;;ggc;;dir    ;3;;atgf;dir     ;-;;16s;suite3;;;;;;;;;;;;dir    ;3;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;:9;cds;response regulator transcription factor;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;aca;dir     ;309;ttg;;;;;;;;dir    ;8;;ggc;dir    ;255;;gca;;dir    ;155;;gac;;;;;;;;;;;;;;;;;dir    ;174;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;4;gta;dir     ;:15;cds;HNH endonuclease;;;;;;;dir    ;6;;tgc;dir    ;:10;;cds;arginase;dir    ;:12;;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;dir    ;:14;cds;tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE;;;;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;144;5s;;;;;;;;;;;dir    ;132;;ttg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;237;23s;;;;;;;;;;;dir    ;:14;;cds;tyrosine-type recombinase/integrase;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;112;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;366;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;139;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;:22;cds;MgtC/SapB family protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;97;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;8;5s;dir     ;103;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;2;aac;dir     ;140;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;17;tcc;dir     ;86;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;4;gaa;dir     ;9;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;26;gta;dir     ;4;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;3;atgf;dir     ;21;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;9;gac;dir     ;5;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;18;ttc;dir     ;16;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;10;aca;dir     ;65;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;7;tac;dir     ;5;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;19;tgg;dir     ;5;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;63;cac;dir     ;10;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;5;caa;dir     ;116;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;14;ggc;dir     ;:9;cds;glycerate kinase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;10;tgc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir    ;144;ttg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;:15;cds;DUF3884 family protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;

génomes clostridia[modifier | modifier le wikicode]

62;Acetobacterium woodii DSM 1030 ;;;;67;Acetohalobium arabaticum DSM 5501 ;;;;;;;;;;;;;;;;51;Butyrivibrio proteoclasticus B316 ;;;;70;Clostridium beijerinckii 59B ;;;;87;Clostridium botulinum BKT015925 ;;;53;Clostridium botulinum CDC 297 ;;;81;Clostridium novyi NT ;;;;;77;Clostridium pasteurianum BC1 ;;;;;;53;Clostridium tetani 12124569 ;;;;54;Dehalobacter restrictus DSM 9455 PER-K23 ;;;;68;Desulfosporosinus acidiphilus SJ4 ;;;;;69;Eubacterium acidaminophilum DSM 3953 ;;;;;;;;;48;Filifactor alocis ATCC 35896 ;;;;;48;Finegoldia magna ATCC 29328 ;;;;;59;Halanaerobium hydrogeniformans ;;;;;78;Halobacteroides halobius DSM 5150 ;;;;;109;Heliobacterium modesticaldum Ice1 ATCC 51547 ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;98;Symbiobacterium thermophilum IAM 14863 IAM14863 ;;;;;48;Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 ;;;;;;53;Thermincola potens JR ;;;;;;57;Thermoanaerobacter brockii subsp. finnii Ako-1 ;;;;;;58;Thermoanaerobacterium thermosaccharolyticum DSM 571 ;;;
cd001;655;Chromosome;;;cd002;555;Chromosome ;;;cd003;11,10,10;chromosome;;110 tRNAs;;;;;;;;cd011;666;Chromosome;;;cd032;17,16,16;Chromosome;;;cd045;10,10,10;Chromosome;;cd047;554;Chromosome;;cd063;10,10,10;Chromosome;;;;cd064;999;Chromosome;;;;;cd079;546;Chromosome;;;cd084;444;Chromosome;;;cd092;898;Chromosome;;;;cd102;777;Chromosome;;;;;;;;cd112;444;Chromosome ;;;;cd113;444;Chromosome;;;;cd114;444;Chromosome;;;;cd116;555;Chromosome;;;;cd118;10,10,10;Chromosome;;;;;;;cd133;9,10,10;chromosome;;;;;;;;cd136;14,16,13;Chromosome;;;;;;;;;;;cd153;666;Chrpmosome;;;;cd155;533;Chromosome;;;;;cd160;333;Chromosome;;;;;cd161;444;Chromosome;;;;;cd170;555;Chromosome;;
3*16s23s5s;;;;;16atcgca235;;;;;3*16s23s5s;;;;;;;;;;;;16s5s23s;;;;;7*16s23s5s;;;;;3*16s23s5s;;;;16s23s5s;;;;4*16s23s5s;;;;;;16s23s5s;;;;;;;16s23s5s-atgi-gca;;;;;2*16-gca-235;;;;;5*16s23s5s;;;;;;2*16-gca-235;;;;;;;;;;16s23s-gca-5s-gta-tac-gga-cga;;;;;;16s-atc-235;;;;;;16atcgca235;;;;;;16s23s5s-aac;;;;;;2*16s5s-gcc-23s;;;;;;;;;3*16s23s5s;;;;;;;;;;s°   ribosomal RNA rRNA prediction is too short;;;;;;;;;;;;;2*16s23s5s;;;;;;16atcgca235;;;;;;;16-cds-atcgca-23s16s°5s  cds ci-dessous;;;;;;;2*16s23s5s;;;;;;;3*16s23s5s;;;;
16s-gcaatc-235-6aas;;;;;16atcgca235-6aas;;;;;16-gca-2355;;;beCoA;bifunctional enoyl-CoA hydratase/phosphate  acetyltransferase;;*;;;;;;16s5s23s-gac-aca;;;;;NCBI et gtRNAdb ne concordent pas.;;;;;16s23s5s-atgi-gca;;;;16s23s5s-aac;;;;16s23s-aac-5s-aac;;;;;;16s23s5s-atgi-gca;;;;;;;16s23s5s-aaa;;;;;16s23s5s;;;;;2*16atcgca235;;;;;;2*16s23s5s;;;;;;;;;;tcc-16s-cds-235-19aas;;;;;;16s23s5s;;;;;;2*16atcgca235-acc;;;;;;16s23s5s-caa-gaa-tac-ggc;;;;;;16s5s-gcc-23s-19aas;;;;;;;;;2*16s-gca-235;;;;;;;;;;s’ possible 23S ribosomal RNA but does not have good blast hits on one or both of the ends ;;;;;;;;;;;;;16s23s5s-gtg-gaa-cgg;;;;;;16s23s5s;;;;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;16s-23s°-gca-atc-23s-16s°-5s-6aas;;;;;;;16s23s5s-aac-ggg;;;;
5aas-16s-gcaatc-235-6aas;;;;;3*16s23s5s-12,9,4 aas;;;;;16-atc-235;;;2pK;two pore domain potassium channel family protein;;;;;;;;16s5s-atc-23s;;;;;2*16s23s5s-atgi-gca;;;;;16s23s5s-aaa;;;;16s23s5s-ttc;;;;16-gca-atc-23-aac;;;;;;2*16s23s5s-aaa;;;;;;;16s23s5s-ttc;;;;;16atcgca-cds-235;;;;;16-gca-235;;;;;;2*16-gca-235-22,21aas;;;;;;;;;;16s-cds-235;;;;;;16s-gca-235-11 aas;;;;;;16s23s5s-13 aas;;;;;;16atcgca235-acc;;;;;;16s5s-gcc-23s-5aas;;;;;;;;;16s23s-gga-5s;;;;;;;;;;;;;;;;;;;;;;;2*16s23s5s-12aas;;;;;;16s23s°23s5s;;;;;;;;long;interc;;;;;23s°-16s-16s°-23s-5s-aac-ggg;;;;;;;16-gcaatc-235-6aas;;;;
5s;;;;;interc;;interc;;;3*16s23s5s-22,13,9aas;;;Aspam;aspartate aminotransferase family protein;;;;;;;;agc-16s5s23s-6aas;;;;;16s23s5s-ttc-gac-gaa;;;;;16s23s-aac-5s-aac;;;;16s23s5s-aac-aac;;;;16s23s5s-ttc-5s-ttc-aaa;;;;;;16s23s5s-ttc;;;;;;;16s-atc-23s;;;;;;;;;;8aas-16s;;;;;;16s23s5s-8aas;;;;;;;;;;tcg-16s23s-gca-5s-12aas;;;;;;16s-gca-235-18 aas;;;;;;;;;;;;16s23s5s-8 aas;;;;;;16s5s23s-aaa-acc-ctc;;;;;;;;;16s23s5s-43aas;;;;;;;;;;C196;9,10,10;;M8;;;;;;;;;;16s23s5s-13aas;;;;;;16s23s°23s5s-5s-5s;;;;;;;<comp;411;185;cds;hp;;;;long;interc;;;;;;;;;
interc;;interc;;;80;16s;109;16s;;2*16-gca-235,22,13aas;;;;;;;;;;;;tca-tcc-16s5s23s-5aas;;;;;2*16s23s-aac-5s;;;;;16s23s5s-ttc-5s-ttc-aaa;;;;16s5s-atgi-gca;;;;16s23s5s-aaa;;;;;;16-atc-235-ttc-tgc;;;;;;;16s°-atc-235-atgi-gca;;;;;MLMPSVAHFNIAPSMARRSLSLFAIHGIAILEHPCSLKTAQREKQNAKCESKDNEMAFKF;;;*;;;;;;;;;;;;;;;;;;;;;;;;;interc;;;;;comp;184;cds;alanine--glyoxylate aminotransferase family protein;*;;16s23s5s-21 aas;;;;;;16s5s-atc-23s-aac;;;;;;;;;16s23s5s-18aas;;;;;;;;;;3*16s23s5s;;;3*16s23s5s;;;;;;;;;;;;;;;;;long;interc;;;;;dir    ;1541;12;16s;;;;dir     ;393;324;cds;30S ribosomal protein S9;*;;;interc;;;
226;aaa;169;aaa;;20;atc;109;23s;;cd003;long;inter;;;;;;;;;;16s5s-gca-23s-aac-gaa-tgc;;;;;16s-atc-23s-aac;;;;;16s-gca-atc-235-6aas;;;;interc;;long;;16s23s5s-atgi-gca;;;;;;16s23s5s-aac;;;;;;;23s5s-aaa;;;;;;;;;;comp;456;cds;cob(I)yrinic acid a,c-diamide adenosyltransferase;*;;interc;long;;interc;long;;interc;long;;;tcc-16s-cds-235-19aas hp ci-dessous;;;;;;dir    ;337;cds;peptidoglycan-binding protein;*;;comp;4;ggc;;;;;;;;;;16s5s-atcgca-23s-aac-atgf;;;;;;;;;16s-gca-235-9aas;;;;;;;;;;2*16s-gca-235;;;16s’-gca-23s°-16s°-23s    16s°-gca-23s’;;;;;;;;;;;interc;;;;;comp;1119;606;cds;sulfate permease;*;;dir    ;222;207;cds;hp;;;dir     ;1622;-1554;16s;;;;dir     ;353;cds;30S ribosomal protein S9;*
22;tac;23;tac;;53;gca;28;5s;;comp;1538;315;16s;suite1;;;;;;;;interc;;interc;;;5s-ttc;;;;;gca-atc-gga-16s23s5s;;;;3;gca;;;16-gca-atc-235-6 aas;;;;;;atgi-gca-16s23s5s-aac;;;;;;;interc;long; ;;;;;;;;comp;4;tta;;;;356;1911;cds;415;1605;cds;196;828;cds;;MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT;;;;*;;dir    ;42;16s;;;;comp;48;tac;;;;comp;381;cds;hp;;;15aas-16s5s-atcgca-23s;;;;;;;;;16s23s-aca;;;;;;;;;;16s23s-gga-5s;;;16s23s-gga-5s;;;;;;;;;;dir    ;463;cds;glutamate--tRNA ligase;*;;dir     ;1706;-1607;16s;;;;dir    ;77;94;atc;;;;dir     ;106;1501;23s°;;;;dir     ;273;16s;;
77;aca;163;aca;;109;23s;9;caa;;comp;74;8;gga;;;;;;;;;510;agc;59;tca;;16s-gca-23s5s;;;;;16s-gca-atc-23s-aac;;;;8;atgi;;;;;;;;;16s23s5s-5aas;;;;;;;200;2848;23s;comp;;;;;;;comp;11;tgc;;;;65;1534;16s;65;1534;16s;5;;gga;;;interc;;;;;dir    ;124;gca;;;;comp;8;gcc;;;;dir     ;95;16s;;;;cgg-tgg-16s5s-gcc-23s-5aas;;;;;;;;;;;;;;;;;;;16s23s-aca;;;16s23s-aca;;;;;;;;;;dir    ;212;16s;;;;dir     ;104;1767;23s°;;;;dir    ;76;356;gca;;;;dir     ;76;1;gca;;;;dir     ;1;gca;;
15;gac;15;gac;;27;5s;117;gaa;;comp;76;13;aca;;;;;;;;;61;16s;156;tcc;;16235-aaa-cds-5s-aaa;;;;;interc;;;;79;5s;;;;interc;;;;;;;;;;;;66;;atc;comp;;;;;;;comp;1;gga;;;;34;;gca;34;;gca;27;;ggc;;comp;403;cds;DUF2232 domain-containing protein;*;;dir    ;43;23s;;;;comp;6;acc;;;;dir     ;89;23s;;;;ttc-cds-16s5s-atc-23s-aac-atgf;;;;;;;;;long;interc;;;long;interc;;;;;16s23s5s-43aas ;;;16s-cds-23s°-5s-43aas;;;;;;;;;;dir    ;46;23s;;;;dir     ;3095;50;23s;;;;dir    ;3168;-2889;23s;;;;dir     ;77;64;atc;;;;dir     ;74;atc;;
53;gaa;53;gaa;;9;aac;5;gta;;comp;77;12;gac;;;long;interc;;;;;256;5s;61;16s;;16s-gcaatc-23s5s-ttc-tgc;;;;;61;gag;;;117;16s;;;comp;237;cds;DNA/RNA nuclease SfsA;;;;long;interc;;;;;166;553;16s°;comp;;;;;;;comp;7;aac;;;;93;2916;23s;93;2916;23s;79;;cta;;comp;109;agg;;;;dir    ;318;5s;;;;comp;74;gac;;;;dir     ;76;5s;;;;;;;;;;;;;1206;505;cds;glycosyl transferase;705;281;cds;N-acetylmuramoyl-L-alanine amidase CwlD;*;;16s23s5s-18aas ;;;cds-cds-23s°-5s-18aas;;;;;;;;;;dir    ;58;5s;;;;dir     ;114;602;5s;;;;dir    ;102;3026;16s°;;;;dir     ;3351;-3087;23s;;;;dir     ;266;23s;;
11;aac;11;aac;;132;caa;3;gac;;comp;77;83;atgf;;dir    ;909;505;cds;beCoA;;;76;23s;256;5s;;interc;long aas;;;;6;caa;;;:2;cds;108 pb;;comp;53;gag;;;;dir   ;255;844;cds;pro-sigmaK processing inhibitor BofA;*;;;;;;;;;;;;comp;61;agc;;;;5;117;5s;5;117;5s;11;;tac;;comp;6;tgc;;;;dir    ;3;aac;;;;comp;29;gta;;;;dir     ;22;caa;;;;interc;;interc;;interc;;interc;;;1508;279;16s;;1509;279;16s;;;;16s-gca-235-9aas ;;;16s°-23s°-5s-9aas;;;;;;;;;;dir    ;3;aac;;;;dir     ;3084;:0;cds;HAMP domain-containing protein;*;;dir    ;117;89;5s;;;;dir     ;86;3032;16s°;;;;dir     ;6;5s;;
346;5s;346;5s;;5;gta;8;aca;;comp;76;77;atgj;;dir    ;1538;61;16s;;;;34;gac;77;23s;;190;250;cds;direct;;4;aga;;;;;;;comp;6;caa;;;;dir   ;1513;235;16s;;;;6;;gca;comp;;;;;;;comp;6;acc;;;;17;;aac;11;;aac;6;;aca;;comp;41;cac;;;;dir    ;4;tta;;;;comp;11;gaa;;;;dir     ;54;gaa;;;;541;cds;260;cds;219;cds;487;cds;;2900;180;23s;;2901;131;23s;;;;;;;;;;;long;interc;;;;;dir    ;6;ggc;;;;;;;;;;;comp;1143;:2;cds;peptidase C45;;;dir     ;152;9;5s;;;;dir     ;6;aac;;
333;23s;330;23s;;3;gac;17;aaa;;comp;76;9;ttc;;dir    ;76;290;gca;;;;30;gta;41;aac;;5;;aaa;comp;;19;gga;;;;;;;comp;5;aga;;;;dir   ;2907;118;23s;;;;6;;atgi;comp;;;;;;;comp;6;tca;;;;7;;atgf;15;;tta;6;;gac;;comp;9;atgi;;;;dir    ;26;atgf;;;;comp;11;agc;;;;dir     ;128;gta;;;;253;16s;5;gac;236;23s;252;16s;;117;6;5s;;117;6;5s;;;;;;+;16s23s5s-19aas;;;dir   ;705;281;cds;N-acetylmuramoyl-L-alanine amidase CwlD;*;;dir    ;95;atgj;;;;16s23s5s-5s5s;;;;;;;;;;;;;;dir     ;75;6;aac;;;;dir     ;7;gaa;;
18;atc;18;atc;;8;aca;57;atgf;;comp;77;5;atc;;dir    ;2938;179;23s;;;;6;aca;5;gaa;;159;;5s;comp;;16;cta;;;;;;;comp;14;gga;;;;dir   ;117;26;5s;;;;107;117;5s;comp;;;;;;;comp;215;gac;;;;17;;gaa;7;;atgf;16;;gta;;comp;14;atgj;;;;dir    ;101;atgj;;;;comp;12;atgj;;;;dir     ;4;gac;;;;64;5s;10;gta;6;gca;64;5s;;75;6;aac;;75;4;aac;;;;;;+;16s23s5s-tta-atgi;;;dir   ;977;100;16s°;;;;dir    ;5;ttc;;;;dir     ;660;232;cds;sporulation protein YunB;*;;16-cds-atcgca-23s16s°5s  cds ci-dessous;;;;;;;dir     ;75;9;gaa;;;;dir     ;18;atgi;;
245;gca;92;gca;;:8;aaa;16;ttc;;comp;77;6;cca;;dir    ;117;8;5s;;;;66;tac;36;atgi;;294;316;cds;comp;;4;gaa;;;;;;;comp;17;cta;;;;dir   ;75;62;gaa;;;;200;2822;23s;comp;;;;;;;comp;47;16s;;;;5;;gta;17;;gaa;5;;gaa;;comp;4;ttc;;;;dir    ;7;gaa;;;;comp;36;gga;;;;dir     ;6;aca;;;;234;gcc;4;gaa;64;atc;6;atc;;86;15;tta;;75;5;gaa;;;;;;+;16s23s5s;;;dir   ;1519;126;23s°;;;;dir    ;6;tac;;;;dir     ;1656;-1583;16s;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;dir     ;76;25;atgi;;;;dir     ;13;gac;;
268;16s;:8;16s;;;;10;cta;;comp;76;22;tgg;;dir    ;75;5;aac;;;;6;atgf;57;gta;;7;;aaa;comp;;97;5s;;;;;;;comp;6;gaa;;;;dir   ;84;7;cta;;;;66;;atc;comp;;;;;;;dir;:8;cds;hp;;;9;;gac;5;;gta;93;117;5s;;comp;15;tca;;;;dir    ;41;gta;;;;comp;8;atgf;;;;dir     ;18;aaa;;;;119;23s;18;aaa;328;5s;229;gca;;76;7;atgf;;76;5;gta;;;;;;+;16’-gca-235-tta-atgi;;;dir   ;117;7;5s;;;;dir    ;7;ggc;;;;dir     ;107;1859;23s°;;;;;long;interc;;;;;dir     ;77;9;gac;;;;dir     ;269;ttc;;
9;tgc;;;;30;cca;8;gga;;comp;77;14;atgi;;dir    ;89;15;tta;;;;:7;ttc;:7;tta;;138;;5s;comp;;94;23s;;;;;;;comp;24;5s;;;;dir   ;75;7;ggc;;;;:3;1467;16s;comp;;;;;;;;;;;;;5;;aca;49;;gac;82;2916;23s;;comp;4;aaa;;;;dir    ;5;gac;;;;comp;20;aaa;;;;dir     ;4;gga;;;;6;tcc;103;caa;505;16s;112;23s;;75;9;gaa;;77;10;gac;;;;;;;;;;dir   ;75;6;aac;;;;dir    ;116;gtc;;;;dir     ;3267;50;23s;;;;comp;429;185;cds;hp;;;dir     ;76;29;ttc;;;;comp;186;acg;;
6;ggc;;;;56;gga;13;aga;;comp;77;9;cca;;dir    ;76;5;atgf;;;;;;;;;339;;23s;comp;;3;atc;;;;;;;comp;127;23s;;;;dir   ;74;3;gga;;;;;;;;;;;;;;;;;;;;7;;tac;8;;aca;510;1534;16s;;comp;10;caa;;;;dir    ;23;aca;;;;comp;29;caa;;;;dir     ;150;cca;;;;10;ccg;237;23s;1;ggc;6;aac;;74;5;gga;;75;14;aca;;;;;;+;23s5s;;;dir   ;86;15;tta;;;;dir    ;5;gac;;;;dir     ;114;330;5s;;;;dir    ;1541;12;16s;;;;dir     ;75;254;acg;;;;dir     ;:8;cds;HlyD family efflux transporter periplasmicadaptor subunit;*
311;ttc;;;;17;atgf;:12;cac;;comp;92;14;agc;;dir    ;77;9;atgj;;;;61;16s;;;;771;;16s;comp;;74;gca;;;;;;;comp;3;atc;;;;dir   ;77;509;aga;;;;;;;;;;;;;;;;;;;;9;;gga;24;;cta;:8;888;cds;;comp;11;aga;;;;dir    ;11;tac;;;;comp;32;5s;;;;dir     ;:8;cds;signal peptide peptidase SppA;*;;14;gga;64;gcc;32;ctg;243;atgf;;76;5;gta;;85;9;tac;;;;Décompte;;+;16s;;;dir   ;76;7;atgf;;;;dir    ;3;ctg;;;;dir     ;109;557;5s;;;;dir    ;222;207;cds;hp;;;dir     ;1287;:8;cds;tetratricopeptide repeat protein;*;;;;;;
12;gac;;;;8;aaa;;;;comp;89;8;tca;;dir    ;75;8;gaa;;;;5;5s;;;;:2;371;cds;comp;;:8;16s;;;;;;;comp;80;gca;;;;dir   ;693;;cds;DNA/RNA nuclease SfsA;;;;;;;;;;;;;;;;;;;10;;aga;9;;ggc;;;;;comp;6;ggc;;;;dir    ;39;ggc;;;;comp;94;23s;;;;;;;;;;1;cac;328;5s;42;ccc;:4;cds;;77;9;gac;;74;10;gga;;;;16s;14;;;;;dir   ;75;8;gaa;;;;dir    ;18;atc;;;;dir     ;109;564;5s;;;;dir    ;77;94;atc;;;;;;;;;;;;;;;
:13;gta;;;;3;aca;109;16s;;comp;76;4;aaa;;dir    ;76;125;gta;;;;212;gca;;;;;;;;;;;;;;;;;comp;405;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;8;;caa;23;;aga;;;;;comp;6;cta;;;;dir    ;875;cgt;;;;comp;680;16s;;;;comp;110;cds;tRNA 2-thiouridine(34) synthase MnmA  assembly pathway, ATPase PilB;*;;9;tgc;651;16s;4;cgt;;;;75;14;aca;;77;9;aga;;;;16s’;2;+;16s23s°-cds;;;dir   ;74;4;gga;;;;dir    ;2;acg;;;;dir     ;2277;:0;cds;5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase;*;;dir    ;76;186;gca;;;;;long;interc;;;;;;;;;
;;;;;5;gac;109;23s;;comp;76;6;caa;;dir    ;77;69;gac;;;;113;23s;;;;543;341;cds;comp;;;;;;;;;;comp;:8;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;34;;aaa;9;;caa;;;;;comp;28;aca;;;;dir    ;:12;cds;hp   4904 aas !!;;;comp;:13;cds;D-alanyl-D-alanine carboxypeptidase;*;;comp;131;riboswitch;;;;3;gtc;:6;cds;120;ggc;155;cds;;85;8;tac;;76;11;caa;;;;16s°;5;+;3*16s-23s°;;;dir   ;76;5;gta;;;;dir    ;145;tcg;;;;;;;;;;;dir    ;3166;-2889;23s;;;;comp;738;128;cds;SDR family oxidoreductase;*;;;;;;
;;;;;132;gta;28;5s;;comp;77;8;aga;;dir    ;85;39;tac;;;;43;aac;;;;140;;16s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;7;;tca;11;;aaa;;;;;comp;5;gac;;;;;;;;;;;;;;;;comp;133;cac;;;;6;ttc;;;42;atgj;213;ttc;;84;29;cta;;76;2;aaa;;;;23s;11;;;;;dir   ;77;10;gac;;;;dir    ;:12;cds;polyamine aminopropyltransferase;*;;;;;;;;;dir    ;102;3026;16s°;;;;comp;75;13;ggg;;;;;;;;
;;;;;8;gaa;8;caa;;comp;74;8;gga;;dir    ;83;321;cta;;;;13;gaa;;;;3;;gca;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;25;;ttc;24;;tca;;;;;comp;35;gta;;;;dir     ;430;cds;aminopeptidase;;;;;;;;;comp;9;aga;;;;4;tac;439;cds;16;agc;563;cds;;77;7;aga;;89;17;tca;;;;23s’;2;+;16s°-23s°-23s’-5s;;;dir   ;75;9;ggc;;;;;;;;;;;;;;;;;dir    ;117;336;5s;;;;comp;75;10;aac;;;;;;;;
;;;;;28;caa;139;gaa;;comp;76;13;aca;;dir    ;75;12;ggc;;;;:4;tgc;;;;111;;atc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;4;;atgj;5;;agc;;;;;comp;2;gaa;;;;dir     ;42;16s;;;;;;;;;;comp;13;gga;;;;17;caa;237;23s;6;atgf;252;16s;;76;88;caa;;91;8;agc;;;;23s°;11;+;23s°-5s;;;dir   ;74;954;aga;;;;dir     ;416;cds;DUF1646 domain-containing protein;*;;;;;;;;;comp;549;:2;cds;cytochrome c3;;;comp;109;32;5s;;;;;;;;
;;;;;109;5s;7;tac;;comp;77;125;gac;;dir    ;76;12;cac;;;;;;;;;70;;23s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;29;;atgi;7;;cca;;;;;comp;7;atgf;;;;dir     ;124;gca;;;;;;;;;;comp;13;ttc;;;;4;aaa;64;gcc;7;aac;64;5s;;89;3;tca;;77;85;cca;;;;5s;14;+;16s°gca-23s°;;;dir   ;840;:9;cds;TIGR00159 family protein;*;;dir     ;280;16s;;;;;;;;;;;;;;;;;;comp;3731;-350;23s;;;;;;;;
;;;;;109;23s;:4;ggc;;comp;76;12;gta;;dir    ;75;4;tgc;;;;;;;;;5;;5s;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;;cca;25;;atc;;;;;comp;8;tta;;;;dir     ;43;23s;;;;;;;;;;comp;4;atgf;;;;5;gaa;328;5s;4;gaa;141;atc;;76;6;ttc;;76;60;tgg;;;;;;;;;;;;;;;;;dir     ;46;23s;;;;;;;;;;;16s-cds-16s°-23s-cds-5s le 1er cds ci-dessous;;;;;;;comp;86;331;16s°;;;;;;;;
;;;;;:9;16s;;;;comp;75;6;gaa;;dir    ;77;642;cgt;;;;;;;;;4;;ttc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;9;;cac;40;;atgi;;;;;comp;29;aac;;;;dir     ;193;5s;;;;;;;;;;comp;10;aaa;;;;5;gta;460;16s;18;aaa;100;23s;;77;11;atgj;;77;6;cca;;;;;long;interc;;;;dir    ;774;179;cds;SigB/SigF/SigG family RNA polymerase sigma factor;*;;dir     ;6;5s;;;;;;;;;;;MRSRKKVVQKRAWQGRQTDGTGGVLMYVEDDMRLADAVRRSFSTTGNPRSIDHLSQDCLAVTSHCSVLRDHSS;;;;;*;;comp;1790;-1696;16s;;;;;;;;
;;;;;;;;;;comp;76;68;atgf;;comp;261;:14;cds;hp;;;;;;;;167;;tgc;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;8;;aaa;6;;tgg;;;;;comp;234;5s;;;;dir     ;3;aac;;;;;;;;;;comp;18;gcc;;;;7;gac;5;tgg;4;caa;6;aac;;77;23;atgi;;77;3;atc;;;;dir   ;645;214;cds;tyrosine-type recombinase/integrase;*;dir    ;1438;161;16s;;;;dir     ;5;aag;;;;;;;;;;;;long;interc;;;;;comp;447;1614;23s°;;;;;;;;
;;;;;;;;;;comp;117;126;5s;;;;;;;;;;;;;;:4;99;cds;direct;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;16;;tgc;47;;cca;;;;;comp;54;23s;;;;dir     ;4;tta;;;;;;;;;;comp;54;gta;;;;43;agc;207;cgg;91;tac;102;atgf;;77;7;cca;;76;7;ttc;;;;dir   ;459;554;cds;helix-turn-helix domain-containing protein;*;comp;117;201;5s;;;;dir     ;25;gag;;;;;;;;;;;dir   ;1242;56;cds;hp;;;comp;264;:2;cds;DUF1657 domain-containing protein;*;;;;;;
;;;;;;;;;;comp;2938;248;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;22;;cta;6;;atgi;;;;;comp;253;cds;hp;;;dir     ;129;atgf;;;;;;;;;;comp;39;gaa;;;;30;ccc;:3;cds;7;gtc;:4;cds;;77;8;cac;;77;114;atg;:18;;;dir   ;1740;0;cds;hypothetical protein;;comp;2893;217;23s;;;;dir     ;5;atgj;;;;;;;;;;;comp;117;126;5s;;;;;;;;;;;;;;;
;;;;;;;;;;comp;1538;589;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;88;;cgt;34;;ttc;;;;;comp;841;16s;;;;dir     ;7;gaa;;;;;;;;;;comp;133;cac;;;;3;ctg;;;325;tgc;;;;76;7;aaa;;1391;68;16s;;;;dir   ;204;168;cds;hp;;comp;1508;108;16s;;;;dir     ;5;ttc;;;;;;;;;;;dir   ;210;29;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;dir     ;819;:22;cds;2pK;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:22;279;cds;:23;;atgj;;;;;comp;54;tcc;;;;dir     ;41;gta;;;;;;;;;;comp;9;aga;;;;4;ggc;464;cds ;:17;cds;704;cds;;74;6;tgc;;76;271;gca;;;;dir   ;827;133;23s°;;;comp;77;11;atgi;;;;dir     ;6;tac;;;;;;;;;;;comp;3168;-381;23s;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;Comp;:20;cds;nucleoside deaminase;*;;dir     ;5;gac;;;;;;;;;;comp;7;gga;;;;4;cgt;327;16s;;;252;16s;;75;5;aac;;2900;126;23s;;;;dir   ;117;7;5s;;;comp;89;5;tta;;;;dir     ;7;ggc;;;;;;;;;;;comp;102;761;16s°;;;;;;;;;;;;;;;
;;;;;;;;;;;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;23;aca;;;;;;;;;;comp;13;cta;;;;352;acc;226;5s;;;64;5s;;86;15;tta;;117;213;5s;;;;dir   ;75;5;aac;;;comp;117;201;5s;;;;dir     ;31;gcc;;;;;;;;;;;comp;222;12;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;dir     ;819;135;cds;2pK;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;16s-cds-235  cds ci-dessous;;;;;;dir     ;35;tac;;;;;;;;;;comp;13;ttc;;;;:20;cds ;98;23s;;;194;atc;;76;7;atgf;;1185;372;cds;pyridoxal phosphate-dependent aminotransferase;*;;dir   ;75;6;gaa;;;comp;2900;375;23s;;;;dir     ;19;gtc;;;;;;;;;;;comp;1541;185;16s;;;;;;;;;;;;;;;
;;;;;;;;;;comp;74;36;gga;;;long;interc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;MRKEGAYKRYVTDRRRNPTKKIPKSEARKVFLKRRRSVKHCNFTESKREQTKAIQSERKQAENNKFSKVKTFTRYFFVNSRRMMRREGVYINT;;;;*;;dir     ;5;gga;;;;;;;;;;comp;4;atgf;;;;;;4;aaa;;;112;23s;;75;9;gaa;;2352;21;cds;anaerobic ribonucleoside triphosphate reductase;*;;dir   ;76;6;gta;;;comp;76;52;gca;;;;dir     ;5;gac;;;;;;;;;;;dir   ;447;:0;cds;hp;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;83;atgj;;comp;1422;126;cds;Aspam;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir     ;7;aga;;;;;;;;;;comp;6;aaa;;;;;;8;acc;;;109;aac;;74;5;gga;;540;776;cds;anaerobic ribonucleoside-triphosphate reductase  activating protein;*;;dir   ;77;12;gac;;;comp;1264;100;16s’;;;;dir     ;49;ctg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;77;atgf;;comp;76;9;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;tcg-16s23s-gca-5s-12aas;;;;;;dir     ;4;gaa;;;;;;;;;;comp;4;aca;;;;;;89;ctc;;;:2;cds;;76;5;gta;;1508;52;16s;;;;dir   ;75;15;aca;;;dir    ;1166;52;16s’;;;;dir     ;3;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;9;ttc;;comp;77;5;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;50S ribosomal protein L32 ci-dessous;;;;;;dir     ;5;aaa;;;;;;;;;;comp;5;gac;;;;;;:3;cds;;;;;;77;9;gac;;76;373;gca;;;;dir   ;85;10;tac;;;dir    ;76;248;gca;;;;dir     ;9;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;5;atc;;comp;76;4;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;MAVPKRKTAKSATRSRRSANMKMTAKTLVKCSNCGEFALPHHVCAECGHYKGREVIAK;;;;*;;dir     ;19;tca;;;;;;;;;;comp;55;gta;;;;;;;;;;;;;75;14;aca;;2900;126;23s;;;;dir   ;74;11;gga;;;dir    ;596;100;23s°;;;;Dir;:13;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;6;cca;;comp;75;27;ggc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;118;cds;CDP-archaeol synthase;*;;dir     ;20;agc;;;;;;;;;;comp;22;gaa;;;;;;;;;;;;;85;9;tac;;117;7;5s;;;;dir   ;77;10;aga;;;dir    ;577;321;16s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;22;tgg;;comp;83;137;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;57;tgg;;;;dir     ;69;atgi;;;;;;;;;;comp;76;caa;;;;;;;;;;;;;84;23;cta;;75;5;aac;;;;dir   ;76;12;caa;;;dir    ;2228;100;23s;;;;comp;333;cds;MFS transporter;*;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;14;atgi;;comp;85;12;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;6;atc;;;;dir     ;0;ttc;;;;;;;;;;comp;90;5s;;;;;;;;;;;;;75;24;ggc;;86;15;tta;;;;dir   ;76;3;aaa;;;dir    ;568;320;16s°;;;;comp;80;ccg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;9;cca;;comp;76;13;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;13;cca;;;;dir     ;135;tgg;;;;;;;;;;comp;95;23s;;;;;;;;;;;;;77;9;aga;;76;7;atgf;;;;dir   ;89;19;tca;;;dir    ;1633;100;23s°;;;;comp;6;ccc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;92;14;agc;;comp;77;126;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;26;agc;;;;dir     ;86;cgg;;;;;;;;;;comp;404;16s;;;;;;;;;;;;;76;8;caa;;75;14;gaa;;;;dir   ;91;9;agc;;;dir    ;2449;126;23s’;;;;comp;4;gcc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;89;8;cta;;comp;76;12;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;16;aag;;;;comp;:19;cds;prepilin-type N-terminal cleavage/methylation domain-containing protein;*;;;;;;;;comp;:21;cds;tRNA 2-thiouridine(34) synthase MnmA;*;;;;;;;;;;;76;2;aaa;;74;5;gga;;;;dir   ;77;86;cca;;;dir    ;117;127;5s;;;;comp;8;cac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;4;aaa;;comp;75;6;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;18;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;89;3;tca;;76;5;gta;;;;dir   ;76;61;tgg;;;dir    ;510;;cds;transcription repressor NadR;*;;comp;7;tgg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;27;ggc;;comp;76;15;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;63;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;6;ttc;;77;10;gac;;;;dir   ;77;6;cca;;;;;;;;;;comp;5;cgg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;83;84;cta;;comp;89;5;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;10;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;11;atgj;;75;9;ggc;;;;dir   ;77;4;atc;;;comp;660;228;cds;type A-1 chloramphenicol O-acetyltransferase;*;;comp;34;cgt;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;85;12;tac;;comp;75;8;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;28;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;17;atgi;;74;975;aga;;;;dir   ;76;8;ttc;;;dir    ;1351;321;16s;;;;comp;5;acc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;13;aca;;comp;117;126;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;8;cac;;840;:10;cds;TIGR00159 family protein;;;dir   ;77;115;atgj;:18;;dir    ;488;101;23s°;;;;comp;4;ctg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;77;125;gac;;comp;2938;349;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;35;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;7;aaa;;;;;;;;dir   ;1198;1;16s;;;comp;1420;250;23s°;;;;comp;47;ctc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;12;gta;;comp;1538;:13;16s;suite1;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;5;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;74;7;tgc;;;;;;;;dir   ;687;100;cds;xylose isomerase;;comp;76;52;gca;;;;comp;5;gag;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;6;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;172;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;77;12;cgt;;;;;;;;dir   ;796;182;23s°;;;comp;564;100;16s°;;;;comp;112;cag;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;14;atgf;;comp;1538;378;16s;suite2;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;62;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;76;75;gta;;;;;;;;dir   ;117;7;5s;;;comp;285;217;23s°;;;;comp;44;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;89;5;tta;;comp;76;9;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;606;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;414;:43;cds;hp;;;;;;;dir   ;75;7;aac;;;comp;1508;179;16s;;;;comp;281;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;75;8;aac;;comp;77;4;atc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;495;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;86;16;tta;;;>comp;446;386;cds;B/F/G family RNA polymerase sigma-70 factor;*;;comp;914;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;117;179;5s;;comp;76;4;aaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;comp;200;tcg;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;atgf;;;dir    ;1508;321;16s;;;;comp;:12;cds;ABC transporter permease;*;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;2938;166;23s;;comp;76;6;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;Comp;:14;cds;50S ribosomal protein L32;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;10;gaa;;;dir    ;2900;181;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;76;61;gca;;comp;77;8;aga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;6;gga;;;dir    ;117;6;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;comp;1538;:23;16s;suite2;comp;74;8;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;6;gta;;;dir    ;75;6;aac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;76;133;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;gac;;;dir    ;86;15;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;76;12;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;15;aca;;;dir    ;76;7;atgf;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;75;4;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;85;11;tac;;;dir    ;75;9;gaa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;117;161;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;84;29;cta;;;dir    ;74;5;gga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;2938;381;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;8;aga;;;dir    ;76;5;gta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;1538;472;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;90;caa;;;dir    ;77;9;gac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;comp;387;:9;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;89;4;tca;;;dir    ;75;14;aca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;7;ttc;;;dir    ;85;10;tac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;12;atgj;;;dir    ;84;28;cta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;30;atgi;;;dir    ;77;7;aga;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;8;cca;;;dir    ;76;89;caa;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;9;aca;;;dir    ;89;3;tca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;aaa;;;dir    ;76;6;ttc;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;7;tgc;;;dir    ;77;11;atgj;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;7;aac;;;dir    ;77;29;atgi;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;86;16;tta;;;dir    ;77;7;cca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;atgf;;;dir    ;77;8;cac;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;10;gaa;;;dir    ;76;353;aaa;:19;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;6;gga;;;comp;117;126;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;6;gta;;;comp;2036;582;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;gac;;;dir    ;1506;217;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;15;aca;;;dir    ;2900;126;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;85;10;tac;;;dir    ;117;216;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;84;25;cta;;;comp;1185;372;cds;pyridoxal phosphate-dependent aminotransferase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;75;25;ggc;;;dir    ;2352;21;cds;anaerobic ribonucleoside triphosphate reductase;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;10;aga;;;dir    ;540;778;cds;anaerobic ribonucleoside-triphosphate reductase activating protein;*;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;9;caa;;;dir    ;1537;261;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;3;aaa;;;dir    ;2899;201;23s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;89;4;tca;;;dir    ;117;5;5s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;7;ttc;;;dir    ;89;11;tta;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;12;atgj;;;dir    ;77;108;atgi;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;18;atgi;;;dir    ;1508;184;16s;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;9;cac;;;dir    ;645;100;23s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;8;aaa;;;<dir    ;259;112;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;74;8;tgc;;;comp;2110;375;23s’;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;77;13;cgt;;;comp;76;52;gca;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;76;76;gta;:43;;comp;578;282;16s°;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;414;308;cds;hp;;dir    ;204;12;cds;hp;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;dir   ;3432;;cds;pyruvate carboxylase;;dir    ;1278;;cds;phage portal protein;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;

génomes negativicutes[modifier | modifier le wikicode]

77;Lactobacillus salivarius UCC118 ;;;;;;;;99;Pelosinus sp. UFO1 ;;73;Selenomonas ruminantium subsp. lactilytica TAM6421 ;;;;55;Selenomonas sputigena ATCC 35185 ;
en004;777;Chromosome;;;;;;;en010;16,15,14;Chromosome;;en011;777;Chromosome;;en012;444;Chromosome
16s23s5s;;;;;;;;;6*16s23s5s;;;;4*16s23s5s;;;;16s23s5s;;
16atcgca235-9aas;;;;;;;;;3*16atcgca235;;;;16-gcaatc-235-cac-tgg-agc;;;;16-gca-atc-235;;
2*16atcgca235-12aas;;;;;;;;;16-gca-235;;;;16-gcaatc-2355-13 aas;;;;16s23s5s-cac-tgg;;
16235-19aas;;;;;;;;;16s23s5s-5s;;;;16s23s;;;;16s23s5s-12aas;;
16s23s5s-cds-tac-caa;;;;;;;;;16-gca-235-aac;;;;interc;;;;interc;;
16235-aac-gaa-acg;;;;;;;;;16atcgca235-aac;;;;133;cds ;comp ;;320;cds;comp
;;;;;;;;;16s23s5s-acc;;;;87;16s;;;27;ctc;comp
interc;;interc;;interc;;interc;;;16s-23s°;;;;4;gca;;;31;ctg;comp
331;cds;356;cds;3;caa;15;acg;;gga-5s-5aas-ncRNA-9aas;;;;168;atc;;;10;tta;comp
103;16s;13;16s;151;tac;4;gaa;;;interc;;;70;23s;;;12;gga;comp
31;atc;244;23s;248;cds;5;aac;;;212;gga;;4;5s;;;8;aca;comp
126;gca;5;5s;35;5s;240;5s;;;8;5s;;26;5s;;;5;ttc;comp
244;23s;3;gta;13;23s;13;23s;;;5;aac;;24;aac;;;4;gac;comp
5;5s;65;aaa;:2;16s;:3;16s;;;53;atg;;6;caa;;;61;gta;comp
14;aac;4;aca;;;;;;;14;cac;;8;aaa;;;41;aag;comp
14;tcc;12;ggc;527;cds;30;ttg;;;4;caa;;7;gaa;;;4;aaa;comp
2;gaa;8;tta;103;16s;24;tgc;;;44;agc;;6;aag;;;18;caa;comp
9;gta;6;cgt;31;atc;10;caa;;;25;ncRNA;;6;gta;;;4;aac;comp
25;gac;24;cca;126;gca;6;cac;;;6;cgt;;39;gac;;;174;5s;comp
4;ttc;16;atg;244;23s;12;tgg;;;1;ttc;;10;ttc;;;406;23s;comp
12;tac;40;atg;5;5s;4;tac;;;9;aca;;14;aca;;;159;16s;comp
6;tgg;10;tca;3;gta;25;ttc;;;11;tac;;18;gga;;;293;cds;dir
11;cac;4;atg;15;aaa;9;gac;;;2;aaa;;23;tta;;;24;cgt;comp
9;caa;9;gac;8;cta;2;gta;;;6;gaa;;55;ctg;;;74;atg;comp
30;tgc;19;ttc;4;aca;14;gaa;;;20;gta;;102;ctc;;;5;ggc;comp
149;ttg;8;gga;9;ggc;14;tcc;;;3;gac;;:15;cds;;;105;ggc;comp
:14;cds;3;atc;8;tta;5;aac;;;:15;ggc;;;;;;:15;cds;comp
;;4;agc;47;cgt;244;5s;;;;;;;;;;;;
;;22;gaa;4;cgt;126;23s;;;;;;;;;;;;
;;4;atg;403;cca;31;gca;;;;;;;;;;;;
;;201;gac;:11;cds;103;atc;;;;;;;;;;;;
;;:19;cds;;;:14;16s;;;;;;;;;;;;

Proteobacteria[modifier | modifier le wikicode]

Gamma[modifier | modifier le wikicode]

gamma blocs[modifier | modifier le wikicode]

lien;blocs;;16s;total aas;avec;sans;total page;Gm001-47;;;;;;;;;Notes
gm0001;atgf-16atcgca235;;2;54;3;51;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235;;;;;;;sans;;27;;11;1;;4;;avant
;;;;;;;;gac-tgg;;1;;0;;;3;;3*atgf-16atcgca235
gm0003;atgf-16atcgca235;;2;51;3;48;;gac;;1;;3;;;;;cgg-cac-cca-16atcgca2355-gac-tgg
;16atcgca235;;;;;;;acc-5s;;;;;;;;;cgg-cac-cca-16atcgca235
;;;;;;;;tgg;;;;;;;;;2*cgg-cac-cca-16gaa2355-gac-tgg
gm0005;atgf-16atcgca235;;2;50;3;47;51;total;0;29;0;14;1;0;7;;
;16atcgca235;;;;;;;;;;;;;;;;incomplets
;;;;;;;;;;;;;;;;;16gaa23?
gm0017;16atcgca235 +5s;;1;63;2;61;;;;;;;;;;;
;;;;;;;;;;;;;;;;;différents
gm0036;6*16atcgca235;;6;70;12;58;;;;;;;;;;;16gaa235-acc
;;;;;;;;;;;;;;;;;16atcgca235-acc
gm0037;6*16atcgca235;;6;72;12;60;;;;;;;;;;;
;;;;;;;;;;;;;;;;;5s en trop
gm0039;2*16atcgca235;;6;64;14;50;;;;;;;;;;;16atcgca2355-gac-tgg
;3*16gaa235;;;;;;;;;;;;;;;;cgg-cac-cca-16atcgca2355-gac-tgg
;cgg-cac-cca-16atcgca2355-gac-tgg;;;;;;;;;;;;;;;;2*cgg-cac-cca-16gaa2355-gac-tgg
;;;;;;;;;;;;;;;;;5s
gm0040;16atcgaa235;;6;64;16;48;;;;;;;;;;;
;cgg-cac-cca-16gaa2355-gac-tgg;;;;;;;;;;;;;;;;
;4*16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0043;16atcgca235;;6;61;14;47;;;;;;;;;;;
;cgg-cac-cca-16atcgca235;;;;;;;;;;;;;;;;
;16atcgca2355-gac-tgg;;;;;;;;;;;;;;;;
;3*16gaa235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0045;2*16gaa235;;6;60;14;46;;;;;;;;;;;
;cgg-cac-cca-16gaa2355-gac-tgg;;;;;;;;;;;;;;;;
;3*16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0047;3*16gaa235+16gaa23?;;11;129;20;109;;;;;;;;;;;
;3*16gaa235-gac;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16atcgca235-acc;;;;;;;;;;;;;;;;
;16gaa235-acc;;54;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm055-64;;;;;;;;;Notes
gm0055;3*16gaa235;;;131;17;114;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235;;;;;;;sans;4;10;;11;;;1;;avant
;2*16atcgca235-gac;;;;;;;gac-tgg;;1;;0;;;1;;cgg-cac-cca-16atcgca235-x-tgg
;16gaa235-acc;;;;;;;gac;;2;;6;2;;;;cgg-cac-cca-16atcgca235
;16gaa235-acc-5s;;;;;;;acc- 5s;;2;;1;;;;;
;16gaa235-gac;;9;;;;;tgg;;;;;;;;;différents
;;;;;;;41;total;4;15;0;18;2;0;2;;2*16gaa235-acc
gm0056;3*16gaa235;;;111;17;94;;;;;;;;;;;16atcgca235-acc
;3*16gaa235-gac;;;;;;;;;;;;;;;;16gaa235-tca
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;5s en trop
;16atcgca235-acc;;9;;;;;;;;;;;;;;16atcgca2355-gac-tgg
;;;;;;;;;;;;;;;;;
gm0057;3*16gaa235;;;103;18;85;;;;;;;;;;;
;2*16gaa235-gac;;;;;;;;;;;;;;;;
;2*16atcgaa235-gac;;;;;;;;;;;;;;;;
;16gaa235-tca;;;;;;;;;;;;;;;;
;16atcgaa235-acc-5s;;;;;;;;;;;;;;;;
;16gaa235-acc;;10;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0058;2*16atcgca235;;;52;13;39;;;;;;;;;;;
;2*16gaa235;;;;;;;;;;;;;;;;
;cgg-cac-cca-16atcgca235-x-tgg;;;;;;;;;;;;;;;;
;16s23s5s;;6;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0062;4*16atcgca235;;;60;17;43;;;;;;;;;;;
;cgg-cac-cca-16atcgca235;;;;;;;;;;;;;;;;
;16atcgca2355-gac-tgg;;6;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0063;2*16s23s5s;;;43;2;41;;;;;;;;;;;
;16atcgca235;;3;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0064;16atcgca235;;2;45;2;43;;;;;;;;;;;
;16s23s5s;;45;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm065-73;;;;;;;;;Notes
gm0065;2*16atcgca235;;2;48;4;44;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;;;;;;;;sans;11;8;2;;;6;;;autres
gm0066;2*16s23s5s;;;104;26;78;;gac-tgg;;;;1;;1;;;16gcc235-gac-tgg
;2*16s23s5s-gac;;;;;;;gac;4;1;;1;;2;;;16 atc-gcc 235-gac
;16s23s5s-acc-5s;;;;;;;acc-5s;2;;;;;;;;16-gaa-aaa-gta-235
;16atcgca235;;;;;;;tgg;;;;;;1;;;16-gaa-aaa-gta-235-gac
;16atcgca235-gac;;;;;;40;total;17;9;2;2;0;10;0;;16-gaa-aaa-gta-235-tgg
;16gcc235-gac-tgg;;;;;;;;;;;;;;;;16-gaa-aaa-gca-gta-235
;16-gaa-aaa-gta-235;;;;;;;;;;;;;;;;4*16-gca-cca-235
;16-gaa-aaa-gta-235-gac;;;;;;;;;;;;;;;;
;16-gaa-aaa-gta-235-tgg;;;;;;;;;;;;;;;;incomplets
;16-gaa-aaa-gca-gta-235;;12;;;;;;;;;;;;;;16s-gaa-aaa-gta-5s
;;;;;;;;;;;;;;;;;
gm0067;2*16235-gac;;;91;14;77;;;;;;;;;;;à l’envers
;16 atc-gcc 235-gac;;;;;;;;;;;;;;;;2*5s-23s-16s
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;16235-acc-5s;;;;;;;;;;;;;;;;
;16s-gaa-aaa-gta-5s;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0068;2*16atcgca235;;2;49;4;45;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0069;3*16atcgca235;;3;54;6;48;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0070;2*16s23s5s;;;68;6;62;;;;;;;;;;;
;3*16-gca-cca-235;;5;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0071;16-gca-cca-235;;5;57;2;55;;;;;;;;;;;
;4*16s23s5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0073;2*16-gca-atc-235;;5;54;4;50;;;;;;;;;;;
;2*5s-23s-16s;;;;;;;;;;;;;;;;
;16s23s5s5s;;41;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm079-129;;;;;;;;;Notes
gm0079;2*16-gca-atc-235;;5;77;10;67;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16-gca-atc-2355;;;;;;;sans;2;13;3;3;;;1;;avant
;2*5s-23s-cp(atc-gca)-16s;;;;;;;gac-tgg;;2;;1;;;;;cgg-cac-cca-16atcgca235
;;;;;;;;gac;;1;;1;;;;;
gm0086;6*16atcgca235;;12;70;12;58;;acc-5s;;;;;;;;;incomplets
gm0087;6*16atcgca235;;;66;12;54;;tgg;;1;;2;;;;;16gaa23
;;;;;;;30;total;2;17;3;7;0;0;1;;2*16atcgca23
gm0090;2*16gaa235;;6;58;15;43;;;;;;;;;;;2*16s23s
;16gaa235-gac-5s;;;;;;;;;;;;;;;;
;cgg-cac-cca-16atcgca235;;;;;;;;;;;;;;;;à l’envers
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;2*5s-23s-cp(atc-gca)-16s
;16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;autres incomplets
gm0094;16gaa23+5s;;1;38;1;37;;;;;;;;;;;gaa-23s5s-gac
;;;;;;;;;;;;;;;;;
gm0098;16atcgca23+gaa-5s;;1;32;3;29;;;;;;;;;;;5s en trop
;;;;;;;;;;;;;;;;;16-gca-atc-2355
gm0114;16gaa235;;2;40;4;36;;;;;;;;;;;16gaa235-gac-5s
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;2*5s
;;;;;;;;;;;;;;;;;gaa-5s
gm0115;16atcgca23+5s;;1;41;2;39;;;;;;;;;;;atc-5s-aaa
;;;;;;;;;;;;;;;;;
gm0119;16s23s;;1;27;0;27;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0126;16s23s + atc-5s-aaa;;1;33;2;31;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0127;2*16gaa235-tgg;;3;45;7;38;;;;;;;;;;;
;16atcgca235-tgg;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0128;2*16s23s5s;;3;37;4;33;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0129;16atcgca235-gac;;1;42;5;37;;;;;;;;;;;
;gaa-23s5s-gac;;37;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm131-150;;;;;;;;;Notes
gm0131;16gaa235;;;40;3;37;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16s23s5s;;;;;;;sans;2;16;;9;;1;;;autres
;16gaa23-tgg;;3;;;;;gac-tgg;;1;;3;;;;;16-atc-235
;;;;;;;;gac;;;;3;;;;;
gm0137;16-atc-235;;1;33;1;32;;acc-5s;;2;;1;;;;;incomplets
;;;;;;;;tgg;;;;;;;;;16gaa23-tgg
gm0140;16atcgca235;;2;33;3;30;38;total;2;19;0;16;0;1;0;;16atcgca
;16gaa235;;;;;;;;;;;;;;;;2*16s
;;;;;;;;;;;;;;;;;
gm0141;16atcgca235;;1;37;2;35;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0142;16atcgca235+16atcgca;;5;57;7;50;;;;;;;;;;;
;16gaa235-gac-tgg+2*16s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0143;2*16atcgca235;;;83;14;69;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;2*16gaa235;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-gac;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0147;3*16atcgca235;;3;49;6;43;;;;;;;;;;;
gm0148;5*16atcgca235;;5;70;10;60;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0149;3*16gaa235;;;84;14;70;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16gaa235-gac;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0150;2*16gaa235;;;84;13;71;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;2*16atcgca235;;7;;;;;;;;;;;;;;
;16gaa235-acc-5s;;42;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm151-169;;;;;;;;;Notes
gm0151;2*16gaa235;;;87;14;73;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16gaa235-gac;;;;;;;sans;;13;;5;;9;;;autres
;2*16atcgca235;;;;;;;gac-tgg;;2;;1;;;;;7*16-gca-cds-235
;16gaa235-gac-tgg;;;;;;;gac;;1;;2;;;;;16-atc-235
;16atcgca235-acc-5s;;7;;;;;acc-5s;;2;;1;;;;;16-atc-235
;;;;;;;;tgg;;;;;;;;;
gm0152;7*16-gca-cds-235;;;89;10;79;36;total;0;18;0;9;0;9;0;;différents
;16-atc-2355-tac;;;;;;;;;;;;;;;;16-atc-2355-tac
;16-atc-235;;9;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;incomplets
gm0155;16atcgca235;;;44;2;42;;;;;;;;;;;16atcgca23
gm0158;16atcgca23+5s;;;43;2;41;;;;;;;;;;;
gm0161;16atcgca235;;3;39;2;37;;;;;;;;;;;cds
;;;;;;;;;;;;;;;;;7*16-gca-cds-235
gm0162;2*16gaa235;;;85;14;71;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;5s en trop
;16gaa235-acc-5s;;;;;;;;;;;;;;;;5s
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;16-atc-2355-tac
;2*16atcgca235;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0166;2*16atcgca235;;;86;16;70;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16-atc-235;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0167;16atcgca235;;1;36;2;34;;;;;;;;;;;
gm0168;16atcgca235;;1;36;2;34;;;;;;;;;;;
gm0169;3*16atcgca235;;3;47;6;41;;;;;;;;;;;
;;;38;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm170-182;;;;;;;;;Notes
gm0170;3*16gaa235;;;76;13;63;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235;;;;;;;sans;;8;;18;;;;;différents
;16gaa235-gac;;;;;;;gac-tgg;;3;;2;;;;;2*16gaa235-gac-gac
;16atcgca235-gac-tgg;;;;;;;gac;;;;3;;;;;
;16gaa235-acc-5s;;7;;;;;acc-5s;;3;;2;;;;;
;;;;;;;;tgg;;;;;;;;;
gm0173;3*16gaa235;;;91;14;77;39;total;0;14;0;25;0;0;0;;
;16atcgca235;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0175;2*16atcgca235;;2;53;4;49;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0177;3*16gaa235;;;95;15;80;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0178;5*16gaa235;;;96;15;81;;;;;;;;;;;
;16gaa235-gac-gac;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0180;4*16gaa235;;;96;14;82;;;;;;;;;;;
;16gaa235-gac-gac;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;8;;;;;;;;;;;;;;
;;;1;;;;;;;;;;;;;;
gm0182;16atcgca235;;41;43;2;41;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm183-202;;;;;;;;;Notes
gm0183;4*16gaa235;;;90;15;75;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235-gac;;;;;;;sans;3;6;;14;;;;;différents
;16atcgca235;;;;;;;gac-tgg;;5;;;;;;;16s23s5s-acc-5s-acc-5s
;16atcgca235-gac-tgg;;;;;;;gac;;5;;;;;;;16gaa235-ttc
;16s23s5s-acc-5s-acc-5s;;8;;;;;acc-5s;;;;4;;;;;
;;;;;;;;tgg;;;;;;;;;5s en trop
gm0185;2*16gaa235;;;85;15;70;37;total;3;16;0;18;0;0;0;;16s23s5s-acc-5s-acc-5s
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-ttc;;;;;;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0190;3*16gaa235;;;90;14;76;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0198;2*16atcgca235;;;89;15;74;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;2*16gaa235;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16s23s5s;;8;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0202;3*16gaa235;;;83;14;69;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16atcgca235;;7;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;39;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm203-211;;;;;;;;;Notes
gm0203;3*16gaa235;;;87;14;73;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235-gac;;;;;;;sans;2;6;;15;;;;;différents
;16gaa235-acc-5s;;;;;;;gac-tgg;;4;;1;;;;;16gaa235-ttc
;16atcgca235;;;;;;;gac;;4;;1;;;;;
;16atcgca235-gac-tgg;;7;;;;;acc-5s;;1;;3;;;;;incomplets
;;;;;;;;tgg;;;;;;;;;16s-atc-gca-tgg
gm0204;3*16gaa235;;;89;18;71;37;total;2;15;0;20;0;0;0;;16s-23s°-5s-gac
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16s-atc-gca-tgg;;;;;;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;16s-23s°-5s-gac;;10;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0205;4*16gaa235;;;88;15;73;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-ttc;;;;;;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;9;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0206;3*16atcgca235;;;79;15;64;;;;;;;;;;;
;16gaa235;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0211;4*16gaa235;;;78;13;65;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-gac;;7;;;;;;;;;;;;;;
;16atcgca235;;40;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm212-319;;;;;;;;;Notes
gm0212;2*16atcgca235;;;76;14;62;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16gaa235-gac-tgg;;;;;;;sans;;9;;16;;;;;
;2*16gaa235;;;;;;;gac-tgg;;2;;4;;;;;
;16atcgca235-acc-5s;;7;;;;;gac;;4;;1;;;;;
;16gaa235-gac;;;;;;;acc-5s;;4;;2;;;;;
;;;;;;;;tgg;;;;;;;;;
gm0214;3*16gaa235;;;78;14;64;42;total;0;19;0;23;0;0;0;;
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0215;16atcgca235;;;82;15;67;;;;;;;;;;;
;3*16gaa235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0216;2*16gaa235;;;89;14;75;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0309;3*16gaa235;;;86;13;73;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;7;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0319;3*16gaa235;;;89;14;75;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235;;7;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;;;42;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm320-361;;;;;;;;;Notes
gm0320;16s23s5s-5s;;;122;11;111;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235;;;;;;;sans;1;27;;5;;1;4;;avant
;16s23s5s-gac;;;;;;;gac-tgg;;;;2;;;;;3*agc-gta-16atcgca235
;16atcgca235-acc;;;;;;;gac;1;1;;;;;;;cgg-cac-cca-16gaa235
;16s23s5s-tgg;;;;;;;acc-5s;;;;;;;;;
;16atcgca235-gac;;;;;;;tgg;1;;;;;;;;autres
;16s23s5s-acc;;7;;;;43;total;3;28;0;7;0;1;4;;16atcgca-cds-2355
;;;;;;;;;;;;;;;;;
gm0321;3*16atcgca235+5s;;;39;6;33;;;;;;;;;;;différents
gm0322;3*16atcgca235+5s;;;39;6;33;;;;;;;;;;;16atcgca235-acc
gm0323;3*16atcgca235+5s;;9;39;6;33;;;;;;;;;;;16s23s5s-acc
;;;;;;;;;;;;;;;;;
gm0324;2*16atcgca235+5s;;;40;8;32;;;;;;;;;;;cds
;agc-gta-16atcgca235;;3;;;;;;;;;;;;;;16atcgca-cds-2355
;;;;;;;;;;;;;;;;;
gm0326;2*16atcgca235+5s;;;41;8;33;;;;;;;;;;;5s en trop
;agc-gta-16atcgca235;;3;;;;;;;;;;;;;;16gaa2355-gac-tgg
;;;;;;;;;;;;;;;;;16atcgca-cds-2355
gm0333;3*16atcgca235+5s;;3;39;6;33;;;;;;;;;;;16s23s5s-5s
;;;;;;;;;;;;;;;;;8*5s
gm0334;2*16atcgca235+5s;;;40;8;32;;;;;;;;;;;
;agc-gta-16atcgca235;;3;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0335;3*16atcgca235+5s;;3;39;6;33;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0359;4*16atcgca235;;4;76;8;68;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0360;16atcgca235;;;54;8;46;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235;;;;;;;;;;;;;;;;
;16atcgca-cds-2355;;4;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0361;4*16gaa235;;;59;11;48;;;;;;;;;;;
;16gaa235-5s-gac-tgg;;6;;;;;;;;;;;;;;
;cgg-cac-cca-16gaa235;;45;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm363-392;;;;;;;;;Notes
gm0363;3*16atcgca235;;;53;9;44;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16gaa235-gac-tgg;;4;;;;;sans;8;30;2;10;;1;1;;avant
;;;;;;;;gac-tgg;;2;;2;;1;;;cgg-cac-cca-16-gaa-cds-235
gm0364;4*16atcgca235;;4;55;8;47;;gac;;;;1;;;;;
gm0365;6*16atcgca235;;6;60;12;48;;acc-5s;;;;1;;;;;autres
;;;;;;;;tgg;;;;;;;;;16-gaa-cds-23555-gac-tgg
gm0366;3*16atcgca235;;5;62;10;52;59;total;8;32;2;14;0;2;1;;16-gaa-cds-235
;2*16-gca-atc-235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0367;4*16s23s5s;;4;50;0;50;;;;;;;;;;;différents
;;;;;;;;;;;;;;;;;16gaa23-cds-5s-5s
gm0368;2*16atcgca235;;6;50;11;39;;;;;;;;;;;
;16atcgca235-5s-gac-tgg;;;;;;;;;;;;;;;;cds
;3*16gaa235;;;;;;;;;;;;;;;;cgg-cac-cca-16-gaa-cds-235
;;;;;;;;;;;;;;;;;16-gaa-cds-23555-gac-tgg
gm0369;3*16atcgca235;;6;59;14;45;;;;;;;;;;;16-gaa-cds-235
;cgg-cac-cca-16-gaa-cds-235;;;;;;;;;;;;;;;;16gaa23-cds-5s-5s
;16-gaa-cds-23555-gac-tgg;;;;;;;;;;;;;;;;
;16-gaa-cds-235;;;;;;;;;;;;;;;;5s en trop
;;;;;;;;;;;;;;;;;16atcgca2355-gac-tgg
gm0386;4*16gaa235;;6;57;8;49;;;;;;;;;;;16gaa2355-gac-tgg
;16gaa23-cds-5s-5s;;;;;;;;;;;;;;;;16-gaa-cds-23555-gac-tgg
;16gaa235-5s-gac-tgg;;;;;;;;;;;;;;;;16gaa23-cds-5s-5s
;;;;;;;;;;;;;;;;;
gm0390;3*16gaa235;;8;94;15;79;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16gaa235-gac;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0391;5*16atcgca235;;5;69;10;59;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0392;4*16s23s5s;;6;61;4;57;;;;;;;;;;;
;2*16atcgca235;;60;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm393-409;;;;;;;;;Notes
gm0393;4*16atcgca235;;4;71;8;63;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;;;;;;;;sans;6;19;;8;;;1;;avant
gm0394;4*16s23s5s;;6;65;4;61;;gac-tgg;;1;;1;;;;;aaa-16atcgca235
;2*16atcgca235;;;;;;;gac;;2;;2;;;;;
;;;;;;;;acc-5s;1;1;;1;;;;;incomplets
gm0396;16atcgca235;;2;48;2;46;;tgg;;;;;;;;;16s
;16235;;;;;;43;total;7;23;0;12;0;0;1;;
;;;;;;;;;;;;;;;;;autres incomplets
gm0397;16atcgca235;;2;45;5;40;;;;;;;;;;;23s5s
;aaa-16atcgca235;;;;;;;;;;;;;;;;atc-gca-235-gac-tgg
;;;;;;;;;;;;;;;;;
gm0398;4*16atcgca235;;4;57;8;49;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0400;2*16atcgca235;;2;42;4;38;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0401;2*16atcgca235;;7;85;15;70;;;;;;;;;;;
;16gaa235 + 23s5s;;;;;;;;;;;;;;;;
;2*16gaa235-gac;;;;;;;;;;;;;;;;
;16gaa235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0402;3*16gaa235;;8;87;14;73;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;16s23s5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0409;4*16gaa235 + 16s;;9;92;16;76;;;;;;;;;;;
;16s235-acc-5s;;;;;;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;atc-gca-235-gac-tgg;;44;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm413-487;;;;;;;;;Notes
gm0413;4*16gaa235;;8;87;14;73;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16s235-acc-5s;;;;;;;sans;4;16;;14;;;2;;avant
;16atcgca235-gac-tgg;;;;;;;gac-tgg;;3;;1;;;;;ttc-16atcgca235
;16atcgca235;;;;;;;gac;;3;;1;;;;;cgg-cac-cca-16atcgca235
;16atcgca235-gac;;;;;;;acc-5s;2;;;1;;;;;
;;;;;;;;tgg;;;;;;;;;5s en trop
gm0420;4*16gaa235 + 5s;;7;70;12;58;47;total;6;22;0;17;0;0;2;;16atcgca235-5s-gac
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;5s
;16gaa235-gac;;;;;;;;;;;;;;;;
;16gaa235-acc-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0441;4*16gaa235;;8;86;14;72;;;;;;;;;;;
;16s235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0470;2*16-gaa-235;;6;66;15;51;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;cgg-cac-cca-16atcgca235;;;;;;;;;;;;;;;;
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-5s-gac;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0476;3*16atcgca235;;3;57;6;51;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0478;3*16atcgca235;;3;52;6;46;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0483;4*16s23s5s;;7;81;6;75;;;;;;;;;;;
;3*16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0486;2*16atcgca235;;2;47;4;43;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0487;2*16atcgca235;;3;47;7;40;;;;;;;;;;;
;ttc-16atcgca235;;47;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm488-538;;;;;;;;;Notes
gm0488;2*16atcgca235;;3;47;7;40;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235-tta;;;;;;;sans;7;20;;2;;;2;;avant
;;;;;;;;gac-tgg;1;1;;1;;;1;;aaa-16atcgca235
gm0489;2*16atcgca235;;3;44;7;37;;gac;1;5;;2;;2;;;ttg-16-gaa-aaa-gta-235-gac-tgg
;aaa-16atcgca235;;;;;;;acc-5s;1;;;0;;;;;atgj-16atcgca235
;;;;;;;;tgg;;;;;;;;;
gm0491;3*16atcgca235;;4;50;9;41;46;total;10;26;0;5;0;2;3;;autres
;atgj-16atcgca235;;;;;;;;;;;;;;;;2*16-gaa-aaa-gta-235-gac
;;;;;;;;;;;;;;;;;
gm0494;2*16-gaa-235 + 16atcgca-23s°-5s-gac;;;82;14;68;;;;;;;;;;;
;2*16atcgca235;;7;;;;;;;;;;;;;;incomplets
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;16atcgca-23s°-5s-gac
;16-gaa-23-acc-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;différents
gm0495;3*16atcgca235;;11;132;25;107;;;;;;;;;;;16atcgca235-tta
;5*16atcgca235-gac;;;;;;;;;;;;;;;;16atcgca235-tgg-tgg
;2*16atcgca235-5s;;;;;;;;;;;;;;;;16-gaa-23-acc-5s
;16atcgca235-tgg-tgg;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;5s en trop
gm0526;2*16-gaa-235-gac;;9;137;25;112;;;;;;;;;;;2*16atcgca235-5s
;2*16-gaa-aaa-gta-235-gac;;;;;;;;;;;;;;;;16s23s5s-5s-gac-tgg
;ttg-16-gaa-aaa-gta-235-gac-tgg;;;;;;;;;;;;;;;;16s23s5s-5s
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16s23s5s-acc-5s;;;;;;;;;;;;;;;;
;16s23s5s-gac;;;;;;;;;;;;;;;;
;16s23s5s-5s-gac-tgg;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0535;6*16s23s5s;;9;108;4;104;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16s23s5s-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm0538;4*16atcgca235;;4;66;8;58;;;;;;;;;;;
;;;50;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm666-1048;;;;;;;;;Notes
gm0666;3*16-gaa-235;;;83;14;69;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;16atcgca235-gac;;;;;;;sans;8;5;2;8;;1;;;autres
;16atcgca235;;;;;;;gac-tgg;;1;;3;;2;;;16-gcc-gaa-235-gac-tgg
;16-gaa-235-gac-tgg;;;;;;;gac;2;3;;1;;1;;;16-gaa-aaa-gca-gta-235-gac-tgg
;16atcgca235-acc-5s;;7;;;;;acc-5s;1;2;;1;;;;;16-gaa-aaa-gta-cds-235
;;;;;;;;tgg;;;;;;;;;16-gaa-aaa-gta-cds-235-gac
gm0942;2*16-gaa-235;;;87;15;72;41;total;11;11;2;13;0;4;0;;
;16-gaa-235-gac;;7;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;différents
;16-gaa-235-acc-5s;;;;;;;;;;;;;;;;16atcgca-235-acc-5s-gac
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;16atcgca-235-tca
;16atcgca-23s°;;;;;;;;;;;;;;;;16-gaa-aaa-gta-cds-235-tca
;16s°-gaa-235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;incomplets
gm0973;6*16s23s5s;;11;149;9;140;;;;;;;;;;;16atcgca-23s°
;16atcgca235-gac;;;;;;;;;;;;;;;;
;16s23s5s-acc-5s;;;;;;;;;;;;;;;;autres incomplets
;2*16atcgca235;;;;;;;;;;;;;;;;16s°-gaa-235
;16s23s5s-gac;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;cds
gm0984;3*16-gaa-235;;7;103;14;89;;;;;;;;;;;16-gaa-aaa-gta-cds-235
;16atcgca235-gac;;;;;;;;;;;;;;;;16-gaa-aaa-gta-cds-235-gac
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;16-gaa-aaa-gta-cds-235-tca
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;5s en trop
;;;;;;;;;;;;;;;;;16-gca-atc-235-5s
gm1003;16-gca-atc-235;;2;71;4;67;;;;;;;;;;;16atcgca-235-acc-5s-gac
;16-gca-atc-235-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm1048;16-gcc-gaa-235-gac-tgg;;;126;32;94;;;;;;;;;;;
;16atcgca-235-acc-5s-gac;;;;;;;;;;;;;;;;
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;
;16-gaa-aaa-gca-gta-235-gac-tgg;;;;;;;;;;;;;;;;
;2*16s23s5s;;;;;;;;;;;;;;;;
;16s23s5s-gac;;;;;;;;;;;;;;;;
;16atcgca-235-tca;;11;;;;;;;;;;;;;;
;16-gaa-aaa-gta-cds-235;;;;;;;;;;;;;;;;
;16-gaa-aaa-gta-cds-235-gac;;;;;;;;;;;;;;;;
;16-gaa-aaa-gta-cds-235-tca;;45;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Gm1066-1149;;;;;;;;;Notes
gm1066;2*16-gca-atc-235;;2;55;4;51;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;;;;;;;;sans;;5;5;11;;;1;;avant
gm1072;2*16-gca-atc-235;;2;55;4;51;;gac-tgg;;2;;2;;;;;cgg-16-gca-atc-235
;;;;;;;;gac;;1;;3;;;;;
gm1100;3*16-gaa-235;;7;82;13;69;;acc-5s;;2;;2;;;;;
;16-gaa-235-gac;;;;;;;tgg;;;;;;;;;
;16atcgca235;;;;;;34;total;0;10;5;18;;0;1;;
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm1106;16-gca-atc-235;;2;53;5;48;;;;;;;;;;;
;cgg-16-gca-atc-235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm1115;3*16-gaa-235;;7;85;14;71;;;;;;;;;;;
;16-gaa-235-gac;;;;;;;;;;;;;;;;
;16atcgca235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm1128;3*16-gaa-235;;7;73;12;61;;;;;;;;;;;
;16-gaa-235-acc-5s;;;;;;;;;;;;;;;;
;16-gaa-235-gac-tgg;;;;;;;;;;;;;;;;
;16-gaa-235-gac;;;;;;;;;;;;;;;;
;16atcgca235;;;;;;;;;;;;;;;;
;;;;;;;;;;;;;;;;;
gm1149;2*16-gaa-235;;7;82;15;67;;;;;;;;;;;
;2*16atcgca235;;;;;;;;;;;;;;;;
;16atcgca235-gac-tgg;;;;;;;;;;;;;;;;
;16-gaa-235-acc-5s;;;;;;;;;;;;;;;;
;16atcgca235-gac;;34;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;Total;;;;;;;;;
;;;;;;;;;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;;
;;;;;;;;sans;58;238;14;160;1;19;17;;
;;;;;;;;gac-tgg;1;31;0;25;0;4;5;;
;Moyenne;;;68;10;58;;gac;8;34;0;31;2;5;0;;
;ecartype;;;25;6;20;;acc- 5s;7;19;0;20;;0;0;;
;max;;;149;32;140;;tgg;1;1;0;2;0;1;0;;
;min;;;27;0;27;704;total;75;323;14;238;3;29;22;;

gamma notes[modifier | modifier le wikicode]

13.12.19 Paris ;;gamma notes;;;;;
avant;;;;autres;;;5s en trop
3*agc-gta-16atcgca235;;;;3*16-atc-235;;;2*16s23s5s-5s
3*atgf-16atcgca235;;;;16gcc235-gac-tgg;;;16s23s5s-5s-gac-tgg
4*cgg-cac-cca-16atcgca235;;;;16 atc-gcc 235-gac;;;16s23s5s-acc-5s-acc-5s
cgg-cac-cca-16atcgca2355-gac-tgg;;;;16-gcc-gaa-235-gac-tgg;;;
cgg-cac-cca-16atcgca235-x-tgg;;;;4*16-gca-cca-235;;;2*16atcgca235-5s
2*aaa-16atcgca235;;;;;;;16atcgca235-5s-gac
ttc-16atcgca235;;;;16-gaa-aaa-gta-235;;;3*16atcgca2355-gac-tgg
atgj-16atcgca235;;;;3*16-gaa-aaa-gta-235-gac;;;16atcgca-235-acc-5s-gac
;;;;16-gaa-aaa-gta-235-tgg;;;cgg-cac-cca-16atcgca2355-gac-tgg
2*cgg-cac-cca-16gaa2355-gac-tgg;;;;;;;16atcgca-cds-2355
cgg-cac-cca-16gaa235;;;;16-gaa-aaa-gca-gta-235;;;
;;;;16-gaa-aaa-gca-gta-235-gac-tgg;;;2*cgg-cac-cca-16gaa2355-gac-tgg
cgg-16-gca-atc-235;;;;;;;16gaa23-cds-5s-5s
;;;;16atcgca-cds-2355;;;16gaa235-gac-5s
cgg-cac-cca-16-gaa-cds-235;;;;16-gaa-cds-23555-gac-tgg;;;2*16gaa2355-gac-tgg
ttg-16-gaa-aaa-gta-235-gac-tgg;;;;16-gaa-cds-235;;;16-gaa-cds-23555-gac-tgg
;;;;7*16-gca-cds-235;;;
différents;;;;16-gaa-aaa-gta-cds-235;;;16-atc-2355-tac
16s23s5s-acc;;;;16-gaa-aaa-gta-cds-235-gac;;;2*16-gca-atc-2355
16s23s5s-acc-5s-acc-5s;;;;;;;
;;;;incomplets;;;gaa-5s
16gaa235-tca;;;;3*16atcgca23;;;atc-5s-aaa
3*16gaa235-acc;;;;2*16s23s;;;13*5s
2*16gaa235-ttc;;;;2*16gaa23;;;
16gaa23-cds-5s-5s;;;;16gaa23-tgg;;;cds
2*16gaa235-gac-gac;;;;;;;16gaa23-cds-5s-5s
16-gaa-23-acc-5s;;;;16s-gaa-aaa-gta-5s;;;
;;;;16atcgca-23s°-5s-gac;;;16atcgca-cds-2355
3*16atcgca235-acc;;;;16s-23s°-5s-gac;;;16-gaa-cds-23555-gac-tgg
16atcgca-235-tca;;;;;;;16-gaa-cds-235
16atcgca235-tta;;;;16s-atc-gca-tgg;;;7*16-gca-cds-235
16atcgca235-tgg-tgg;;;;16atcgca-23s°;;;16-gaa-aaa-gta-cds-235
16atcgca-235-acc-5s-gac;;;;16atcgca;;;16-gaa-aaa-gta-cds-235-gac
;;;;3*16s;;;cgg-cac-cca-16-gaa-cds-235
16-atc-2355-tac;;;;;;;16-gaa-aaa-gta-cds-235-tca
16-gaa-aaa-gta-cds-235-tca;;;;autres incomplets;;;
;;;;23s5s;;;à l’envers
;;;;16s°-gaa-235;;;2*5s-23s-16s
;;;;gaa-23s5s-gac;;;2*5s-23s-cp(atc-gca)-16s
;;;;atc-gca-235-gac-tgg;;;
gamma typage[modifier | modifier le wikicode]
gamma type 16235-z après 5s[modifier | modifier le wikicode]
16235-z;;;;;;à l’envers;;;
Total tableau des blocs + différents;;;;;;2*5s-23s-16s;;;
;;;;;;2*5s-23s-cp(atc-gca)-16s;;;
;;sans: tableau + l’envers;;;;;;;
16-235-z;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;total;%
sans;60;240;14;160;1;19;17;511;70
gac-tgg;1;31;0;25;0;4;5;66;9
gac;8;34;0;31;2;5;0;80;11
acc- 5s;7;19;0;20;0;0;0;46;6
tgg;1;1;0;2;0;1;0;5;0.7
16-235-z’;2;7;;10;;2;0;21;2.9
total;79;332;14;248;3;31;22;729;
% sans;76;72;100;65;33;61;77;70;
;;;;;;;;;
différents z';par type;différents z';par aa;total blocs z;;total;z+z’;%;
acc;7;acc;11;gac;146;gac;151;52;
acc-5s-acc-5s;1;tca;3;tgg;71;tgg;73;25;
tca;3;ttc;2;acc;46;acc;57;20;
ttc;2;cds;1;;;tca;3;1.0;
cds;1;gac;5;;;ttc;2;0.7;
gac-gac;2;tta;1;;;cds;1;0.3;
tta;1;tgg;2;;;tta;1;0.3;
tgg-tgg;1;tac;1;;;tac;1;0.3;
acc-5s-gac;1;total;26;total;263;total;289;;
tac;1;;;;;;;;
23-acc-5s;1;;;;;;;;
total;21;;;;;;;;
gamma type 16-y-235 après 16s[modifier | modifier le wikicode]
16-y-235;;;;;;;;;
;;;;;;;;;
Tableau des blocs;;;;;;;;;
16-y-235-z;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;total;
sans;58;238;14;160;1;19;17;507;
gac-tgg;1;31;0;25;0;4;5;66;
gac;8;34;0;31;2;5;0;80;
acc- 5s;7;19;0;20;;0;0;46;
tgg;1;1;0;2;0;1;0;5;
total;75;323;14;238;3;29;22;704;
Catégories;;;;;;;;;
16-y-23;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;total;%;
16-y-235-z;75;323;14;238;3;29;682;93;
x-16-y-235-z; ;16;1;3;;2;22;3.0;
16-y-235-z’;2;7;;10;;2;21;2.8;
16-y-23-;2;3;;3;;;8;1.1;
5-23-y-16;2;2;;;;;4;0.5;
total;81;351;15;254;3;33;737;;
%;11;48;2;34;0;4;;;
Détails;;;;;;;;;
Par séquence;;;;par tRNAs;;;;;
16-y-235-z;;divers;16-y-23;Total;16-y-235-z;16-y-235-z;16-y-23;16-y-23;
autres;;avant;;;tableau;autres;divers;total;%
atc;3;x-16-235;0;atc;340;5;30;375;35
gcc;1;atcgca;16;gca;337;14;29;380;36
atc-gcc;1;gaa;3;gaa;241;12;19;272;25
gcc-gaa;1;gcaatc;1;gcc;;3;;3;0.3
gca-cca;4;gaa-cds;1;cca;;4;;4;0.4
gaa-cds;2;gaa-aaa-gta;1;aaa;;9;2;11;1.0
gca-cds;7;différents;;gta;;9;2;11;1.0
atcgca-cds;1;16-235-z’;2;cds;;12;2;14;1.3
EKV;5;gaa;10;total;;;;1070;
EKAV;2;atcgca;7;;;;;;
EKV-cds;2;atc;1;16-y-235-z;;;;;
total;29;gaa-aaa-gta-cds;1;autres;;;;;
;;l’envers;;atc;5;;;16-y-23;
16-y-235-z;;5s23s16s;2;gca;14;;;divers;
tableau;;5s23atcgca16;2;gaa;12;;;atc;30
16s23s5s;75;incomplets23;;gcc;3;;;gca;29
atcgca;323;16-23-;2;cca;4;;;gaa;19
gcaatc;14;atcgca;3;aaa;9;;;aaa;2
gaa;238;gaa;3;gta;9;;;gta;2
atcgaa;3;total;55;cds;12;;;cds;2
gamma type x-16235 avant 16s[modifier | modifier le wikicode]
x-16235;;;;
Par séquence;;Par tRNA;;
avant;;;x-16235;%
cgg-cac-cca;10;cgg;11;24
agc-gta;3;cac;10;22
atgf;3;cca;10;22
aaa;2;atgf;3;7
ttc;1;agc;3;7
atgj;1;gta;3;7
cgg;1;aaa;2;4
ttg;1;ttc;1;2
;;atgj;1;2
;;ttg;1;2
;;total;45;
gamma comparaison des types x y z[modifier | modifier le wikicode]
comparaison des 3 types x y z;;;;;;;;;;;
Effectifs;;3 +;31;1027;281;;;;;;
;x-16-y-235-z;total;45;1070;289;;1404;;;;
atgf;3;act;;aat;;cds;15;;ttc;2;z
ctt;;cct;;cat;;cgc;;;ttc;1;x
gtt;;gct;;gat;;ggt;;;;;
ttt;;tct;;tat;;tgt;;;cds;14;y
;;;;;;;;;cds;1;z
atc;375;acc;57;aac;;agc;3;;;;
ctc;;ccc;;cac;10;cgt;;;gta;11;y
gtc;;gcc;3;gac;151;ggc;;;gta;3;x
ttc;3;tcc;;tac;1;tgc;;;;;
;;;;;;;;;cca;10;x
atgi;;aca;;aaa;13;aga;;;cca;4;y
cta;;cca;14;caa;;cga;;;;;
gta;14;gca;380;gaa;272;gga;;;aaa;11;y
tta;1;tca;3;taa;;tga;;;aaa;2;x
;;;;;;;;;;;
atgj;1;acg;;aag;;agg;;;;;
ctg;;ccg;;cag;;cgg;11;;;;
gtg;;gcg;;gag;;ggg;;;;;
ttg;1;tcg;;tag;;tgg;73;;;;
;;;;;;;;;;;
;;;;;;;;;;;
;;;;;;;;;;;
%;;3 +;69;96;97;;;;;;
;;total;100;100;100;;300;;;;
atgf;6.7;act;;aat;;cds;1.7;;ttc;0.69;z
ctt;;cct;;cat;;cgc;;;ttc;2.22;x
gtt;;gct;;gat;;ggt;;;;;
ttt;;tct;;tat;;tgt;;;cds;1.31;y
;;;;;;;;;cds;0.35;z
atc;35;acc;20;aac;;agc;6.7;;;;
ctc;;ccc;;cac;22;cgt;;;gta;1.03;y
gtc;;gcc;0.3;gac;52;ggc;;;gta;6.67;x
ttc;2.9;tcc;;tac;0.3;tgc;;;;;
;;;;;;;;;cca;22.22;x
atgi;;aca;;aaa;5.5;aga;;;cca;0.37;y
cta;;cca;23;caa;;cga;;;;;
gta;7.7;gca;36;gaa;25;gga;;;aaa;1.03;y
tta;0.3;tca;1.0;taa;;tga;;;aaa;4.44;x
;;;;;;;;;;;
atgj;2.2;acg;;aag;;agg;;;;;
ctg;;ccg;;cag;;cgg;24;;;;
gtg;;gcg;;gag;;ggg;;;;;
ttg;2.2;tcg;;tag;;tgg;25;;;;
gamma. 5s se comporte comme un tRNA[modifier | modifier le wikicode]
5s en trop;;;;;;;;;;
;16s23s5s;atcgca;gcaatc;gaa;atcgaa;autres;av16s;différents;total 5s+;total
sans;56;236;12;160;1;18;17;;;500
5s;2;2;2;;;1;;;7;7
gac-tgg;0;28;;23;;3;2;;;56
5s-gac-tgg;1;3;;2;;;3;;9;9
55-gac-tgg;;;;;;1;;;1;1
gac;8;33;;30;2;5;;;;78
gac-5s;;;;1;;;;;1;1
5s-gac;;1;;;;;;;1;1
acc-5s;7;19;;20;;;;;;46
tgg;1;1;;2;;1;;;;5
acc;1;3;;3;;;;;;7
acc-5s-acc-5s;1;;;;;;;;1;1
acc-5s-gac;;1;;;;;;;1;1
tca;;1;;1;;1;;;;3
ttc;;;;2;;;;;;2
23-cds-5s-5s;;;;1;;;;;1;1
gac-gac;;;;2;;;;;;2
23-acc-5s;;;;1;;;;;;1
tta;;1;;;;;;;;1
tgg-tgg;;1;;;;;;;;1
16-atc-2355-tac;;;;;;;;1;1;1
;77;330;14;248;3;30;22;1;23;725
;75;323;14;238;3;29;22;0;19;704

Noms gamma[modifier | modifier le wikicode]

noms gamma;;;;;;
rupture;notes;rRNAs;fait;codes;tRNAs;génomes
1;;222;1;gm0001;§54;Acidithiobacillus caldus ATCC 51756 
;;;;gm0002;55;Acidithiobacillus caldus SM-1 
1;;222;1;gm0003;§51;Acidithiobacillus ferrivorans SS3 
1;;;;gm0004;§88;Acidithiobacillus ferrooxidans ATCC 23270 
;;222;1;gm0005;50;Acidithiobacillus ferrooxidans ATCC 53993 
1;;;;gm0006;§72;Acinetobacter baumannii 1656-2 
;;;;gm0007;75;Acinetobacter baumannii 6200 
;;;;gm0008;73;Acinetobacter baumannii 6411 
;;;;gm0009;74;Acinetobacter baumannii A1 
;;;;gm0010;74;Acinetobacter baumannii AB0057 
;;;;gm0011;75;Acinetobacter baumannii AB030 
;;;;gm0012;74;Acinetobacter baumannii AB031 
;;;;gm0013;74;Acinetobacter baumannii AB307-0294 
;;;;gm0014;75;Acinetobacter baumannii AB5075-UW 
;;;;gm0015;73;Acinetobacter baumannii AbH12O-A2 
;;;;gm0016;39;Acinetobacter baumannii AC12 
;;211;1;gm0017;63;Acinetobacter baumannii AC29 
;;;;gm0018;48;Acinetobacter baumannii AC30 
;;;;gm0019;65;Acinetobacter baumannii ACICU 
;;;;gm0020;71;Acinetobacter baumannii ATCC 17978 
;;;;gm0021;73;Acinetobacter baumannii AYE 
;;;;gm0022;75;Acinetobacter baumannii BJAB07104 
;;;;gm0023;76;Acinetobacter baumannii BJAB0715 
;;;;gm0024;76;Acinetobacter baumannii BJAB0868 
;;;;gm0025;66;Acinetobacter baumannii D1279779 
;;;;gm0026;75;Acinetobacter baumannii IOMTU 433 
;;;;gm0027;73;Acinetobacter baumannii LAC-4 
;;;;gm0028;76;Acinetobacter baumannii MDR-TJ 
;;;;gm0029;70;Acinetobacter baumannii MDR-ZJ06 
;;;;gm0030;75;Acinetobacter baumannii NCGM 237 
;;;;gm0031;81;Acinetobacter baumannii PKAB07 
;;;;gm0032;65;Acinetobacter baumannii SDF 
;;;;gm0033;43;Acinetobacter baumannii TCDC-AB0715 
;;;;gm0034;76;Acinetobacter baumannii TYTH-1 
;;;;gm0035;72;Acinetobacter baumannii ZW85-1 
1;;666;1;gm0036;§70;Acinetobacter calcoaceticus PHEA-2 
1;;666;1;gm0037;§72;Acinetobacter oleivorans DR1 
;;;;gm0038;77;Acinetobacter sp. ADP1 
1;;766;1;gm0039;§64;Actinobacillus equuli subsp. equuli 19392 
1;;766;1;gm0040;§64;Actinobacillus pleuropneumoniae serovar 3 str. JL03 
;;;;gm0041;63;Actinobacillus pleuropneumoniae serovar 5b str. L20 
;;;;gm0042;65;Actinobacillus pleuropneumoniae serovar 7 str. AP76 
1;;766;1;gm0043;§61;Actinobacillus succinogenes 130Z 
1;;;;gm0044;§64;Actinobacillus suis ATCC 33415 
;;766;1;gm0045;60;Actinobacillus suis H91-0380 
1;;;;gm0046;§106;Aeromonas hydrophila 4AK4 
;;11,11,11;1;gm0047;129;Aeromonas hydrophila AH10 
;;;;gm0048;115;Aeromonas hydrophila AL06-06 
;;;;gm0049;114;Aeromonas hydrophila AL09-71 
;;;;gm0050;113;Aeromonas hydrophila J-1 
;;;;gm0051;114;Aeromonas hydrophila ML09-119 
;;;;gm0052;114;Aeromonas hydrophila pc104A 
;;;;gm0053;128;Aeromonas hydrophila subsp. hydrophila ATCC 7966 
;;;;gm0054;129;Aeromonas hydrophila YL17 
1;;10,9,9;1;gm0055;§131;Aeromonas media WS 
1;;10,9,9;1;gm0056;§111;Aeromonas salmonicida subsp. salmonicida A449 
1;;11,10,10;1;gm0057;§103;Aeromonas veronii B565 
1;;666;1;gm0058;§52;Aggregatibacter actinomycetemcomitans ANH9381 
;;;;gm0059;57;Aggregatibacter actinomycetemcomitans D11S-1 
;;;;gm0060;55;Aggregatibacter actinomycetemcomitans D7S-1 
;;;;gm0061;55;Aggregatibacter actinomycetemcomitans HK1651 
1;;766;1;gm0062;§60;Aggregatibacter aphrophilus NJ8700 
1;;333;1;gm0063;§43;Alcanivorax borkumensis SK2 
1;;222;1;gm0064;§45;Alcanivorax dieselolei B5 
1;;222;1;gm0065;§48;Alcanivorax pacificus W11-5 
1;;13,12,12;1;gm0066;§104;Aliivibrio salmonicida LFI1238 
1;;876;1;gm0067;§91;Aliivibrio wodanis 
1;;222;1;gm0068;§49;Alkalilimnicola ehrlichii MLHE-1 
1;;333;1;gm0069;§54;Allochromatium vinosum DSM 180 
1;;555;1;gm0070;§68;Alteromonas australica DE170 
 ;;555;1;gm0071;57;Alteromonas australica H 17 
1;;;;gm0072;§69;Alteromonas macleodii AltDE1 
 ;;655;1;gm0073;54;Alteromonas macleodii ATCC 27126 
;;;;gm0074;67;Alteromonas macleodii str. Aegean Sea MED64 
;;;;gm0075;72;Alteromonas macleodii str. Balearic Sea AD45 
;;;;gm0076;70;Alteromonas macleodii str. Black Sea 11 
;;;;gm0077;64;Alteromonas macleodii str. Deep ecotype 
;;;;gm0078;68;Alteromonas macleodii str. English Channel 615 
;;655;1;gm0079;77;Alteromonas macleodii str. English Channel 673 
;;;;gm0080;63;Alteromonas macleodii str. Ionian Sea U4 
;;;;gm0081;63;Alteromonas macleodii str. Ionian Sea U7 
;;;;gm0082;64;Alteromonas macleodii str. Ionian Sea U8 
;;;;gm0083;59;Alteromonas macleodii str. Ionian Sea UM4b 
;;;;gm0084;65;Alteromonas macleodii str. Ionian Sea UM7 
1;;;;gm0085;§66;Alteromonas sp. SN2 
1;;666;1;gm0086;§70;Azotobacter chroococcum NCIMB 8003 
1;;666;1;gm0087;§66;Azotobacter vinelandii CA 
;;;;gm0088;66;Azotobacter vinelandii CA6 
;;;;gm0089;66;Azotobacter vinelandii DJ ATCC BAA-1303 
1;;766;1;gm0090;§58;Bibersteinia trehalosi USDA-ARS-USMARC-188 
;;;;gm0091;58;Bibersteinia trehalosi USDA-ARS-USMARC-189 
;;;;gm0092;59;Bibersteinia trehalosi USDA-ARS-USMARC-190 
;;;;gm0093;58;Bibersteinia trehalosi USDA-ARS-USMARC-192 
1;;111;1;gm0094;§38;Blochmannia endosymbiont of Camponotus Colobopsis obliquus 757 
;;;;gm0095;38;Blochmannia endosymbiont of Polyrhachis Hedomyrma turneri 675 
;;;;gm0096;31;Buchnera aphidicola BCc 
;;;;gm0097;31;Buchnera aphidicola Cinara tujafilina 
1;;111;1;gm0098;§32;Buchnera aphidicola str. 5A Acyrthosiphon pisum 
;;;;gm0099;32;Buchnera aphidicola str. Ak Acyrthosiphon kondoi 
;;;;gm0100;32;Buchnera aphidicola str. APS Acyrthosiphon pisum 
;;;;gm0101;32;Buchnera aphidicola str. Bp Baizongia pistaciae 
;;;;gm0102;32;Buchnera aphidicola str. F009 Myzus persicae 
;;;;gm0103;32;Buchnera aphidicola str. G002 Myzus persicae 
;;;;gm0104;32;Buchnera aphidicola str. JF98 Acyrthosiphon pisum 
;;;;gm0105;32;Buchnera aphidicola str. JF99 Acyrthosiphon pisum 
;;;;gm0106;32;Buchnera aphidicola str. LL01 Acyrthosiphon pisum 
;;;;gm0107;32;Buchnera aphidicola str. LSR1 Acyrthosiphon pisum 
;;;;gm0108;32;Buchnera aphidicola str. Sg Schizaphis graminum 
;;;;gm0109;32;Buchnera aphidicola str. TLW03 Acyrthosiphon pisum 
;;;;gm0110;32;Buchnera aphidicola str. Tuc7 Acyrthosiphon pisum 
;;;;gm0111;32;Buchnera aphidicola str. Ua Uroleucon ambrosiae 
;;;;gm0112;32;Buchnera aphidicola str. USDA Myzus persicae 
;;;;gm0113;32;Buchnera aphidicola str. W106 Myzus persicae 
1;;222;1;gm0114;§40;Candidatus Baumannia cicadellinicola BGSS 
1;;111;1;gm0115;§41;Candidatus Blochmannia chromaiodes str. 640 
;;;;gm0116;37;Candidatus Blochmannia floridanus 
;;;;gm0117;41;Candidatus Blochmannia pennsylvanicus str. BPEN 
;;;;gm0118;38;Candidatus Blochmannia vafer str. BVAF 
1;;011;1;gm0119;§27;Candidatus Carsonella ruddii CE isolate Thao2000 
;;;;gm0120;26;Candidatus Carsonella ruddii CS isolate Thao2000 
;;;;gm0121;27;Candidatus Carsonella ruddii DC 
;;;;gm0122;24;Candidatus Carsonella ruddii HC isolate Thao2000 
;;;;gm0123;26;Candidatus Carsonella ruddii HT isolate Thao2000 
;;;;gm0124;27;Candidatus Carsonella ruddii PC isolate NHV 
;;;;gm0125;26;Candidatus Carsonella ruddii PV 
1;;111;1;gm0126;§33;Candidatus Evansia muelleri 
1;;333;1;gm0127;§45;Candidatus Hamiltonella defensa 5AT Acyrthosiphon pisum T5A 
1;;333;1;gm0128;§37;Candidatus Ishikawaella capsulata Mpkobe 
1;;212;1;gm0129;§42;Candidatus Moranella endobia PCIT 
;;;;gm0130;42;Candidatus Moranella endobia PCVAL 
1;;233;1;gm0131;§40;Candidatus Pantoea carbekii 
;;;;gm0132;39;Candidatus Pantoea carbekii US 
;;;;gm0133;34;Candidatus Portiera aleyrodidarum AD-CAI 
;;;;gm0134;35;Candidatus Portiera aleyrodidarum AF-CAI 
; 2*33;;;gm0135;66;Candidatus Portiera aleyrodidarum BT-B-HRs    
;;;;gm0136;66;Candidatus Portiera aleyrodidarum BT-QVLC 
1;;111;1;gm0137;§33;Candidatus Portiera aleyrodidarum MED Bemisia tabaci BT-Q 
;;;;gm0138;34;Candidatus Portiera aleyrodidarum TV 
;;;;gm0139;34;Candidatus Portiera aleyrodidarum TV-BCN 
1;;222;1;gm0140;§33;Candidatus Riesia pediculicola USDA 
1;;111;1;gm0141;§37;Candidatus Ruthia magnifica str. Cm Calyptogena magnifica 
1;;252;1;gm0142;§57;Candidatus Sodalis pierantonius str. SOPE 
1;;877;1;gm0143;§83;Cedecea neteri M006 
;;;;gm0144;84;Cedecea neteri ND14a 
;;;;gm0145;77;Cedecea neteri ND14b 
;;;;gm0146;83;Cedecea neteri SSMD04 
1;;333;1;gm0147;§49;Cellvibrio japonicus Ueda107 
1;;555;1;gm0148;§70;Chromohalobacter salexigens DSM 3043 
1;;988;1;gm0149;§84;Citrobacter freundii CFNIH1 
1;;877;1;gm0150;§84;Citrobacter koseri ATCC BAA-895 
1;;877;1;gm0151;§87;Citrobacter rodentium ICC168 
1;;10,9,9;1;gm0152;§89;Colwellia psychrerythraea 34H BAA-681 
;;;;gm0153;43;Coxiella burnetii Cb175 Guyana 
;;;;gm0154;43;Coxiella burnetii CbuG Q212 
1;;111;1;gm0155;§44;Coxiella burnetii CbuK Q154 
;;;;gm0156;44;Coxiella burnetii Dugway 5J108-111 
;;;;gm0157;43;Coxiella burnetii RSA 331 
1;;111;1;gm0158;§43;Coxiella burnetii RSA 493 
;;;;gm0159;44;Coxiella burnetii str. Namibia 
;;;;gm0160;43;Coxiella burnetii Z3055 
1;;111;1;gm0161;§39;Coxiella endosymbiont of Amblyomma americanum 
1;;877;1;gm0162;§85;Cronobacter sakazakii ATCC BAA-894 
;;;;gm0163;85;Cronobacter sakazakii CMCC 45402 CMCC45402 
;;;;gm0164;81;Cronobacter sakazakii ES15 
;;;;gm0165;85;Cronobacter sakazakii SP291 Sp291 
1;;877;1;gm0166;§86;Cronobacter turicensis z3032 
1;;111;1;gm0167;§36;Cycloclasticus sp. P1 MCCC 1A01040 
1;;111;1;gm0168;§36;Cycloclasticus zancles 7-ME 
1;;333;1;gm0169;§47;Dichelobacter nodosus VCS1703A 
1;;877;1;gm0170;§76;Dickeya dadantii 3937 
;;;;gm0171;78;Dickeya dadantii Ech586 
;;;;gm0172;75;Dickeya dadantii Ech703 
1;;877;1;gm0173;§91;Dickeya zeae EC1 
;;;;gm0174;76;Dickeya zeae Ech1591 
1;;222;1;gm0175;§53;Dyella japonica A8 
1;;;;gm0176;§57;Dyella jiangningensis SBZ 3-12 
1;;988;1;gm0177;§95;Edwardsiella ictaluri 93-146 
1;;988;1;gm0178;§96;Edwardsiella piscicida C07-087 
1;;;;gm0179;§99;Edwardsiella tarda 080813 
 ;;988;1;gm0180;96;Edwardsiella tarda EIB202 
;;;;gm0181;96;Edwardsiella tarda FL6-60 
1;;111;1;gm0182;§43;endosymbiont of unidentified scaly snail isolate Monju 
1;;10,8,8;1;gm0183;§90;Enterobacter aerogenes EA1509E 
;;;;gm0184;85;Enterobacter aerogenes KCTC 2190 
1;;988;1;gm0185;§85;Enterobacter asburiae L1 
;;;;gm0186;84;Enterobacter asburiae LF7a 
1;;;;gm0187;§87;Enterobacter cloacae 34399 
;;;;gm0188;86;Enterobacter cloacae 34977 
;;;;gm0189;86;Enterobacter cloacae 34983 
;;988;1;gm0190;90;Enterobacter cloacae ECNIH2 
;;;;gm0191;84;Enterobacter cloacae ECNIH3 
;;;;gm0192;85;Enterobacter cloacae ECNIH4 
;;;;gm0193;84;Enterobacter cloacae ECNIH5 
;;;;gm0194;84;Enterobacter cloacae ECR091 
;;;;gm0195;84;Enterobacter cloacae EcWSU1 
;;;;gm0196;85;Enterobacter cloacae GGT036 
;;;;gm0197;104;Enterobacter cloacae P101 
;;988;1;gm0198;89;Enterobacter cloacae subsp. cloacae ATCC 13047 
;;;;gm0199;84;Enterobacter cloacae subsp. cloacae ENHKU01 
;;;;gm0200;65;Enterobacter cloacae subsp. cloacae NCTC 9394 
;;;;gm0201;80;Enterobacter cloacae subsp. dissolvens SDM 
1;;877;1;gm0202;§83;Enterobacter lignolyticus SCF1 
1;;877;1;gm0203;§87;Enterobacter sp. 638 
1;;11,10,8;1;gm0204;§89;Enterobacter sp. R4-368 
1;;10,9,9;1;gm0205;§88;Enterobacteriaceae bacterium strain FGI 57 
1;;877;1;gm0206;§79;Erwinia amylovora ATCC 49946 
;;;;gm0207;78;Erwinia amylovora CFBP1430 
;;;;gm0208;60;Erwinia amylovora LA635 
;;;;gm0209;60;Erwinia amylovora LA636 
;;;;gm0210;60;Erwinia amylovora LA637 
1;;777;1;gm0211;§78;Erwinia billingiae Eb661 
1;;877;1;gm0212;§76;Erwinia pyrifoliae DSM 12163 
;;;;gm0213;76;Erwinia pyrifoliae Ep1/96 
1;;877;1;gm0214;§78;Erwinia sp. Ejp617 
1;;877;1;gm0215;§82;Erwinia tasmaniensis Et1/99 
1;;877;1;gm0216;§89;Escherichia albertii KF1 
1;;;;gm0217;§93;Escherichia coli 
;;;;gm0218;95;Escherichia coli 042 
;;;;gm0219;91;Escherichia coli 1303 
;;;;gm0220;81;Escherichia coli 536 
;;;;gm0221;96;Escherichia coli 55989 
;;;;gm0222;87;Escherichia coli 6409 
;;;;gm0223;93;Escherichia coli 94-3024 
;;;;gm0224;89;Escherichia coli ABU 83972 
;;;;gm0225;89;Escherichia coli APEC IMT5155 
;;;;gm0226;98;Escherichia coli APEC O1 
;;;;gm0227;91;Escherichia coli APEC O78 
;;;;gm0228;85;Escherichia coli ATCC 25922 
;;;;gm0229;87;Escherichia coli ATCC 8739 
;;;;gm0230;87;Escherichia coli B str. REL606 
;;;;gm0231;87;Escherichia coli B7A 
;;;;gm0232;86;Escherichia coli BL21 TaKaRa 
;;;;gm0233;86;Escherichia coli BL21-GoldDE3pLysS AG 
;;;;gm0234;172;Escherichia coli BL21DE3 
;;;;gm0235;88;Escherichia coli BW25113 K-12 substr. BW25113 
;;;;gm0236;89;Escherichia coli BW2952 K-12 substr. BW2952 
;;;;gm0237;86;Escherichia coli C41DE3 
;;;;gm0238;89;Escherichia coli CFT073 
;;;;gm0239;92;Escherichia coli CI5 
;88+89;;;gm0240;177;Escherichia coli DH1 
;;;;gm0241;91;Escherichia coli ECC-1470 
;;;;gm0242;94;Escherichia coli ECONIH1 
;;;;gm0243;92;Escherichia coli ED1a 
;;;;gm0244;89;Escherichia coli ER2796 
;;;;gm0245;92;Escherichia coli ETEC H10407 
;;;;gm0246;95;Escherichia coli FAP1 
;;;;gm0247;90;Escherichia coli HS 
;;;;gm0248;93;Escherichia coli HUSEC2011 
;;;;gm0249;87;Escherichia coli IAI1 
;;;;gm0250;89;Escherichia coli IAI39 
;;;;gm0251;100;Escherichia coli IHE3034 
;;;;gm0252;91;Escherichia coli JJ1886 
;;;;gm0253;89;Escherichia coli K-12 ER3413 
;;;;gm0254;89;Escherichia coli K-12 ER3435 
;;;;gm0255;89;Escherichia coli K-12 ER3440 
;;;;gm0256;89;Escherichia coli K-12 ER3445 
;;;;gm0257;89;Escherichia coli K-12 ER3446 
;;;;gm0258;89;Escherichia coli K-12 ER3454 
;;;;gm0259;89;Escherichia coli K-12 ER3466 
;;;;gm0260;89;Escherichia coli K-12 ER3475 
;;;;gm0261;89;Escherichia coli K-12 ER3476 
;;;;gm0262;89;Escherichia coli K-12 substr. HMS174 
;;;;gm0263;89;Escherichia coli K-12 substr. RV308 
;;;;gm0264;89;Escherichia coli KLY 
;2*86;;;gm0265;172;Escherichia coli KO11FL 
;;;;gm0266;87;Escherichia coli LF82 
;;;;gm0267;86;Escherichia coli LY180 
;;;;gm0268;88;Escherichia coli MNCRE44 
;;;;gm0269;82;Escherichia coli NA114 
;NCBI;11,10,8;;gm0270;123;Escherichia coli Nissle 1917 
;;;;gm0271;104;Escherichia coli O103 H2 str. 12009 
;;;;gm0272;99;Escherichia coli O104 H4 str. 2009EL-2050 
;;;;gm0273;99;Escherichia coli O104 H4 str. 2009EL-2071 
;;;;gm0274;94;Escherichia coli O104 H4 str. 2011C-3493 
;;;;gm0275;116;Escherichia coli O111 H- str. 11128 
;;;;gm0276;93;Escherichia coli O127 H6 str. E2348/69 
;;;;gm0277;93;Escherichia coli O139 H28 str. E24377A 
;;;;gm0278;113;Escherichia coli O145 H28 str. RM12581 
;;;;gm0279;104;Escherichia coli O145 H28 str. RM12761 
;;;;gm0280;113;Escherichia coli O145 H28 str. RM13514 
;;;;gm0281;104;Escherichia coli O145 H28 str. RM13516 
;;;;gm0282;96;Escherichia coli O157 H16 Santai 
;;;;gm0283;113;Escherichia coli O157 H7 str. EC4115 
;;;;gm0284;210;Escherichia coli O157 H7 str. EDL933 
;;;;gm0285;108;Escherichia coli O157 H7 str. Sakai Sakai substr. RIMD 0509952 
;;;;gm0286;112;Escherichia coli O157 H7 str. SS17 
;;;;gm0287;111;Escherichia coli O157 H7 str. SS52 
;;;;gm0288;112;Escherichia coli O157 H7 str. TW14359 
;;;;gm0289;106;Escherichia coli O26 H11 str. 11368 
;;;;gm0290;105;Escherichia coli O55 H7 str. CB9615 
;;;;gm0291;108;Escherichia coli O55 H7 str. RM12579 
;;;;gm0292;94;Escherichia coli O7 K1 str. CE10 
;;;;gm0293;84;Escherichia coli O83 H1 str. NRG 857C 
;;;;gm0294;88;Escherichia coli P12b 
;;;;gm0295;90;Escherichia coli PMV-1 
;;;;gm0296;96;Escherichia coli RM9387 
;;;;gm0297;94;Escherichia coli S88 
;;;;gm0298;92;Escherichia coli SE11 
;;;;gm0299;87;Escherichia coli SE15 
;;;;gm0300;91;Escherichia coli SMS-3-5 
;;;;gm0301;91;Escherichia coli ST131 EC958 
;;;;gm0302;284;Escherichia coli ST2747 
;;;;gm0303;285;Escherichia coli ST540 
;;;;gm0304;89;Escherichia coli str. clone D i14 
;;;;gm0305;89;Escherichia coli str. clone D i2 
;;;;gm0306;90;Escherichia coli str. K-12 substr. DH10B 
;;;;gm0307;89;Escherichia coli str. K-12 substr. MC4100 
;;;;gm0308;86;Escherichia coli str. K-12 substr. MDS42 
 ;4*86;877;1;gm0309;356;Escherichia coli str. K-12 substr. MG1655 
;;;;gm0310;89;Escherichia coli str. K-12 substr. W3110 
;;;;gm0311;86;Escherichia coli UM146 
;;;;gm0312;89;Escherichia coli UMN026 
;;;;gm0313;106;Escherichia coli UMNF18 
;;;;gm0314;99;Escherichia coli UMNK88 
;;;;gm0315;90;Escherichia coli UTI89 
;;;;gm0316;94;Escherichia coli VR50 
;;;;gm0317;176;Escherichia coli W 
;;;;gm0318;97;Escherichia coli Xuzhou21 
1;;877;1;gm0319;§89;Escherichia fergusonii ATCC 35469 
1;;877;1;gm0320;§122;Ferrimonas balearica DSM 9799 
1;;433;1;gm0321;§39;Francisella cf. novicida Fx1 
1;;433;1;gm0322;§39;Francisella cf. tularensis subsp. novicida 3523 
1;;433;1;gm0323;§39;Francisella guangzhouensis 08HL01032 
1;;433;1;gm0324;§40;Francisella noatunensis subsp. orientalis LADL--07-285A 
;;;;gm0325;36;Francisella noatunensis subsp. orientalis str. Toba 04 
1;;433;1;gm0326;§41;Francisella philomiragia GA01-2794 
;;;;gm0327;41;Francisella philomiragia GA01-2801 
;;;;gm0328;40;Francisella philomiragia O#319-029 
;;;;gm0329;40;Francisella philomiragia O#319-036 FSC 153 
;;;;gm0330;40;Francisella philomiragia O#319-067 
;;;;gm0331;40;Francisella philomiragia subsp. philomiragia ATCC 25015 O#319L 
;;;;gm0332;40;Francisella philomiragia subsp. philomiragia ATCC 25017 
1;;433;1;gm0333;§39;Francisella sp. FSC1006 
1;;433;1;gm0334;§40;Francisella sp. TX077308 
1;;433;1;gm0335;§39;Francisella tularensis subsp. holarctica 425 
;;;;gm0336;39;Francisella tularensis subsp. holarctica F92 
;;;;gm0337;39;Francisella tularensis subsp. holarctica FSC200 
;;;;gm0338;39;Francisella tularensis subsp. holarctica FTNF002-00 
;;;;gm0339;39;Francisella tularensis subsp. holarctica FTT 1 
;;;;gm0340;78;Francisella tularensis subsp. holarctica LVS 
;;;;gm0341;78;Francisella tularensis subsp. holarctica OSU18 
;;;;gm0342;39;Francisella tularensis subsp. holarctica PHIT-FT049 
;;;;gm0343;39;Francisella tularensis subsp. holarctica VT68 
;;;;gm0344;39;Francisella tularensis subsp. mediasiatica FSC147 GIEM 543 
;;;;gm0345;39;Francisella tularensis subsp. novicida D9876 
;;;;gm0346;39;Francisella tularensis subsp. novicida F6168 
;;;;gm0347;78;Francisella tularensis subsp. novicida U112 
;;;;gm0348;39;Francisella tularensis subsp. tularensis FSC198 FSC 198 
;;;;gm0349;39;Francisella tularensis subsp. tularensis NE061598 
;;;;gm0350;37;Francisella tularensis subsp. tularensis NIH B-38 
;;;;gm0351;37;Francisella tularensis subsp. tularensis Scherm 
;;;;gm0352;39;Francisella tularensis subsp. tularensis SCHU S4 
;;;;gm0353;39;Francisella tularensis subsp. tularensis SCHU S4 SHU-S4 
;;;;gm0354;39;Francisella tularensis subsp. tularensis str. SCHU S4 substr. NR-28534 
;;;;gm0355;39;Francisella tularensis subsp. tularensis TI0902 
;;;;gm0356;40;Francisella tularensis subsp. tularensis TIGB03 
;;;;gm0357;39;Francisella tularensis subsp. tularensis WY96 
;;;;gm0358;39;Francisella tularensis subsp. tularensis WY96-3418 
1;;444;1;gm0359;§76;Frateuria aurantia DSM 6220 
1;;544;1;gm0360;§54;Frischella perrara PEB0191 
1;;766;1;gm0361;§59;Gallibacterium anatis UMN179 
1;;;;gm0362;§51;gamma proteobacterium HdN1 
1;;444;1;gm0363;§53;Gilliamella apicola wkB1 
1;;444;1;gm0364;§55;Glaciecola nitratireducens FR1064 
1;;666;1;gm0365;§60;Glaciecola psychrophila 170 
1;;555;1;gm0366;§62;Glaciecola sp. 4H-3-7+YE-5 
1;;444;1;gm0367;§50;Gynuella sunshinyii YC6258 
1;;766;1;gm0368;§50;Haemophilus ducreyi 35000HP 
1;;866;1;gm0369;§59;Haemophilus influenzae 10810 
;;;;gm0370;60;Haemophilus influenzae 2019 
;;;;gm0371;61;Haemophilus influenzae 477 
;;;;gm0372;60;Haemophilus influenzae 723 
;;;;gm0373;60;Haemophilus influenzae 86-028NP 
;;;;gm0374;58;Haemophilus influenzae C486 
;;;;gm0375;60;Haemophilus influenzae CGSHiCZ412602 
;;;;gm0376;61;Haemophilus influenzae F3031 
;;;;gm0377;59;Haemophilus influenzae F3047 
;;;;gm0378;61;Haemophilus influenzae Hi375 
;;;;gm0379;59;Haemophilus influenzae KR494 
;;;;gm0380;59;Haemophilus influenzae PittEE 
;;;;gm0381;58;Haemophilus influenzae PittGG 
;;;;gm0382;58;Haemophilus influenzae R2846 
;;;;gm0383;62;Haemophilus influenzae R2866 
;;;;gm0384;59;Haemophilus influenzae Rd KW20 
;;;;gm0385;59;Haemophilus parainfluenzae T3T1 
1;;866;1;gm0386;§57;Haemophilus parasuis KL0318 
;;;;gm0387;57;Haemophilus parasuis SH0165 
;;;;gm0388;60;Haemophilus parasuis SH03 
;;;;gm0389;64;Haemophilus parasuis ZJ0906 
1;;988;1;gm0390;§94;Hafnia alvei FB1 
1;;555;1;gm0391;§69;Hahella chejuensis KCTC 2396 
1;;666;1;gm0392;§61;Halomonas campaniensis LS21 
1;;444;1;gm0393;§71;Halomonas elongata DSM 2581 
1;;666;1;gm0394;§65;Halomonas sp. KO116 
1;;;;gm0395;§48;Halorhodospira halochloris str. A 
1;;222;1;gm0396;§48;Halorhodospira halophila SL1 
1;;222;1;gm0397;§45;Halothiobacillus neapolitanus c2 
1;;444;1;gm0398;§57;Idiomarina loihiensis GSL 199 
;;;;gm0399;57;Idiomarina loihiensis L2TR 
1;;222;1;gm0400;§42;Kangiella koreensis DSM 16069 
1;;978;1;gm0401;§85;Klebsiella michiganensis RC10 
1;;988;1;gm0402;§87;Klebsiella oxytoca E718 
;;;;gm0403;87;Klebsiella oxytoca HKOPL1 
;;;;gm0404;85;Klebsiella oxytoca KCTC 1686 
;;;;gm0405;88;Klebsiella oxytoca KONIH1 
;;;;gm0406;83;Klebsiella oxytoca M1 
;;;;gm0407;80;Klebsiella pneumoniae 30660/NJST258 1 
;;;;gm0408;88;Klebsiella pneumoniae 30684/NJST258 2 
1;;10,9,9;1;gm0409;§92;Klebsiella pneumoniae 32192 
;;;;gm0410;89;Klebsiella pneumoniae 342 
;;;;gm0411;89;Klebsiella pneumoniae 34618 
;;;;gm0412;88;Klebsiella pneumoniae ATCC BAA-2146 
1;;988;1;gm0413;§87;Klebsiella pneumoniae blaNDM-1 
;;;;gm0414;82;Klebsiella pneumoniae CG43 
;;;;gm0415;89;Klebsiella pneumoniae HK787 
;;;;gm0416;86;Klebsiella pneumoniae JM45 
;;;;gm0417;90;Klebsiella pneumoniae KCTC 2242 
;;;;gm0418;86;Klebsiella pneumoniae Kp52.145 
;;;;gm0419;90;Klebsiella pneumoniae PMK1 
1;;977;1;gm0420;§70;Klebsiella pneumoniae SB3432 
;;;;gm0421;81;Klebsiella pneumoniae subsp. pneumoniae 1084 
;;;;gm0422;87;Klebsiella pneumoniae subsp. pneumoniae 1158 
;;;;gm0423;87;Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1 
;;;;gm0424;91;Klebsiella pneumoniae subsp. pneumoniae HS11286 
;;;;gm0425;87;Klebsiella pneumoniae subsp. pneumoniae Kp13 
;;;;gm0426;79;Klebsiella pneumoniae subsp. pneumoniae KP5-1 
;;;;gm0427;91;Klebsiella pneumoniae subsp. pneumoniae KPNIH1 
;;;;gm0428;91;Klebsiella pneumoniae subsp. pneumoniae KPNIH10 
;;;;gm0429;89;Klebsiella pneumoniae subsp. pneumoniae KPNIH24 
;;;;gm0430;87;Klebsiella pneumoniae subsp. pneumoniae KPNIH27 
;;;;gm0431;88;Klebsiella pneumoniae subsp. pneumoniae KPNIH29 
;;;;gm0432;89;Klebsiella pneumoniae subsp. pneumoniae KPNIH30 
;;;;gm0433;86;Klebsiella pneumoniae subsp. pneumoniae KPNIH31 
;;;;gm0434;91;Klebsiella pneumoniae subsp. pneumoniae KPNIH32 
;;;;gm0435;91;Klebsiella pneumoniae subsp. pneumoniae KPNIH33 
;;;;gm0436;87;Klebsiella pneumoniae subsp. pneumoniae KPR0928 
;;;;gm0437;88;Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ATCC 700721 
;;;;gm0438;88;Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 
;;;;gm0439;87;Klebsiella pneumoniae subsp. pneumoniae PittNDM01 
;;;;gm0440;86;Klebsiella pneumoniae XH209 
1;;988;1;gm0441;§86;Klebsiella variicola At-22 
;;;;gm0442;87;Klebsiella variicola DSM 15968 
;;;;gm0443;89;Klebsiella variicola DX120E 
1;;;;gm0444;§83;Kosakonia sacchari SP1 
1;;;;gm0445;§49;Legionella fallonii LLAP-10 
1;;;;gm0446;§45;Legionella hackeliae ATCC35250 
1;;;;gm0447;§50;Legionella longbeachae NSW150 
1;;;;gm0448;§45;Legionella oakridgensis ATCC 33761 DSM 21215 OR-10 
1;;;;gm0449;§48;Legionella pneumophila 2300/99 Alcoy 
;;;;gm0450;49;Legionella pneumophila str. Corby 
;;;;gm0451;44;Legionella pneumophila str. Lens 
;;;;gm0452;47;Legionella pneumophila str. Paris 
;;;;gm0453;46;Legionella pneumophila subsp. pneumophila ATCC 43290 
;;;;gm0454;48;Legionella pneumophila subsp. pneumophila HL06041035 
;;;;gm0455;46;Legionella pneumophila subsp. pneumophila Lorraine 
;;;;gm0456;46;Legionella pneumophila subsp. pneumophila LPE509 
;;;;gm0457;43;Legionella pneumophila subsp. pneumophila str. Hextuple 2q Philadelphia 1 substr. Lp02 
;;;;gm0458;43;Legionella pneumophila subsp. pneumophila str. Hextuple 3a Philadelphia 1 substr. Lp02 
;;;;gm0459;46;Legionella pneumophila subsp. pneumophila str. Philadelphia 1 
;;;;gm0460;41;Legionella pneumophila subsp. pneumophila str. Thunder Bay 
1;;;;gm0461;§67;Mannheimia haemolytica 89010807N 
;;;;gm0462;67;Mannheimia haemolytica 89010807N lktA- 
;;;;gm0463;64;Mannheimia haemolytica D153 
;;;;gm0464;61;Mannheimia haemolytica D171 
;;;;gm0465;68;Mannheimia haemolytica D174 
;;;;gm0466;63;Mannheimia haemolytica M42548 
;;;;gm0467;67;Mannheimia haemolytica USDA-ARS-USMARC-183 
;;;;gm0468;64;Mannheimia haemolytica USDA-ARS-USMARC-184 
;;;;gm0469;63;Mannheimia haemolytica USDA-ARS-USMARC-185 
;;766;1;gm0470;66;Mannheimia haemolytica USMARC 2286 
1;;;;gm0471;§61;Mannheimia succiniciproducens MBEL55E 
1;;;;gm0472;§64;Mannheimia varigena USDA-ARS-USMARC-1261 
;;;;gm0473;63;Mannheimia varigena USDA-ARS-USMARC-1296 
;;;;gm0474;62;Mannheimia varigena USDA-ARS-USMARC-1312 
;;;;gm0475;62;Mannheimia varigena USDA-ARS-USMARC-1388 
1;;333;1;gm0476;§57;Marichromatium purpuratum 984 987 
1;;;;gm0477;§55;Marinobacter adhaerens HP15 
1;;333;1;gm0478;§52;Marinobacter hydrocarbonoclasticus ATCC 49840 
;;;;gm0479;54;Marinobacter hydrocarbonoclasticus VT8 
1;;;;gm0480;§44;Marinobacter salarius R9SW1 
1;;;;gm0481;§48;Marinobacter similis A3d10 
1;;;;gm0482;§54;Marinobacter sp. BSs20148 
1;;777;1;gm0483;§81;Marinomonas mediterranea MMB-1 
1;;;;gm0484;§80;Marinomonas posidonica IVIA-Po-181 
1;;;;gm0485;§83;Marinomonas sp. MWYL1 
1;;222;1;gm0486;§47;Methylococcus capsulatus str. Bath 
1;;333;1;gm0487;§47;Methylomicrobium alcaliphilum 20Z 
1;;333;1;gm0488;§47;Methylomonas methanica MC09 
1;;333;1;gm0489;§44;Methylophaga frappieri JAM7 
1;;;;gm0490;§47;Methylophaga nitratireducenticrescens JAM1 
1;;444;1;gm0491;§50;Moraxella catarrhalis 25239 
;;;;gm0492;50;Moraxella catarrhalis 25240 
;;;;gm0493;50;Moraxella catarrhalis BBH18 
1;;776;1;gm0494;§82;Morganella morganii subsp. morganii KT 
1;;13,11,11;1;gm0495;§132;Moritella viscosa 
1;;;;gm0496;§48;Nitrosococcus halophilus Nc 4 
1;;;;gm0497;§48;Nitrosococcus oceani ATCC 19707 
1;;;;gm0498;§48;Nitrosococcus watsonii C-113 
1;;;;gm0499;§92;Oceanimonas sp. GK1 
1;;;;gm0500;§52;Oleispira antarctica RB-8 
1;;;;gm0501;§79;Pantoea ananatis AJ13355 
;;;;gm0502;73;Pantoea ananatis LMG 20103 
;;;;gm0503;80;Pantoea ananatis LMG 5342 
;;;;gm0504;87;Pantoea ananatis PA13 
1;;;;gm0505;§80;Pantoea rwandensis ND04 
1;;;;gm0506;§83;Pantoea sp. At-9b 
1;;;;gm0507;§85;Pantoea sp. PSNIH1 
1;;;;gm0508;§87;Pantoea sp. PSNIH2 
1;;;;gm0509;§80;Pantoea vagans C9-1 
1;;;;gm0510;§56;Pasteurella multocida 36950 
;;;;gm0511;59;Pasteurella multocida ATCC 43137 
;;;;gm0512;61;Pasteurella multocida OH1905 
;;;;gm0513;59;Pasteurella multocida subsp. multocida OH4807 
;;;;gm0514;56;Pasteurella multocida subsp. multocida str. 3480 
;;;;gm0515;55;Pasteurella multocida subsp. multocida str. HB03 
;;;;gm0516;57;Pasteurella multocida subsp. multocida str. HN06 
;;;;gm0517;58;Pasteurella multocida subsp. multocida str. Pm70 
1;;;;gm0518;§79;Pectobacterium atrosepticum 21A 
;;;;gm0519;78;Pectobacterium atrosepticum JG10-08 
;;;;gm0520;78;Pectobacterium atrosepticum SCRI1043 
1;;;;gm0521;§79;Pectobacterium carotovorum subsp. carotovorum PC1 
;;;;gm0522;78;Pectobacterium carotovorum subsp. carotovorum PCC21 
;;;;gm0523;78;Pectobacterium carotovorum subsp. odoriferum BC S7 
1;;;;gm0524;§78;Pectobacterium sp. SCC3193 
1;;;;gm0525;§76;Pectobacterium wasabiae WPP163 
1;;11,9,9;1;gm0526;§137;Photobacterium gaetbulicola Gung47 
1;;;;gm0527;§97;Photorhabdus asymbiotica 
1;;;;gm0528;§62;Plautia stali symbiont 
1;;;;gm0529;§86;Pluralibacter gergoviae FB2 
1;;;;gm0530;§83;Proteus mirabilis BB2000 
;;;;gm0531;85;Proteus mirabilis HI4320 
1;;;;gm0532;§81;Providencia stuartii ATCC 33672 
;;;;gm0533;78;Providencia stuartii MRSN 2154 
1;;;;gm0534;§63;Pseudoalteromonas atlantica T6c 
1;;10,9,9;1;gm0535;§108;Pseudoalteromonas haloplanktis TAC125 
1;;;;gm0536;§97;Pseudoalteromonas sp. OCN003 
1;;;;gm0537;§63;Pseudoalteromonas sp. SM9913 
1;;444;1;gm0538;§66;Pseudomonas aeruginosa 19BR 
;;;;gm0539;66;Pseudomonas aeruginosa 213BR 
;;;;gm0540;67;Pseudomonas aeruginosa B136-33 
;;;;gm0541;64;Pseudomonas aeruginosa c7447m C7447m 
;;;;gm0542;65;Pseudomonas aeruginosa DK2 
;;;;gm0543;66;Pseudomonas aeruginosa F22031 
;;;;gm0544;67;Pseudomonas aeruginosa FRD1 
;;;;gm0545;69;Pseudomonas aeruginosa LES400 
;;;;gm0546;68;Pseudomonas aeruginosa LES431 
;;;;gm0547;69;Pseudomonas aeruginosa LESB58 
;;;;gm0548;65;Pseudomonas aeruginosa LESB65 
;;;;gm0549;65;Pseudomonas aeruginosa LESlike1 
;;;;gm0550;65;Pseudomonas aeruginosa LESlike4 
;;;;gm0551;65;Pseudomonas aeruginosa LESlike5 
;;;;gm0552;64;Pseudomonas aeruginosa LESlike7 
;;;;gm0553;66;Pseudomonas aeruginosa M18 
;;;;gm0554;68;Pseudomonas aeruginosa MTB-1 
;;;;gm0555;72;Pseudomonas aeruginosa NCGM 1900 
;;;;gm0556;73;Pseudomonas aeruginosa NCGM 1984 
;;;;gm0557;70;Pseudomonas aeruginosa NCGM2.S1 
;;;;gm0558;67;Pseudomonas aeruginosa PA1 
;;;;gm0559;67;Pseudomonas aeruginosa PA1R 
;;;;gm0560;67;Pseudomonas aeruginosa PA38182 
;;;;gm0561;67;Pseudomonas aeruginosa PA7 
;;;;gm0562;66;Pseudomonas aeruginosa PA96 
;;;;gm0563;65;Pseudomonas aeruginosa PACS2 
;;;;gm0564;64;Pseudomonas aeruginosa PAO1 
;;;;gm0565;64;Pseudomonas aeruginosa PAO1-VE13 
;;;;gm0566;64;Pseudomonas aeruginosa PAO1-VE2 
;;;;gm0567;64;Pseudomonas aeruginosa PAO1H2O 
;;;;gm0568;64;Pseudomonas aeruginosa PAO581 
;;;;gm0569;65;Pseudomonas aeruginosa PSE305 
;;;;gm0570;66;Pseudomonas aeruginosa RP73 
;;;;gm0571;66;Pseudomonas aeruginosa SCV20265 
;;;;gm0572;66;Pseudomonas aeruginosa UCBPP-PA14 
;;;;gm0573;73;Pseudomonas aeruginosa VRFPA04 
;;;;gm0574;67;Pseudomonas aeruginosa YL84 
1;;;;gm0575;§72;Pseudomonas alkylphenolia KL28 
1;;;;gm0576;§62;Pseudomonas balearica DSM 6083 DSM6083 SP1402 
1;;;;gm0577;§66;Pseudomonas brassicacearum DF41 
;;;;gm0578;68;Pseudomonas brassicacearum subsp. brassicacearum NFM421 
1;;;;gm0579;§72;Pseudomonas chlororaphis PA23 
;;;;gm0580;81;Pseudomonas chlororaphis PCL1606 
;;;;gm0581;70;Pseudomonas chlororaphis subsp. aurantiaca JD37 
1;;;;gm0582;§67;Pseudomonas cichorii JBC1 
1;;;;gm0583;§76;Pseudomonas cremoricolorata ND07 
;;;;gm0584;64;Pseudomonas denitrificans ATCC 13867 
1;;;;gm0585;§78;Pseudomonas entomophila L48 
1;;;;gm0586;§69;Pseudomonas fluorescens A506 
;;;;gm0587;66;Pseudomonas fluorescens F113 
;;;;gm0588;69;Pseudomonas fluorescens LBUM223 
;;;;gm0589;71;Pseudomonas fluorescens PCL1751 
;;;;gm0590;74;Pseudomonas fluorescens Pf0-1 
;;;;gm0591;69;Pseudomonas fluorescens PICF7 
;;;;gm0592;67;Pseudomonas fluorescens SBW25 
;;;;gm0593;70;Pseudomonas fluorescens UK4 
1;;;;gm0594;§67;Pseudomonas fulva 12-X 
1;;;;gm0595;§62;Pseudomonas knackmussii B13 
1;;;;gm0596;§68;Pseudomonas mandelii JR-1 
1;;;;gm0597;§67;Pseudomonas mendocina NK-01 
;;;;gm0598;67;Pseudomonas mendocina ymp 
1;;;;gm0599;§69;Pseudomonas monteilii SB3078 
;;;;gm0600;67;Pseudomonas monteilii SB3101 
;;;;gm0601;81;Pseudomonas mosselii SJ10 
1;;;;gm0602;§77;Pseudomonas parafulva CRS01-1 
1;;;;gm0603;§73;Pseudomonas plecoglossicida NyZ12 
1;;;;gm0604;§65;Pseudomonas poae RE1-1-14 
1;;;;gm0605;§72;Pseudomonas protegens Cab57 
;;;;gm0606;73;Pseudomonas protegens CHA0 
;;;;gm0607;74;Pseudomonas protegens Pf-5 
1;;;;gm0608;§69;Pseudomonas pseudoalcaligenes 
;;;;gm0609;69;Pseudomonas pseudoalcaligenes CECT 5344 CECT5344 
1;;;;gm0610;§66;Pseudomonas putida BIRD-1 
;;;;gm0611;74;Pseudomonas putida DLL-E4 
;;;;gm0612;62;Pseudomonas putida DOT-T1E 
;;;;gm0613;76;Pseudomonas putida F1 
;;;;gm0614;76;Pseudomonas putida GB-1 
;;;;gm0615;70;Pseudomonas putida H8234 
;;;;gm0616;72;Pseudomonas putida HB3267 PC9 
;;;;gm0617;76;Pseudomonas putida KT2440 
;;;;gm0618;75;Pseudomonas putida NBRC 14164 
;;;;gm0619;76;Pseudomonas putida ND6 
;;;;gm0620;61;Pseudomonas putida S12 
;;;;gm0621;69;Pseudomonas putida S16 
;;;;gm0622;77;Pseudomonas putida W619 
1;;;;gm0623;§74;Pseudomonas resinovorans NBRC 106553 
1;;;;gm0624;§72;Pseudomonas rhizosphaerae DSM 16299 
1;;;;gm0625;§66;Pseudomonas savastanoi pv. phaseolicola 1448A BAA-978 
1;;;;gm0626;§65;Pseudomonas simiae WCS417 
1;;;;gm0627;§55;Pseudomonas sp. 20 BN 
1;;;;gm0628;§75;Pseudomonas sp. FGI182 
1;;;;gm0629;§77;Pseudomonas sp. MRSN12121 
1;;;;gm0630;§59;Pseudomonas sp. MT-1 
1;;;;gm0631;§72;Pseudomonas sp. StFLB209 
1;;;;gm0632;§68;Pseudomonas sp. TKP 
1;;;;gm0633;§72;Pseudomonas sp. UW4 
1;;;;gm0634;§83;Pseudomonas sp. VLB120 
1;;;;gm0635;§76;Pseudomonas sp. WCS374 
1;;;;gm0636;§63;Pseudomonas stutzeri 19SMN4 
;;;;gm0637;61;Pseudomonas stutzeri 28a24 
;;;;gm0638;62;Pseudomonas stutzeri A1501 
;;;;gm0639;61;Pseudomonas stutzeri ATCC 17588 LMG 11199 
;;;;gm0640;64;Pseudomonas stutzeri CCUG 29243 
;;;;gm0641;62;Pseudomonas stutzeri DSM 10701 
;;;;gm0642;62;Pseudomonas stutzeri DSM 4166 
;;;;gm0643;63;Pseudomonas stutzeri RCH2 
1;;;;gm0644;§63;Pseudomonas syringae CC1557 
;;;;gm0645;66;Pseudomonas syringae pv. syringae B728a 
;;;;gm0646;69;Pseudomonas syringae pv. tomato str. DC3000 
1;;;;gm0647;§50;Pseudoxanthomonas spadix BD-a59 
1;;;;gm0648;§52;Pseudoxanthomonas suwonensis 11-1 
;;;;gm0649;48;Pseudoxanthomonas suwonensis J1 
1;;;;gm0650;§50;Psychrobacter arcticus 273-4 
1;;;;gm0651;§49;Psychrobacter cryohalolentis K5 
1;;;;gm0652;§49;Psychrobacter sp. G 
1;;;;gm0653;§61;Psychrobacter sp. PRwf-1 
1;;;;gm0654;§86;Psychromonas ingrahamii 37 
1;;;;gm0655;§92;Psychromonas sp. CNPT3 
1;;;;gm0656;§77;Rahnella aquatilis CIP 78.65 ATCC 33071 
;;;;gm0657;77;Rahnella aquatilis HX2 
1;;;;gm0658;§77;Rahnella sp. Y9602 
1;;;;gm0659;§80;Raoultella ornithinolytica B6 
;;;;gm0660;86;Raoultella ornithinolytica S12 
1;;;;gm0661;§51;Rhodanobacter denitrificans 2APBS1 
1;;;;gm0662;§41;Saccharophagus degradans 2-40 
1;;;;gm0663;§88;Salmonella bongori N268-08 
;;;;gm0664;88;Salmonella bongori NCTC 12419 
;;;;gm0665;84;Salmonella bongori serovar 48 z41 -- str. RKS3044 
1;;877;1;gm0666;§83;Salmonella enterica subsp. arizonae serovar 62 z36 str. RKS2983 
;;;;gm0667;88;Salmonella enterica subsp. arizonae serovar 62 z4 z23 RSK2980 
;;;;gm0668;91;Salmonella enterica subsp. enterica serovar 4 5 12 i str. 08-1736 
;;;;gm0669;85;Salmonella enterica subsp. enterica serovar Abaetetuba str. ATCC 35640 
;;;;gm0670;89;Salmonella enterica subsp. enterica serovar Abony str. 0014 
;;;;gm0671;87;Salmonella enterica subsp. enterica serovar Agona str. 24249 
;;;;gm0672;87;Salmonella enterica subsp. enterica serovar Agona str. 460004 2-1 
;;;;gm0673;87;Salmonella enterica subsp. enterica serovar Agona str. SL483 
;;;;gm0674;85;Salmonella enterica subsp. enterica serovar Anatum str. ATCC BAA-1592 
;;;;gm0675;86;Salmonella enterica subsp. enterica serovar Anatum str. CDC 06-0532 
;;;;gm0676;83;Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1175 
;;;;gm0677;86;Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 
;;;;gm0678;77;Salmonella enterica subsp. enterica serovar Bovismorbificans str. 3114 
;;;;gm0679;87;Salmonella enterica subsp. enterica serovar Bredeney str. CFSAN001080 
;;;;gm0680;86;Salmonella enterica subsp. enterica serovar Choleraesuis C500 
;;;;gm0681;89;Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 
;;;;gm0682;88;Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 
;;;;gm0683;81;Salmonella enterica subsp. enterica serovar Dublin 
;;;;gm0684;87;Salmonella enterica subsp. enterica serovar Dublin str. CT 02021853 
;;;;gm0685;87;Salmonella enterica subsp. enterica serovar Enteritidis Durban 
;;;;gm0686;88;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1 
;;;;gm0687;86;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE10-10052 
;;;;gm0688;87;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE11-10058 
;;;;gm0689;85;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE2-98984-6 
;;;;gm0690;85;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE3-98983-4 
;;;;gm0691;86;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE4-0317-8 
;;;;gm0692;87;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE5-1104-2 
;;;;gm0693;87;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE6-00219-16 
;;;;gm0694;86;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE7-100819 
;;;;gm0695;84;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE8-1021710 
;;;;gm0696;83;Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE9-10012 
;;;;gm0697;86;Salmonella enterica subsp. enterica serovar Enteritidis SEJ 
;;;;gm0698;90;Salmonella enterica subsp. enterica serovar Enteritidis str. 77-1427 
;;;;gm0699;89;Salmonella enterica subsp. enterica serovar Enteritidis str. CDC 2010K 0968 CDC 2010K-0968 
;;;;gm0700;89;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090135 
;;;;gm0701;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090193 
;;;;gm0702;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090195 
;;;;gm0703;88;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090332 
;;;;gm0704;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090530 
;;;;gm0705;85;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090531 
;;;;gm0706;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090641 
;;;;gm0707;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090698 
;;;;gm0708;84;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20090884 
;;;;gm0709;78;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100088 
;;;;gm0710;78;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100089 
;;;;gm0711;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100100 
;;;;gm0712;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100101 
;;;;gm0713;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100103 
;;;;gm0714;84;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100130 
;;;;gm0715;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100131 
;;;;gm0716;85;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100134 
;;;;gm0717;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20100325 
;;;;gm0718;85;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110221 
;;;;gm0719;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110222 
;;;;gm0720;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110223 
;;;;gm0721;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110353 
;;;;gm0722;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110354 
;;;;gm0723;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110355 
;;;;gm0724;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110356 
;;;;gm0725;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110357 
;;;;gm0726;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110358 
;;;;gm0727;85;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110359 
;;;;gm0728;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110360 
;;;;gm0729;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20110361 
;;;;gm0730;88;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111095 
;;;;gm0731;89;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111174 
;;;;gm0732;88;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111175 
;;;;gm0733;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111510 
;;;;gm0734;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111514 
;;;;gm0735;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111515 
;;;;gm0736;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111554 
;;;;gm0737;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111561 
;;;;gm0738;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20111576 
;;;;gm0739;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120002 
;;;;gm0740;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120003 
;;;;gm0741;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120005 
;;;;gm0742;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120007 
;;;;gm0743;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120008 
;;;;gm0744;77;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120009 
;;;;gm0745;79;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120051 
;;;;gm0746;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120200 
;;;;gm0747;72;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120213 
;;;;gm0748;79;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120219 
;;;;gm0749;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120229 
;;;;gm0750;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120240 
;;;;gm0751;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120356 
;;;;gm0752;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120469 
;;;;gm0753;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120496 
;;;;gm0754;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120497 
;;;;gm0755;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120498 
;;;;gm0756;76;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120505 
;;;;gm0757;75;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120528 
;;;;gm0758;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120544 
;;;;gm0759;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120548 
;;;;gm0760;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120555 
;;;;gm0761;75;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120580 
;;;;gm0762;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120581 
;;;;gm0763;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120590 
;;;;gm0764;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120597 
;;;;gm0765;63;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120677 
;;;;gm0766;76;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120685 
;;;;gm0767;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120686 
;;;;gm0768;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120687 
;;;;gm0769;64;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120697 
;;;;gm0770;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120722 
;;;;gm0771;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120734 
;;;;gm0772;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120738 
;;;;gm0773;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120765 
;;;;gm0774;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120773 
;;;;gm0775;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120774 
;;;;gm0776;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120775 
;;;;gm0777;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120776 
;;;;gm0778;89;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120916 
;;;;gm0779;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120917 
;;;;gm0780;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120918 
;;;;gm0781;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120925 
;;;;gm0782;78;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120927 
;;;;gm0783;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120929 
;;;;gm0784;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120963 
;;;;gm0785;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120968 
;;;;gm0786;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120969 
;;;;gm0787;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120970 
;;;;gm0788;74;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120994 
;;;;gm0789;43;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121004 
;;;;gm0790;88;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121175 
;;;;gm0791;90;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121176 
;;;;gm0792;92;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121177 
;;;;gm0793;93;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121178 
;;;;gm0794;95;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121179 
;;;;gm0795;93;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121180 
;;;;gm0796;61;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121541 
;;;;gm0797;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121542 
;;;;gm0798;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121671 
;;;;gm0799;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121672 
;;;;gm0800;78;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121689 
;;;;gm0801;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121744 
;;;;gm0802;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121746 
;;;;gm0803;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121747 
;;;;gm0804;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121748 
;;;;gm0805;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121750 
;;;;gm0806;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121751 
;;;;gm0807;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121753 
;;;;gm0808;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121765 
;;;;gm0809;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121812 
;;;;gm0810;82;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121825 
;;;;gm0811;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121826 
;;;;gm0812;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121969 
;;;;gm0813;79;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121970 
;;;;gm0814;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121976 
;;;;gm0815;80;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121986 
;;;;gm0816;83;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121989 
;;;;gm0817;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121990 
;;;;gm0818;79;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122022 
;;;;gm0819;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122026 
;;;;gm0820;81;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122031 
;;;;gm0821;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122033 
;;;;gm0822;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20122045 
;;;;gm0823;86;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130345 
;;;;gm0824;87;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130346 
;;;;gm0825;64;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130347 
;;;;gm0826;79;Salmonella enterica subsp. enterica serovar Enteritidis str. EC20130348 
;;;;gm0827;87;Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 
;;;;gm0828;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19930684 
;;;;gm0829;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19940857 
;;;;gm0830;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19942384 
;;;;gm0831;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19943269 
;;;;gm0832;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19960848 
;;;;gm0833;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19961622 
;;;;gm0834;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970510 
;;;;gm0835;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19970769 
;;;;gm0836;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19971331 
;;;;gm0837;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19980677 
;;;;gm0838;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981522 
;;;;gm0839;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19981857 
;;;;gm0840;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19982831 
;;;;gm0841;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19983126 
;;;;gm0842;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19992322 
;;;;gm0843;73;Salmonella enterica subsp. enterica serovar Enteritidis str. SA19994216 
;;;;gm0844;59;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20082034 
;;;;gm0845;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083456 
;;;;gm0846;82;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20083636 
;;;;gm0847;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084384 
;;;;gm0848;76;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084644 
;;;;gm0849;71;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20084824 
;;;;gm0850;48;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20085285 
;;;;gm0851;47;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090419 
;;;;gm0852;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090435 
;;;;gm0853;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20090877 
;;;;gm0854;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20091739 
;;;;gm0855;102;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20092320 
;;;;gm0856;102;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093266 
;;;;gm0857;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093421 
;;;;gm0858;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093430 
;;;;gm0859;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093538 
;;;;gm0860;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093543 
;;;;gm0861;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093784 
;;;;gm0862;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093788 
;;;;gm0863;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093950 
;;;;gm0864;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20093977 
;;;;gm0865;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094079 
;;;;gm0866;74;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094177 
;;;;gm0867;71;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094301 
;;;;gm0868;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094350 
;;;;gm0869;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094352 
;;;;gm0870;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094383 
;;;;gm0871;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094389 
;;;;gm0872;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094521 
;;;;gm0873;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094642 
;;;;gm0874;81;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094682 
;;;;gm0875;84;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20094803 
;;;;gm0876;83;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095309 
;;;;gm0877;68;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20095440 
;;;;gm0878;47;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100239 
;;;;gm0879;65;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20100349 
;;;;gm0880;77;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20121703 
;;;;gm0881;80;Salmonella enterica subsp. enterica serovar Enteritidis str. SA20123395 
;;;;gm0882;79;Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 
;;;;gm0883;78;Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67 
;;;;gm0884;75;Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 
;;;;gm0885;89;Salmonella enterica subsp. enterica serovar Heidelberg str. 41578 
;;;;gm0886;88;Salmonella enterica subsp. enterica serovar Heidelberg str. B182 
;;;;gm0887;88;Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 
;;;;gm0888;88;Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 
;;;;gm0889;89;Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 
;;;;gm0890;86;Salmonella enterica subsp. enterica serovar Infantis 1326/28 
;;;;gm0891;88;Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992 
;;;;gm0892;88;Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20 
;;;;gm0893;86;Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1903 
;;;;gm0894;86;Salmonella enterica subsp. enterica serovar Montevideo str. USDA-ARS-USMARC-1921 
;;;;gm0895;87;Salmonella enterica subsp. enterica serovar Newport str. CDC 2010K-2159 
;;;;gm0896;89;Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 
;;;;gm0897;90;Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 
;;;;gm0898;87;Salmonella enterica subsp. enterica serovar Newport str. CVM 21554 
;;;;gm0899;91;Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 
;;;;gm0900;91;Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 
;;;;gm0901;89;Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 
;;;;gm0902;89;Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 
;;;;gm0903;86;Salmonella enterica subsp. enterica serovar Newport str. CVM N18486 
;;;;gm0904;89;Salmonella enterica subsp. enterica serovar Newport str. SL254 
;;;;gm0905;88;Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1927 
;;;;gm0906;92;Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1 
;;;;gm0907;103;Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50503 
;;;;gm0908;105;Salmonella enterica subsp. enterica serovar Paratyphi A CMCC 50973 
;;;;gm0909;86;Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU 12601 AKU12601 
;;;;gm0910;87;Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 
;;;;gm0911;87;Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 SGSC4150 
;;;;gm0912;87;Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594 
;;;;gm0913;72;Salmonella enterica subsp. enterica serovar Pullorum 
;;;;gm0914;81;Salmonella enterica subsp. enterica serovar Pullorum str. S06004 
;;;;gm0915;87;Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 
;;;;gm0916;88;Salmonella enterica subsp. enterica serovar Tennessee str. TXSC TXSC08-19 
;;;;gm0917;82;Salmonella enterica subsp. enterica serovar Thompson str. RM6836 
;;;;gm0918;83;Salmonella enterica subsp. enterica serovar Typhi str. CT18 
;;;;gm0919;81;Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 
;;;;gm0920;81;Salmonella enterica subsp. enterica serovar Typhi str. Ty2 
;;;;gm0921;81;Salmonella enterica subsp. enterica serovar Typhi str. Ty21a 
;;;;gm0922;89;Salmonella enterica subsp. enterica serovar Typhimurium 138736 
;;;;gm0923;88;Salmonella enterica subsp. enterica serovar Typhimurium ATCC 13311 
;;;;gm0924;89;Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S 
;;;;gm0925;87;Salmonella enterica subsp. enterica serovar Typhimurium str. 798 
;;;;gm0926;87;Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-0870 
;;;;gm0927;93;Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 
;;;;gm0928;89;Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 
;;;;gm0929;87;Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 
;;;;gm0930;90;Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 
;;;;gm0931;88;Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 
;;;;gm0932;90;Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 
;;;;gm0933;90;Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74 
;;;;gm0934;88;Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 
;;;;gm0935;87;Salmonella enterica subsp. enterica serovar Typhimurium str. U288 
;;;;gm0936;89;Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 
;;;;gm0937;90;Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 
;;;;gm0938;89;Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921 
;;;;gm0939;89;Salmonella enterica subsp. enterica serovar Typhimurium VNP20009 
1;;;;gm0940;§40;secondary endosymbiont of Ctenarytaina eucalypti 
1;;;;gm0941;§38;secondary endosymbiont of Heteropsylla cubana 
1;;877;1;gm0942;§87;Serratia liquefaciens ATCC 27592 
;;;;gm0943;88;Serratia liquefaciens HUMV-21 
1;;;;gm0944;§85;Serratia marcescens FGI94 
;;;;gm0945;90;Serratia marcescens SM39 
;;;;gm0946;90;Serratia marcescens subsp. marcescens Db11 
;;;;gm0947;84;Serratia marcescens WW4 
1;;;;gm0948;§82;Serratia multitudinisentens RB-25 
1;;;;gm0949;§83;Serratia plymuthica 4Rx13 
;;;;gm0950;88;Serratia plymuthica AS9 
;;;;gm0951;85;Serratia plymuthica RVH1 
;;;;gm0952;87;Serratia plymuthica S13 
;;;;gm0953;67;Serratia plymuthica V4 
1;;;;gm0954;§87;Serratia proteamaculans 568 
1;;;;gm0955;§88;Serratia sp. AS12 
1;;;;gm0956;§88;Serratia sp. AS13 
1;;;;gm0957;§93;Serratia sp. FS14 
1;;;;gm0958;§84;Serratia sp. SCBI 
1;;;;gm0959;§36;Serratia symbiotica str. Cinara cedri 
1;;;;gm0960;§102;Shewanella amazonensis SB2B 
1;;;;gm0961;§110;Shewanella baltica BA175 
;;;;gm0962;100;Shewanella baltica OS117 
;;;;gm0963;122;Shewanella baltica OS155 
;;;;gm0964;109;Shewanella baltica OS185 
;;;;gm0965;109;Shewanella baltica OS195 
;;;;gm0966;112;Shewanella baltica OS223 
;;;;gm0967;107;Shewanella baltica OS678 
1;;;;gm0968;§97;Shewanella denitrificans OS217 
1;;;;gm0969;§99;Shewanella frigidimarina NCIMB 400 
1;;;;gm0970;§128;Shewanella halifaxensis HAW-EB4 
1;;;;gm0971;§102;Shewanella loihica PV-4 
1;;;;gm0972;§106;Shewanella oneidensis MR-1 
1;;12,11,11;1;gm0973;§149;Shewanella pealeana ATCC 700345 
1;;;;gm0974;§94;Shewanella piezotolerans WP3 
1;;;;gm0975;§102;Shewanella putrefaciens 200 
;;;;gm0976;103;Shewanella putrefaciens CN-32 
1;;;;gm0977;§134;Shewanella sediminis HAW-EB3 
1;;;;gm0978;§108;Shewanella sp. ANA-3 
1;;;;gm0979;§105;Shewanella sp. MR-4 
1;;;;gm0980;§107;Shewanella sp. MR-7 
1;;;;gm0981;§101;Shewanella sp. W3-18-1 
1;;;;gm0982;§133;Shewanella violacea DSS12 
1;;;;gm0983;§134;Shewanella woodyi ATCC 51908 
1;;877;1;gm0984;§103;Shigella boydii CDC 3083-94 BS512 
;;;;gm0985;94;Shigella boydii Sb227 
1;;;;gm0986;§88;Shigella dysenteriae 1617 
;;;;gm0987;87;Shigella dysenteriae Sd197 
1;;;;gm0988;§99;Shigella flexneri 
;;;;gm0989;104;Shigella flexneri 2002017 
;;;;gm0990;99;Shigella flexneri 2003036 
;;;;gm0991;103;Shigella flexneri 2a str. 2457T 
;;;;gm0992;100;Shigella flexneri 2a str. 301 
;;;;gm0993;99;Shigella flexneri 5 str. 8401 
;;;;gm0994;100;Shigella flexneri Shi06HN006 
1;;;;gm0995;§98;Shigella sonnei 53G 
;;;;gm0996;98;Shigella sonnei Ss046 
1;;;;gm0997;§90;Shimwellia blattae DSM 4481 NBRC 105725 
1;;;;gm0998;§42;Simiduia agarivorans SA1 DSM 21679 
1;;;;gm0999;§76;Sodalis glossinidius str. morsitans 
1;;;;gm1000;§78;Sodalis praecaptivus HS1 
1;;;;gm1001;§46;Spiribacter salinus M19-40 
1;;;;gm1002;§46;Spiribacter sp. UAH-SP71 
1;;322;1;gm1003;§71;Stenotrophomonas maltophilia 13637 
;;;;gm1004;77;Stenotrophomonas maltophilia D457 
;;;;gm1005;75;Stenotrophomonas maltophilia JV3 
;;;;gm1006;76;Stenotrophomonas maltophilia K279a 
;;;;gm1007;74;Stenotrophomonas maltophilia R551-3 
1;;;;gm1008;§67;Stenotrophomonas rhizophila DSM14405 
1;;;;gm1009;§89;synthetic Escherichia coli C321.deltaA 
1;;;;gm1010;§47;Tatlockia micdadei ATCC33218 
1;;;;gm1011;§41;Teredinibacter turnerae T7901 
1;;;;gm1012;§51;Thalassolituus oleivorans MIL-1 
;;;;gm1013;49;Thalassolituus oleivorans R6-15 
1;;;;gm1014;§43;Thioalkalimicrobium aerophilum AL3 
1;;;;gm1015;§41;Thioalkalimicrobium cyclicum ALM1 
1;;;;gm1016;§46;Thioalkalivibrio nitratireducens DSM 14787 
1;;;;gm1017;§49;Thioalkalivibrio sp. K90mix 
1;;;;gm1018;§45;Thioalkalivibrio sulfidiphilus HL-EbGr7 HL-EbGR7 
1;;;;gm1019;§48;Thioalkalivibrio thiocyanoxidans ARh 4 
1;;;;gm1020;§53;Thiocystis violascens DSM 198 
1;;;;gm1021;§48;Thioflavicoccus mobilis 8321 
1;;;;gm1022;§40;Thiolapillus brandeum Hiromi 1 
1;;;;gm1023;§45;Thiomicrospira crunogena XCL-2 
1;;;;gm1024;§45;Thioploca ingrica 
1;;;;gm1025;§92;Tolumonas auensis DSM 9187 
1;;;;gm1026;§106;Vibrio alginolyticus NBRC 15630 ATCC 17749 
1;;;;gm1027;§87;Vibrio anguillarum 775 
;;;;gm1028;§94;Vibrio anguillarum NB10 
1;;;;gm1029;96;Vibrio campbellii ATCC BAA-1116 
;;;;gm1030;121;Vibrio campbellii ATCC BAA-1116 BB120 
1;;;;gm1031;§94;Vibrio cholerae 10432-62 
;;;;gm1032;104;Vibrio cholerae 1154-74 
;;;;gm1033;99;Vibrio cholerae 2012EL-2176 
;;;;gm1034;81;Vibrio cholerae H1 
;;;;gm1035;98;Vibrio cholerae IEC224 
;;;;gm1036;95;Vibrio cholerae LMA3984-4 
;;;;gm1037;97;Vibrio cholerae M66-2 
;;;;gm1038;98;Vibrio cholerae MJ-1236 
;;;;gm1039;90;Vibrio cholerae MS6 
;;;;gm1040;94;Vibrio cholerae O1 biovar El Tor FJ147 
;;;;gm1041;98;Vibrio cholerae O1 biovar El Tor str. N16961 
;;;;gm1042;79;Vibrio cholerae O1 str. 2010EL-1786 
;2*96;;;gm1043;192;Vibrio cholerae O395 
1;;;;gm1044;§87;Vibrio coralliilyticus OCN014 
;;;;gm1045;117;Vibrio coralliilyticus RE98 
1;;;;gm1046;§100;Vibrio furnissii NCTC 11218 
1;;;;gm1047;§104;Vibrio nigripulchritudo SFn1 
1;;12,11,11;1;gm1048;§126;Vibrio parahaemolyticus BB22OP 
1;;;;gm1049;§130;Vibrio parahaemolyticus O1 K33 str. CDC K4557 
;;;;gm1050;131;Vibrio parahaemolyticus O1 Kuk str. FDA R31 
;;;;gm1051;127;Vibrio parahaemolyticus RIMD 2210633 O3 K6 substr. RIMD 2210633 
;;;;gm1052;122;Vibrio parahaemolyticus UCM-V493 
1;;;;gm1053;§121;Vibrio sp. EJY3 
1;;;;gm1054;§125;Vibrio sp. Ex25 EX25 
1;;;;gm1055;§114;Vibrio tasmaniensis LGP32 
1;;;;gm1056;§118;Vibrio tubiashii ATCC 19109 
1;;;;gm1057;§109;Vibrio vulnificus 93U204 
;;;;gm1058;113;Vibrio vulnificus CMCP6 
;;;;gm1059;114;Vibrio vulnificus MO6-24/O 
;;;;gm1060;113;Vibrio vulnificus YJ016 
1;;;;gm1061;§34;Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis 
1;;;;gm1062;§53;Xanthomonas albilineans GPE PC73 
1;;;;gm1063;§55;Xanthomonas axonopodis pv. citri str. 306 
;;;;gm1064;54;Xanthomonas axonopodis pv. citrumelo F1 
;;;;gm1065;55;Xanthomonas axonopodis Xac29-1 
1;;222;1;gm1066;§55;Xanthomonas campestris 17 
;;;;gm1067;55;Xanthomonas campestris pv. campestris B100 
;;;;gm1068;57;Xanthomonas campestris pv. campestris str. 8004 
;;;;gm1069;58;Xanthomonas campestris pv. campestris str. ATCC 33913 
;;;;gm1070;58;Xanthomonas campestris pv. raphani 756C 
;;;;gm1071;59;Xanthomonas campestris pv. vesicatoria str. 85-10 
1;;222;1;gm1072;§55;Xanthomonas citri subsp. citri 5208 
;;;;gm1073;55;Xanthomonas citri subsp. citri A306 
;;;;gm1074;57;Xanthomonas citri subsp. citri Aw12879 
;;;;gm1075;57;Xanthomonas citri subsp. citri AW13 
;;;;gm1076;57;Xanthomonas citri subsp. citri AW14 
;;;;gm1077;57;Xanthomonas citri subsp. citri AW15 
;;;;gm1078;57;Xanthomonas citri subsp. citri AW16 
;;;;gm1079;55;Xanthomonas citri subsp. citri BL18 
;;;;gm1080;55;Xanthomonas citri subsp. citri FB19 
;;;;gm1081;55;Xanthomonas citri subsp. citri gd2 
;;;;gm1082;55;Xanthomonas citri subsp. citri gd3 
;;;;gm1083;55;Xanthomonas citri subsp. citri jx4 
;;;;gm1084;55;Xanthomonas citri subsp. citri jx5 
;;;;gm1085;55;Xanthomonas citri subsp. citri mf20 
;;;;gm1086;55;Xanthomonas citri subsp. citri MN10 
;;;;gm1087;55;Xanthomonas citri subsp. citri MN11 
;;;;gm1088;55;Xanthomonas citri subsp. citri MN12 
;;;;gm1089;55;Xanthomonas citri subsp. citri NT17 
;;;;gm1090;55;Xanthomonas citri subsp. citri UI6 
;;;;gm1091;55;Xanthomonas citri subsp. citri UI7 
1;;;;gm1092;§55;Xanthomonas fuscans subsp. fuscans 4834-R 
1;;;;gm1093;§55;Xanthomonas oryzae pv. oryzae KACC 10331 KACC10331 
;;;;gm1094;54;Xanthomonas oryzae pv. oryzae MAFF 311018 
;;;;gm1095;54;Xanthomonas oryzae pv. oryzae PXO86 
;;;;gm1096;55;Xanthomonas oryzae pv. oryzae PXO99A 
;;;;gm1097;54;Xanthomonas oryzae pv. oryzicola BLS256 
;;;;gm1098;57;Xanthomonas oryzae pv. oryzicola CFBP7342 
1;;;;gm1099;§57;Xanthomonas sacchari R1 
1;;877;1;gm1100;§82;Xenorhabdus bovienii CS03 
;;;;gm1101;88;Xenorhabdus bovienii SS-2004 
1;;;;gm1102;§79;Xenorhabdus doucetiae FRM16 
1;;;;gm1103;§81;Xenorhabdus nematophila AN6/1 
;;;;gm1104;81;Xenorhabdus nematophila ATCC 19061 
1;;;;gm1105;§80;Xenorhabdus poinarii G6 
1;;222;1;gm1106;§53;Xylella fastidiosa 9a5c 
;;;;gm1107;52;Xylella fastidiosa M12 
;;;;gm1108;50;Xylella fastidiosa M23 
;;;;gm1109;50;Xylella fastidiosa MUL0034 
;;;;gm1110;49;Xylella fastidiosa subsp. fastidiosa GB514 
;;;;gm1111;55;Xylella fastidiosa subsp. sandyi Ann-1 
;;;;gm1112;49;Xylella fastidiosa Temecula1 
1;;;;gm1113;§84;Yersinia aldovae 670-83 
1;;;;gm1114;§79;Yersinia enterocolitica 2516-87 
;;877;1;gm1115;85;Yersinia enterocolitica 8081 
;;;;gm1116;83;Yersinia enterocolitica subsp. enterocolitica 8081 
;;;;gm1117;73;Yersinia enterocolitica subsp. palearctica 105.5Rr 
;;;;gm1118;72;Yersinia enterocolitica subsp. palearctica Y11 
;;;;gm1119;79;Yersinia enterocolitica type O 5 str. YE53/03 
;;;;gm1120;86;Yersinia enterocolitica WA 
1;;;;gm1121;§86;Yersinia frederiksenii Y225 
1;;;;gm1122;§82;Yersinia intermedia Y228 
1;;;;gm1123;§85;Yersinia kristensenii ATCC 33639 
;;;;gm1124;85;Yersinia kristensenii Y231 
1;;;;gm1125;§140;Yersinia pestis A1122 
;;;;gm1126;141;Yersinia pestis Angola 
;;;;gm1127;142;Yersinia pestis Antiqua 
;;877;1;gm1128;73;Yersinia pestis biovar Medievalis str. Harbin 35 
;;;;gm1129;73;Yersinia pestis biovar Microtus str. 91001 
;;;;gm1130;71;Yersinia pestis CO92 
;;;;gm1131;71;Yersinia pestis D106004 
;;;;gm1132;74;Yersinia pestis D182038 
;;;;gm1133;72;Yersinia pestis Dodson 
;;;;gm1134;70;Yersinia pestis El Dorado 
;;;;gm1135;71;Yersinia pestis Harbin35 
;;;;gm1136;72;Yersinia pestis Java9 
;;;;gm1137;74;Yersinia pestis KIM10+ 
;;;;gm1138;75;Yersinia pestis KIM5 
;;;;gm1139;72;Yersinia pestis Nairobi 
;;;;gm1140;73;Yersinia pestis Nepal516 
;;;;gm1141;73;Yersinia pestis Nicholisk 41 
;;;;gm1142;72;Yersinia pestis PBM19 
;73+74;;;gm1143;147;Yersinia pestis Pestoides F 
;;;;gm1144;74;Yersinia pestis Pestoides G 
;;;;gm1145;71;Yersinia pestis Shasta 
;;;;gm1146;74;Yersinia pestis str. Pestoides B 
;;;;gm1147;69;Yersinia pestis Z176003 
1;;;;gm1148;§83;Yersinia pseudotuberculosis 1 
;;877;1;gm1149;82;Yersinia pseudotuberculosis ATCC 6904 
;;;;gm1150;84;Yersinia pseudotuberculosis EP2/+ 
;;;;gm1151;87;Yersinia pseudotuberculosis IP 31758 
;;;;gm1152;87;Yersinia pseudotuberculosis IP 32953 
;;;;gm1153;87;Yersinia pseudotuberculosis IP 32953 IP32953 
;;;;gm1154;86;Yersinia pseudotuberculosis MD67 
;;;;gm1155;170;Yersinia pseudotuberculosis PB1/+ 
;;;;gm1156;88;Yersinia pseudotuberculosis str. PA3606 Pa3606 
;2*85;;;gm1157;170;Yersinia pseudotuberculosis YPIII 
1;;;;gm1158;§82;Yersinia rohdei YRA 
1;;;;gm1159;§84;Yersinia ruckeri Big Creek 74 
;;;;gm1160;82;Yersinia ruckeri YRB 
1;;;;gm1161;§88;Yersinia similis 228 

Alpha[modifier | modifier le wikicode]

alpha blocs[modifier | modifier le wikicode]

alpha blocs;;;;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;alf001-34;;;;;;Notes
alf001;5*16atcgca235-atgf;;9;60;15;45;;;6-atcgca-35;6-gcaatc-35;6-atc-35;6-gca-35;16, 235;
alf010;2*16atcgca235-atgf;;;48;6;42;;sans;16;;;;;incomplets
alf011;2*16atcgca235-atgf;;;48;6;42;;atgf;30;;;;;2*16s23s
;;;4;;;;;autres 1-3;1;;;;;16atcgca23
alf012;3*16atcgca-cds-23-cds-5-atgf ;;;55;12;43;;cds;;;;;3;
;16atcgca-cds-cds-23-cds-5-atgf;;;;;;;cds, atgf;13;;;;;Autres 1-3
;;;;;;;63;total;60;0;;;3;16atcgca235-cgg
alf013;3*16atcgca235-atgf;;;56;9;47;;;;;;;;
;;;3;;;;;;;;;;;
alf014  agr;5*16atcgca-cds-23-5-atgf;;;58;15;43;;;;;;;;
;;;5;;;;;;;;;;;
alf015;4*16atcgca-cds-23-5-atgf;;;57;15;42;;;;;;;;
;16atcgca23-5-atgf;;5;;;;;;;;;;;
;;;;;;;;;;;;;;
alf017;4*16atcgca235-atgf;;;56;12;44;;;;;;;;
;;;4;;;;;;;;;;;
alf020;16s-cds, 23s-5s;;;37;0;37;;;;;;;;
alf021;16s-cds, 23s-5s;;3;35;0;35;;;;;;;;
alf025;16s-cds-cds, 23s-5s ;;;37;0;37;;;;;;;;
;;;;;;;;;;;;;;
alf029;2*16atcgca235-atgf;;;51;9;42;;;;;;;;
;16atcgca235-cgg;;3;;;;;;;;;;;
;;;;;;;;;;;;;;
alf030;3*16atcgca235;;;54;6;48;;;;;;;;
;;;3;;;;;;;;;;;
alf031 abq;5*16atcgca235;;;88;21;67;;;;;;;;
;3*16atcgca235-atgf;;9;;;;;;;;;;;
;16atcgca23;;;;;;;;;;;;;
;;;;;;;;;;;;;;
alf033;4*16atcgca235-atgf;;;83;20;63;;;;;;;;
;4*16atcgca235;;9;;;;;;;;;;;
;16s23s;;;;;;;;;;;;;
;;;;;;;;;;;;;;
alf034;4*16atcgca235-atgf;;9;84;20;64;;;;;;;;
;4*16atcgca235;;;;;;;;;;;;;
;16s23s;;66;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;alf035-159;;;;;;Notes
alf035;2*16atcgca235-atgf;;10;43;6;37;;;6-atcgca-35;6-gcaatc-35;6-atc-35;6-gca-35;16, 235;
alf036;2*16atcgca235-atgf;;;45;6;39;;sans;13;;;;2;
alf037;2*16atcgca235-atgf;;;42;6;36;;atgf;19;8;;;;
alf038;2*16atcgca-cds-235-atgf;;;43;6;37;;autres 1-3;;;;;;
alf039;2*16atcgca235-atgf;;;43;6;37;;cds;;1;;;;
;;;;;;;;cds, atgf;14;;;;;
alf043;2*16atcgca-cds-235-atgf;;4;43;6;37;57;total;46;9;;;2;
alf044;2*16atcgca-cds-235-atgf;;;43;6;37;;;;;;;;
;;;;;;;;;;;;;;
alf046;2*16atcgca-cds-235-atgf;;8;43;6;37;;;;;;;;
alf047;3*16atcgca235-atgf;;;54;9;45;;;;;;;;
alf048;16atcgca235;;;60;2;58;;;;;;;;
alf049;2*16atcgca235;;;64;4;60;;;;;;;;
;;;;;;;;;;;;;;
alf052;2*16atcgca235;;12;57;4;53;;;;;;;;
alf053;2*16atcgca235;;;56;4;52;;;;;;;;
alf054;2*16atcgca235;;;52;4;48;;;;;;;;
alf055;16atcgca235;;;50;2;48;;;;;;;;
alf056;2*16atcgca235-atgf;;;49;6;43;;;;;;;;
alf057;3*16atcgca-cds-235-atgf;;;55;9;46;;;;;;;;
;;;;;;;;;;;;;;
alf071;3*16atcgca-cds-235-atgf;;11;55;9;46;;;;;;;;
alf105;16-gca-atc-235-atgf;;;42;3;39;;;;;;;;
alf111;3*16-gca-atc-235-atgf;;;46;9;37;;;;;;;;
alf117;2*16atcgca235;;;43;4;39;;;;;;;;
alf123;2*16atcgca235-atgf;;;52;6;46;;;;;;;;
;;;;;;;;;;;;;;
alf130;16s, 23s5s;;2;36;0;36;;;;;;;;
alf131;16s, 23s5s;;;37;0;37;;;;;;;;
;;;;;;;;;;;;;;
alf146;4*16atcgca235-atgf;;5;60;12;48;;;;;;;;
alf159;16atcgca235;;;53;2;51;;;;;;;;
;;;;;;;;;;;;;;
alf162;4*16-gca-atc-235-atgf;;5;58;14;44;;;;;;;;
;16-gca-atc-cds-235;;57;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;alf166-317;;;;;;Notes
alf166;5*16-gca-atc-235-atgf;;7;66;15;51;;;6-atcgca-35;6-gcaatc-35;6-atc-35;6-gca-35;16, 235;
alf174;2*16atcgca235-atgf;;;55;6;49;;sans;10;;;2;2;
;;;;;;;;atgf;34;9;;;;
alf187;4*16atcgca235-atgf;;6;72;14;58;;autres 1-3;;;;;;
;2*16-gca-235;;;;;;;cds;;;;;;
;;;;;;;;cds, atgf;5;;;;;
alf198;16atcgca235;;16;58;2;56;62;total;49;9;;2;2;
alf202;3*16atcgca235-atgf;;;59;9;50;;;;;;;;
alf203 oan;4*16atcgca-cds-235-atgf;;;61;12;49;;;;;;;;
alf212;4*16atcgca235-atgf;;;62;12;50;;;;;;;;
alf218;4*16-gca-atc-235-atgf;;;61;12;49;;;;;;;;
;;;;;;;;;;;;;;
alf223;4*16atcgca235;;6;70;14;56;;;;;;;;
;2*16atcgca235-atgf;;;;;;;;;;;;;
;;;;;;;;;;;;;;
alf224;3*16atcgca235-atgf;;3;54;9;45;;;;;;;;
;;;;;;;;;;;;;;
alf298 rtb;16s,235s;;2;33;0;33;;;;;;;;
alf301;16s,235s;;;39;0;39;;;;;;;;
;;;;;;;;;;;;;;
alf303;16atcgca235;;5;38;2;36;;;;;;;;
alf304;16atcgca235;;;38;2;36;;;;;;;;
alf305;2*16atcgca235-atgf;;;54;8;46;;;;;;;;
;16atcgca235;;;;;;;;;;;;;
;;;;;;;;;;;;;;
alf306;5*16atcgca235-atgf;;5;64;15;49;;;;;;;;
;;;;;;;;;;;;;;
alf307;2*16atcgca235-atgf;;3;56;9;47;;;;;;;;
;16atcgca23-cds-5-atgf;;;;;;;;;;;;;
;;;;;;;;;;;;;;
alf308;3*16atcgca235-atgf;;6;56;9;47;;;;;;;;
alf309;3*16atcgca235-atgf;;;56;9;47;;;;;;;;
;;;;;;;;;;;;;;
alf317;2*16atcgca235;;3;62;7;55;;;;;;;;
;16atcgca235-atgf;;62;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;alf321-343;;;;;;Notes
alf321;2*16atcgca235;;3;63;7;56;;;6-atcgca-35;6-gcaatc-35;6-atc-35;6-gca-35;16, 235;
;16atcgca235-atgf;;;;;;;sans;5;;;0;1;
;;;;;;;;atgf;8;;4;;;
alf326;16atcgca235-atgf;;1;47;3;44;;autres 1-3;;;;;;
;;;;;;;;cds;;;;;;
alf329;3*16atcgca235-atgf;;4;61;11;50;;cds, atgf;;;;;;
;16atcgca235;;;;;;18;total;13;0;4;0;1;
;;;;;;;;;;;;;;
alf330;4*16-atc-235-atgf;;7;58;8;50;;;;;;;;
alf331;16s,235s;;;34;0;34;;;;;;;;
alf341;2*16atcgca235;;;55;4;51;;;;;;;;
;;;;;;;;;;;;;;
alf343;3*16atcgca235-atgf;;3;52;9;43;;;;;;;;
;;;18;;;;;;;;;;;
lien;blocs;;16s;total aas;avec;sans;total page;total;;;;;;Notes
;;;;;;;;;6-atcgca-35;6-gcaatc-35;6-atc-35;6-gca-35;16, 235;incomplets
;;;;;;;;sans;44;0;0;2;5;2*16s23s
;;;;;;;;atgf;91;17;4;0;0;16atcgca23
;Moyenne;;;53;8;46;;autres 1-3;1;0;0;0;0;
;ecartype;;;11;5;8;;cds;0;1;0;0;3;Autres 1-3
;max;;;88;21;67;;cds, atgf;32;0;0;0;0;16atcgca235-cgg
;min;;;33;0;33;200;total;168;18;4;2;8;

alpha notes[modifier | modifier le wikicode]

alpha typage[modifier | modifier le wikicode]

alpha gamma typage[modifier | modifier le wikicode]
16-y-235-z;16s23s5s;atcgca;gcaatc;gaa;autres;total;%
après 16s;;;;;;;
gamma;;;;;;;
sans z;58;238;14;160;37;507;72
avec z;17;85;0;78;17;197;28
total;75;323;14;238;54;704;
%;11;46;2;34;8;;
;;;;;;;
alpha;;;;;;;
sans z;0;44;1;0;10;55;27.5
avec z;0;124;17;0;4;145;72.5
total;0;168;18;0;14;200;
%;0;84;9;0;7;;
après 5s;;;;;;;
16-235-z,z’;gac-tgg;gac;acc-5s;atgf;autres;total;
gamma;66;80;46;0;26;218;
%;30;37;21;0;12;;
;;;;;;;
alpha;0;0;0;144;1;145;
%;0;0;0;99;1;;
alpha typage cds[modifier | modifier le wikicode]
Les cds intra bloc des alphas;;;;;;;;;;
date NCBI;génome;sens;adresse;;cds;après;aas;égale en aas;séquence aas;
03/08/16;alf12;comp;59238..59627;;c11;gca cp;129;c11=c22;MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHHLLDLAEPFLLAYAQRGAKSGNPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDVFDTILFEGTPVHFEVVSLRPASRDIIR;*
;;;62235..62492;;c12;23s;85;c12=c23;MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTKVDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE;*
;;;2516197..2516583;;c21;gca cp;128;;MPRTSDPSYLQPLHQFRPTKPSHGFSGIGLGRFGPKPKTPGRFQTYLLFTMYSEQASILANDANVFSSKGYSSTHAPKALREGAKLLATRYRAVLLADQITHAGSASRRPSLAGPCEAQRQSRDSVST;*
;;;2515743..2516132;;c22;cds  cp;129;;MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHHLLDLAEPFLLAYAQRGAKSGNPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDVFDTILFEGTPVHFEVVSLRPASRDIIR;*
;;comp;2512878..2513135;;c23;23s;85;;MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTKVDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE;*
;;comp;1044310..1044699;;l11;gca cp;129;c11=l11;MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHHLLDLAEPFLLAYAQRGAKSGNPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDVFDTILFEGTPVHFEVVSLRPASRDIIR;*
;;;1047307..1047564;;l12;23s;85;c12=l12;MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTKVDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE;*
;;comp;1306725..1307114;;l21;gca cp;129;;MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHHLLDLAEPFLLAYAQRGAKSGHPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDVFDTILFEGTPVHFEVVSLRPASRDIIR;*
;;;1309700..1309999;;l22;23s;99;;MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRTKVDDICSVFTLTWPSATTLQTARQTIGDGLASCMVAMLDLEQRNIRNKSQKDVLN;*
;;;;;;;;;;*
26/08/19;alf14 agr;comp;<59429..59626;;c11;gca cp;66;;P-hp;*
;;;2496166..>2496363;;c21;gca cp;67;;P-hp;*
;;comp;<1429429..1429626;;l11;gca cp;68;;P-hp;*
;;comp;<1690307..1690504;;l21;gca cp;69;;P-hp;*
;;comp;<2105696..2105893;;l31;gca cp;70;;P-hp;*
;;;;;;;;;;*
07/01/20;alf15;comp;<59347..59592;;c11;gca cp;82;;P-hp;*
;;;2508109..2508427;;c21;gca cp;106;;P-hp;*
;;comp;<1122642..1122887;;l11;gca cp;82;;P-hp;*
*01/09/2019;avant;?;2044048..2044367;;l21;gca;-;;P-hp;*
;;;;;;;;;;*
25/08/19;alf020;comp;1001462..1001845;;c11;16s;127;sdhC;MVLRSRPLSPHLQIYRLPVAAWLSITHRASGLLLFFGLLVLSWLFVLLRCAPDCVMPFLANPWGFFLVKLLSFSCCVAFCYHYFNGVRHLLWDCGVGLDKTVVTASNTFVLLLTAAFSVVTFFFVWL;*
;;comp;1001115..1001450;;c12;cds;111;sdhD;MGGRSVYFWWMQRIAGLVMLPVPFLFVFFYRSYGFESVYAADYGFCASISGIALLVAAFYHGVLGVQVVLEDYVQSEVARAFMVTFFRLFSAVTIGAVVLALFFGHGVGGS;*
;;;;;;;;;;
27/08/19;alf021;;249441..249824;;c11;16s;127;sdhC;MVLRSRPLSPHLQVYKLPVAALLSITHRASGLFLFFGLSVLSWLFVLLRCAPDCIAPFLANPLGFFLVKLLSFSCCVAFCYHYFNGVRHLLWDCGVGLDKTAVTASSAFVLLLTAAFSVVAFFFVWL;*
;;;249836..250165;;c12;cds;109;sdhD;MGGRSVYFWWMQRIAGLVMLPVPFLFAFFYRSYGFESVHAADYGFCASVSAIALLVAAFYHGVLGVQVVLEDYVHSEVLRAFMITFFRLFALVTVCAVTLAMLFGHNIR;*
;;;;;;;;;;*
29/11/19;alf025;comp;1055653..1056036;;c11;16s;127;sdhC;MSRSRPLSPHLSVYKLPITAWLSITHRITGVLLLMGLTLFTWLLISLHWTSGQLWGLLDSWIGVLLVKVIIGGCIAALCYHYYNGIRHLFWDCGIGFGKSEATFSGWLMLGFAVTSLIGLGFIGFFS;*
;;comp;1055320..1055649;;c12;cds;109;sdhD;MSGKSILHWWMQRMTAVVMLPVPIFLVKALLVSDFATGLLDLTHGYKGALTALFLMPAFYHGVLGVQVVLEDYVRSDALRAFLITFIKLFAVLTVCVFSLVVLLRTLGM;*
;;;;;;;;;;*
25/08/19;alf038;;1751403..1751597;;c11;gca cp;64;c11=c21;MIVLIANIHSLFVRILCLVQNKAQNKHKYQQKRPASRDIFNGAVKLPIISKGFEHSPATQCLFF;*
;;;1896294..1896488;;c21;gca cp;64;;MIVLIANIHSLFVRILCLVQNKAQNKHKYQQKRPASRDIFNGAVKLPIISKGFEHSPATQCLFF;*
;;;;;;;;;;*
*01/09/2019;alf043;;-;;c11;gca;72;c11=c21;MIVLIANIHSMFVGILCLVQNKAQNKQKYQQKRPASRDIFSGAVKLPIIGKGFENSLATQVPFSVLFLFSVF;*
05/01/20;néant;;-;;c21;gca;72;;MIVLIANIHSMFVGILCLVQNKAQNKQKYQQKRPASRDIFSGAVKLPIIGKGFENSLATQVPFSVLFLFSVF;*
;;;;;;;;;;*
08/08/19;alf044;comp;1854849..1855037;;c11;gca;62;c11=c21;MMCRKGMLKALAYDWKLNRAIEYISRSWSFLLIFVFVLRFVLHKTKNADKQSSYYYSMMLIQ;*
;;comp;2061198..2061386;;c21;gca;62;;MMCRKGMLKALAYDWKLNRAIEYISRSWSFLLIFVFVLRFVLHKTKNADKQSSYYYSMMLIQ;*
;;;;;;;;;;*
26/08/19;alf046;;1353691..1353915;;c11;gca cp;74;c11=c21;MIVLIANIHSAFVSFFALCKTKRAKQTKYQQKRPASRDIFNGAVKLPIISKGFEHSLATQCFLVSFLDFFERPF;*
;;;1496257..1496481;;c21;gca cp;74;;MIVLIANIHSAFVSFFALCKTKRAKQTKYQQKRPASRDIFNGAVKLPIISKGFEHSLATQCFLVSFLDFFERPF;*
;;;;;;;;;;*
24/12/19;alf057;;1602851..1603093;;c11;gca cp;80;c11=c21;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;1806931..1807173;;c21;gca cp;80;c11=c31;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;1057289..1057531;;c31;gca cp;80;;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;;;;;;alf057=alf071;;*
30/03/17;alf071;;1586714..1586956;;c11;gca cp;80;c11=c21;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;1791119..1791361;;c21;gca cp;80;c11=c31;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;1106853..1107095;;c31;gca cp;80;;MRRRMLPFDCKCSFQQYQQKDQLLEIQSVMAVKHINHYARLEQASCDINSSVDPITSSLHDFIQNRQTFVKVRKLVSFFC;*
;;;;;;;;;;*
18/12/14;alf162;;1548251..1548361;;c11;atc cp;36;;MDQSLFSAPHGLSQSITSFIASYCQGIHQTPFSRLI;*
;;;;;;;;;;*
*27/12/2019;alf203  oan;comp;1085980..>1086168;;c11;gca cp;63;;P-hp;*
05/01/20;néant;comp;1348203..>1348391;;c21;gca cp;63;;P-hp;*
;;comp;458785..>458973;;c31;gca cp;63;;P-hp;*
;;;<1601419..1601607;;c41;gca cp;63;;P-hp;*
;;;;;;;;;;*
27/07/17;alf307;comp;3626306..3626473;;c11;23s cp;55;;MNTSCVLSGQLQQPAEPSRQSSGAPSAAPLAREDRRMMLIYDEHKQWERSSRSND;*
;;;;;;;;;;*
28/08/19;aua;;4501..4851;;c11;gca cp;76;;MIVLIAHVHQTSSEDEGERDEQDGFFSSLSALNTGPRATGVGVLRRRSASSRALDGRELAKDQLPETDPDNGGQAR;*
alpha typage absence de cds[modifier | modifier le wikicode]
;après 5s-atgf-cds;;;;;;
28/11/19;alf036;NCBI;;;;;
comp;<250713..250865;;cds;1022;51;transcriptional repressor;
;251888..253381;;16s;315;1494;;
;253697..253773;;atc;122;;;
;253896..253971;;gca;305;;;
;254277..257097;;23s;96;2821;;
;257194..257308;;5s;128;115;;
;257437..257513;;atgf;1208;;;
;258722..259111;;cds;;130;MGSFVNLIIYGGIYLMKRIVLVAALCSALSSVIVPVTANALPVGGGWGTVRDKVVGALVTEGNLGEGGRAILEKIVVPSRKNLFEYKDKAFEIQERYRSIISALGLRVSCGLLNPDRYSGQRWMSCEFK;hp   129
;;;;;;;
comp;1106662..1107051;;cds;1227;130;MGSFVNLIIYGEIYLMKRIVLVAALCSALSSVIVPVTANALPVGGGWGTVRDKVVGALVTEGNLGEGGRAILEKIVVPSRKNLFEYKDKAFEIQERYRSIISALGLRVSCGLLNPDRYSGQRWMSCEFK;hp   129
comp;1108279..1108355;;atgf;128;;;
comp;1108484..1108598;;5s;96;115;;
comp;1108695..1111515;;23s;305;2821;;
comp;1111821..1111896;;gca;122;;;
comp;1112019..1112095;;atc;315;;;
comp;1112411..1113904;;16s;1022;1494;;
;1114927..1115313;;cds;;129;transcriptional repressor;
alpha typage cds et intercalaires[modifier | modifier le wikicode]
génome;16s-aa1;aa2-23s;16s-23s;n blocs;type;lien;notes
;;;;;;;
alpha typage, cds et intercalaires;;;;;;;
alf036;315;305;-;2;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Fiche/Proteobacteria#alpha_typage_absence_de_cds;*
alf254 rru;184;362;-;4;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#rru_blocs;*
alf031 abq;94-110;254-266;-;8;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#abq_blocs;*
“;-;-;262;1;16s-23s;;
alf032 abs;107-110;269-272;-;4;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#abs_blocs_tableau;*
alf253 rpm;112;212-216;-;6;atc;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#rpm_blocs_construits;*
“;182;196;-;1;gca;;*
alf203 oan;268;266;-;4;atc-gca cds;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#oan_blocs;*
alf014 agr;337;585;-;5;atc-gca cds;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#agr_blocs;*
aua;236;478;-;1;atc-gca cds;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/alpha#aua_remarques;*
;;;;;;;*
gamma typage, cds et intercalaires;;;;;;;*
spl;-;-;338-374;8;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#spl_blocs;*
“;71;329-364;-;3;atc-gca;;*
vpb;80;257;-;1;gaa, gta;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#vpb_blocs;*
“;80;253-312;-;3;gaa, gta cds;;*
“;80;258;-;1;gaa;;*
“;88;258;-;1;gcc-gaa;;*
“;56;257;-;2;atc-gca;;*
“;-;-;261;3;16s-23s;;*
eal;85;198;-;4;gaa;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#eal_blocs;*
“;68-70;186;-;3;atc-gca;;*
eco;68;174-183;-;3;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#eco_blocs;*
“;85;193;-;2;gaa;;*
“;171;184-193;-;2;gaa;;*
vha;97;265-290;-;4;atc-gca cds;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#vha_blocs;*
“;56;290;-;1;atc-gca;;*
“;82;310;-;1;gaa, gta;;*
“;114-122;253-310;-;3;gaa, gta cds;;*
“;129;257;-;1;gcc-gaa cds;;*
amed;66;231;-;3;atc-gca;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/gamma#amed_blocs;*
“;192-268;229-245;-;6;gaa;;*
;;;;;;;*
bacilli typage, cds et intercalaires;;;;;;;*
bsu;-;-;164-167;13;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#bsu_blocs;*
“;99;81;-;2;atc-gca;;*
lmo;-;-;244;6;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#lmo_blocs;*
“;127;172;-;2;atc-gca;;*
lam;-;-;192;2;16s-23s cds;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#lam_blocs;*
“;125;115;-;2;atc-gca;;*
ppm;-;-;207-221;6;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#ppm_cumuls;*
“;-;-;280-400;4;16s-23s;;*
“;93-108;128;-;2;5s-atc-gca;;*
“;89;185;-;1;gca;;*
pmq;-;-;248-269;14;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#pmq_blocs;*
lbu;-;-;208;4;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#lbu_blocs;*
“;105;126;-;5;atc-gca;;*
ban;-;-;141;7;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/bacilli#ban_blocs;*
“;-;-;153-173;2;16s-23s;;*
“;130;77;-;2;atc-gca;;*
;;;;;;;
clostridia typage, cds et intercalaires;;;;;;;*
psor;-;-;196;9;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#psor_blocs;*
“;-;-;137;1;16s-23s;;*
“;54;114;-;4;gca;;*
“;109-123;95-152;-;3;gca;;*
cdc;-;-;279-320;5;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cdc_blocs;*
“;-;-;184-217;2;16s-23s;;*
“;52-68;249-373;-;3;gca;;*
cdc8;-;-;261-321;5;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cdc8_blocs;*
“;-;-;184-217;2;16s-23s;;*
cbc;-;-;228;4;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cbc_blocs;*
cbn;-;-;233;8;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cbn_blocs;*
“;74-121;96;-;2;gca-atc;;*
cle;196*;262-282;-;4;5s-gca*;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cle_blocs;*
“;262*;258;-;1;5s-atc*;;*
“;196*;261;-;2;5s-atc-gca*;;*
hmo;508*;233;-;3;5s-gcc*;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#hmo_blocs;*
“;433*;233;-;2;5s-gcc*;;*
“;432*;141-194;-;2;5s-atc*;;*
“;433*;229;-;1;5s-atc-gca*;;*
“;508*;236;-;1;5s-atc-gca*;;*
“;-;-;569;1;5s-16s-23s;;*
cbei;-;-;339;7;16s-23s;Recherche:Les_clusters_de_gènes_tRNA_et_rRNA_chez_les_procaryotes/Annexe/clostridia#cbei_blocs;*
“;-;-;502-578;3;16s-23s;;*
“;-;-;214;3;16s-23s;;*
“;140;111;-;1;gca-atc;;*
“;132;84;-;1;atc;;*
“;137;118;-;1;gca;;*

Tableau des noms alpha[modifier | modifier le wikicode]

;;;;;348;alphaprote-;17165
;;;;;;;
ruptures;notes;rRNAs;fait;code;tRNAs;génomes;
1;;555;1;alf001;60;Acetobacter pasteurianus 386B ;
;;;;alf002;60;Acetobacter pasteurianus IFO 3283-01 IFO 3283 substr. IFO 3283-01 ;
;;;;alf003;57;Acetobacter pasteurianus IFO 3283-01-42C IFO 3283 substr. IFO 3283-01-42C ;
;;;;alf004;60;Acetobacter pasteurianus IFO 3283-03 IFO 3283 substr. IFO 3283-03 ;
;;;;alf005;60;Acetobacter pasteurianus IFO 3283-07 IFO 3283 substr. IFO 3283-07 ;
;;;;alf006;60;Acetobacter pasteurianus IFO 3283-12 IFO 3283 substr. IFO 3283-12 ;
;;;;alf007;60;Acetobacter pasteurianus IFO 3283-22 IFO 3283 substr. IFO 3283-22 ;
;;;;alf008;60;Acetobacter pasteurianus IFO 3283-26 IFO 3283 substr. IFO 3283-26 ;
;;;;alf009;60;Acetobacter pasteurianus IFO 3283-32 IFO 3283 substr. IFO 3283-32 ;
1;;222;1;alf010;48;Acidiphilium cryptum JF-5 ;
1;;222;1;alf011;48;Acidiphilium multivorum AIU301 ;
1;;444;1;alf012;55;Agrobacterium fabrum str. C58 ;
1;;333;1;alf013;56;Agrobacterium radiobacter K84 ;
1;agr;555;1;alf014;58;Agrobacterium sp. H13-3 ;
1;;555;1;alf015;57;Agrobacterium tumefaciens Ach5 ;
;;;;alf016;57;Agrobacterium tumefaciens LBA4213 Ach5 ;
1;;444;1;alf017;56;Agrobacterium vitis S4 ;
1;;-;;alf018;32;alpha proteobacterium HIMB5 ;
1;;-;;alf019;35;alpha proteobacterium HIMB59 ;
1;;111;1;alf020;37;Anaplasma centrale str. Israel ;
1;;111;1;alf021;35;Anaplasma marginale str. Dawn ;
;;;;alf022;37;Anaplasma marginale str. Florida ;
;;;;alf023;37;Anaplasma marginale str. Gypsy Plains ;
;;;;alf024;37;Anaplasma marginale str. St. Maries ;
1;;111;1;alf025;37;Anaplasma phagocytophilum str. Dog2 ;
;;;;alf026;37;Anaplasma phagocytophilum str. HZ ;
;;;;alf027;37;Anaplasma phagocytophilum str. HZ2 ;
;;;;alf028;37;Anaplasma phagocytophilum str. JM ;
1;;333;1;alf029;51;Asticcacaulis excentricus CB 48 ;
1;;333;1;alf030;54;Azorhizobium caulinodans ORS 571 ;
1;abq;899;1;alf031;88;Azospirillum brasilense Az39 ;
;abs;;;alf032;85;Azospirillum brasilense Sp245 ;
1;;899;1;alf033;83;Azospirillum lipoferum 4B ;
1;;899;1;alf034;84;Azospirillum sp. B510 ;
1;;222;1;alf035;43;Bartonella australis Aust/NH1 ;
1;;222;1;alf036;45;Bartonella bacilliformis KC583 ATCC 35685 ;
1;;222;1;alf037;42;Bartonella clarridgeiae 73 ;
1;;222;1;alf038;43;Bartonella grahamii as4aup ;
1;;222;1;alf039;43;Bartonella henselae BM1374163 ;
;;;;alf040;45;Bartonella henselae BM1374165 ;
;;;;alf041;44;Bartonella henselae str. Houston-1 ;
1;;;;alf042;43;Bartonella quintana RM-11 ;
;;222;1;alf043;43;Bartonella quintana str. Toulouse ;
1;;222;1;alf044;43;Bartonella tribocorum BM1374166 ;
;;;;alf045;43;Bartonella tribocorum CIP 105476 ;
1;;222;1;alf046;43;Bartonella vinsonii subsp. berkhoffii str. Winnie ;
1;;333;1;alf047;54;Beijerinckia indica subsp. indica ATCC 9039 ;
1;;111;1;alf048;60;Bradyrhizobium diazoefficiens USDA 110 USDA110 ;
1;;222;1;alf049;64;Bradyrhizobium japonicum E109 ;
;;;;alf050;59;Bradyrhizobium japonicum SEMIA 5079 ;
;;;;alf051;66;Bradyrhizobium japonicum USDA 6 ;
1;;222;1;alf052;57;Bradyrhizobium oligotrophicum S58 ;
1;;222;1;alf053;56;Bradyrhizobium sp. BTAi1 ;
1;;222;1;alf054;52;Bradyrhizobium sp. ORS 278 ORS278 ;
1;;111;1;alf055;50;Bradyrhizobium sp. S23321 ;
1;;222;1;alf056;49;Brevundimonas subvibrioides ATCC 15264 ;
1;;333;1;alf057;55;Brucella abortus 2308 ;
;;;;alf058;55;Brucella abortus 3196 ;
;;;;alf059;55;Brucella abortus 63 75 ;
;;;;alf060;55;Brucella abortus A13334 ;
;;;;alf061;55;Brucella abortus BDW ;
;;;;alf062;54;Brucella abortus BER ;
;;;;alf063;54;Brucella abortus BFY ;
;;;;alf064;55;Brucella abortus bv. 1 str. 9-941 ;
;;;;alf065;55;Brucella abortus bv. 2 str. 86/8/59 ;
;;;;alf066;55;Brucella abortus bv. 6 str. 870 ;
;;;;alf067;55;Brucella abortus bv. 9 str. C68 ;
;;;;alf068;55;Brucella abortus NCTC 10505 ;
;;;;alf069;55;Brucella abortus S19 ;
;;;;alf070;47;Brucella abortus ZW053 ;
1;;333;1;alf071;55;Brucella canis ATCC 23365 ;
;;;;alf072;55;Brucella canis HSK A52141 ;
;;;;alf073;55;Brucella canis RM6/66 ;
;;;;alf074;49;Brucella canis str. Oliveri ;
;;;;alf075;55;Brucella canis SVA13 ;
1;;;;alf076;54;Brucella ceti TE10759-12 ;
;;;;alf077;54;Brucella ceti TE28753-12 ;
1;;;;alf078;55;Brucella melitensis ATCC 23457 ;
;;;;alf079;108;Brucella melitensis bv. 1 str. 16M ;
;;;;alf080;55;Brucella melitensis bv. 2 str. 63/9 ;
;;;;alf081;55;Brucella melitensis bv. 3 str. Ether ether ;
;;;;alf082;55;Brucella melitensis M28 ;
;;;;alf083;55;Brucella melitensis M5-90 ;
;;;;alf084;54;Brucella melitensis NI ;
1;;;;alf085;55;Brucella microti CCM 4915 ;
1;;;;alf086;53;Brucella ovis ATCC 25840 ;
1;;;;alf087;55;Brucella pinnipedialis 6/566 ;
;;;;alf088;55;Brucella pinnipedialis B2/94 ;
1;;;;alf089;110;Brucella suis 1330 ;
;;;;alf090;55;Brucella suis 513UK ;
;;;;alf091;54;Brucella suis ATCC 23445 ;
;;;;alf092;55;Brucella suis BSP ;
;;;;alf093;55;Brucella suis bv. 1 str. S2 ;
;;;;alf094;54;Brucella suis bv. 2 Bs143CITA ;
;;;;alf095;54;Brucella suis bv. 2 Bs364CITA ;
;;;;alf096;54;Brucella suis bv. 2 Bs396CITA ;
;;;;alf097;54;Brucella suis bv. 2 PT09143 ;
;;;;alf098;54;Brucella suis bv. 2 PT09172 ;
;;;;alf099;55;Brucella suis bv. 3 str. 686 ;
;;;;alf100;55;Brucella suis Human/AR/US/1981 ;
;;;;alf101;55;Brucella suis VBI22 ;
;;;;alf102;58;Brucella suis ZW043 ;
;;;;alf103;55;Brucella suis ZW046 ;
1;;-;;alf104;44;Candidatus Caedibacter acanthamoebae ;
1;;111;1;alf105;42;Candidatus Endolissoclinum faulkneri L2 ;
;;;;alf106;42;Candidatus Endolissoclinum faulkneri L5 ;
1;;-;;alf107;19;Candidatus Hodgkinia cicadicola ;
;;-;;alf108;14;Candidatus Hodgkinia cicadicola Dsem ;
;;-;;alf109;13;Candidatus Hodgkinia cicadicola TETUND1 ;
;;-;;alf110;17;Candidatus Hodgkinia cicadicola TETUND2 ;
1;;333;1;alf111;46;Candidatus Liberibacter americanus str. Sao Paulo ;
;;;;alf112;45;Candidatus Liberibacter asiaticus str. gxpsy ;
;;;;alf113;45;Candidatus Liberibacter asiaticus str. Ishi-1 ;
;;;;alf114;45;Candidatus Liberibacter asiaticus str. psy62 ;
;;;;alf115;46;Candidatus Liberibacter solanacearum CLso-ZC1 ;
1;;;;alf116;35;Candidatus Midichloria mitochondrii IricVA ;
1;;222;1;alf117;43;Candidatus Paracaedibacter acanthamoebae ;
1;;;;alf118;32;Candidatus Pelagibacter sp. IMCC9063 ;
;;;;alf119;32;Candidatus Pelagibacter ubique HTCC1062 ;
1;;;;alf120;44;Candidatus Phaeomarinobacter ectocarpi Ec32 ;
1;;;;alf121;38;Candidatus Puniceispirillum marinum IMCC1322 ;
1;;;;alf122;33;Candidatus Rickettsia amblyommii str. GAT-30V ;
1;;222;1;alf123;52;Caulobacter crescentus CB15 ;
;;;;alf124;52;Caulobacter crescentus NA1000 ;
1;;;;alf125;53;Caulobacter segnis ATCC 21756 ;
1;;;;alf126;51;Caulobacter sp. K31 ;
1;;;;alf127;50;Celeribacter indicus P73 ;
1;;;;alf128;54;Chelativorans sp. BNC1 ;
1;;;;alf129;47;Dinoroseobacter shibae DFL 12 DSM 16493 ;
1;;111;1;alf130;36;Ehrlichia canis str. Jake ;
1;;111;1;alf131;37;Ehrlichia chaffeensis str. Arkansas ;
;;;;alf132;37;Ehrlichia chaffeensis str. Heartland ;
;;;;alf133;37;Ehrlichia chaffeensis str. Jax ;
;;;;alf134;37;Ehrlichia chaffeensis str. Liberty ;
;;;;alf135;37;Ehrlichia chaffeensis str. Osceola ;
;;;;alf136;37;Ehrlichia chaffeensis str. Saint Vincent ;
;;;;alf137;37;Ehrlichia chaffeensis str. Wakulla ;
;;;;alf138;37;Ehrlichia chaffeensis str. West Paces ;
1;;;;alf139;37;Ehrlichia muris AS145 ;
1;;;;alf140;36;Ehrlichia ruminantium str. Gardel ;
;;;;alf141;72;Ehrlichia ruminantium str. Welgevonden ;
1;;;;alf142;36;Ehrlichia sp. HF ;
1;;;;alf143;38;endosymbiont of Acanthamoeba sp. UWC8 ;
1;;;;alf144;63;Ensifer adhaerens OV14 ;
1;;;;alf145;43;Erythrobacter litoralis HTCC2594 ;
1;;444;1;alf146;60;Gluconacetobacter diazotrophicus PA1 5 ;
;;;;alf147;58;Gluconacetobacter diazotrophicus PA1 5 PAl 5 ;
1;;;;alf148;57;Gluconobacter oxydans 621H ;
;;;;alf149;57;Gluconobacter oxydans DSM 3504 ;
;;;;alf150;60;Gluconobacter oxydans H24 ;
1;;;;alf151;52;Granulibacter bethesdensis CGDNIH1 ;
;;;;alf152;53;Granulibacter bethesdensis CGDNIH2 ;
;;;;alf153;52;Granulibacter bethesdensis CGDNIH3 ;
;;;;alf154;52;Granulibacter bethesdensis CGDNIH4 ;
1;;;;alf155;39;Hirschia baltica ATCC 49814 ;
1;;;;alf156;48;Hyphomicrobium denitrificans 1NES1 ;
;;;;alf157;47;Hyphomicrobium denitrificans ATCC 51888 ;
1;;;;alf158;49;Hyphomicrobium nitrativorans NL23 ;
1;;111;1;alf159;53;Hyphomicrobium sp. MC1 ;
1;;;;alf160;43;Hyphomonas neptunium ATCC 15444 ;
1;;;;alf161;43;Jannaschia sp. CCS1 ;
1;;555;1;alf162;58;Ketogulonicigenium vulgare WSH-001 ;
;;;;alf163;60;Ketogulonicigenium vulgare Y25 ;
1;;;;alf164;59;Komagataeibacter medellinensis NBRC 3288 ;
1;;;;alf165;60;Komagataeibacter xylinus E25 ;
1;;555;1;alf166;66;Leisingera methylohalidivorans DSM 14336 MB2 ;
1;;;;alf167;47;Liberibacter crescens BT-1 ;
1;;;;alf168;45;Magnetococcus marinus MC-1 ;
1;;;;alf169;48;Magnetospira sp. QH-2 ;
1;;;;alf170;54;Magnetospirillum gryphiswaldense MSR-1 v2 ;
1;;;;alf171;53;Magnetospirillum magneticum AMB-1 ;
1;;;;alf172;45;Maricaulis maris MCS10 ;
1;;;;alf173;57;Martelella endophytica YC6887 ;
1;;222;1;alf174;55;Mesorhizobium australicum WSM2073 ;
1;;;;alf175;54;Mesorhizobium ciceri biovar biserrulae WSM1271 ;
1;;;;alf176;55;Mesorhizobium huakuii 7653R ;
1;;;;alf177;55;Mesorhizobium loti MAFF303099 ;
1;;;;alf178;55;Mesorhizobium opportunistum WSM2075 ;
1;;;;alf179;68;Methylobacterium extorquens AM1 ;
;;;;alf180;67;Methylobacterium extorquens CM4 ;
;;;;alf181;62;Methylobacterium extorquens DM4 ;
;;;;alf182;63;Methylobacterium extorquens PA1 ;
1;;;;alf183;83;Methylobacterium nodulans ORS 2060 ;
1;;;;alf184;62;Methylobacterium oryzae CBMB20 ;
1;;;;alf185;61;Methylobacterium populi BJ001 ;
1;;;;alf186;63;Methylobacterium radiotolerans JCM 2831 ;
1;;666;1;alf187;72;Methylobacterium sp. 4-46 ;
1;;;;alf188;50;Methyloceanibacter caenitepidi Gela4 ;
1;;;;alf189;51;Methylocella silvestris BL2 ;
1;;;;alf190;48;Methylocystis sp. SC2 ;
1;;;;alf191;44;Micavibrio aeruginosavorus ARL-13 ;
;;;;alf192;40;Micavibrio aeruginosavorus EPB ;
1;;;;alf193;52;Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 ;
;;;;alf194;52;Neorhizobium galegae bv. orientalis str. HAMBI 540 ;
1;;;;alf195;33;Neorickettsia helminthoeca str. Oregon ;
1;;;;alf196;33;Neorickettsia risticii str. Illinois ;
1;;;;alf197;33;Neorickettsia sennetsu str. Miyayama ;
1;;111;1;alf198;58;Nitrobacter hamburgensis X14 ;
1;;;;alf199;50;Nitrobacter winogradskyi Nb-255 ;
1;;;;alf200;59;Novosphingobium aromaticivorans DSM 12444 ;
1;;;;alf201;57;Novosphingobium pentaromativorans US6-1 ;
1;;333;1;alf202;59;Novosphingobium sp. PP1Y ;
1;oan;444;1;alf203;61;Ochrobactrum anthropi ATCC 49188 ;
;;;;alf204;59;Ochrobactrum anthropi OAB ;
1;;;;alf205;51;Octadecabacter antarcticus 307 ;
1;;;;alf206;49;Octadecabacter arcticus 238 ;
1;;;;alf207;54;Oligotropha carboxidovorans OM4 ;
;;;;alf208;54;Oligotropha carboxidovorans OM5 ;
;;;;alf209;54;Oligotropha carboxidovorans OM5 ATCC 49405 ;
1;;;;alf210;34;Orientia tsutsugamushi str. Boryong ;
;;;;alf211;34;Orientia tsutsugamushi str. Ikeda ;
1;;444;1;alf212;62;Paracoccus aminophilus JCM 7686 ;
1;;;;alf213;55;Paracoccus denitrificans PD1222 ;
1;;;;alf214;46;Parvibaculum lavamentivorans DS-1 ;
1;;;;alf215;44;Parvularcula bermudensis HTCC2503 ;
1;;;;alf216;50;Pelagibacterium halotolerans B2 ;
1;;;;alf217;58;Phaeobacter gallaeciensis 2.10 ;
;;444;1;alf218;61;Phaeobacter gallaeciensis DSM 26640 ;
1;;;;alf219;59;Phaeobacter inhibens DSM 17395 ;
1;;;;alf220;43;Phenylobacterium zucineum HLK1 ;
1;;;;alf221;45;Planktomarina temperata RCA23 ;
1;;;;alf222;53;Polymorphum gilvum SL003B-26A1 ;
1;;666;1;alf223;70;Pseudovibrio sp. FO-BEG1 ;
1;;333;1;alf224;54;Rhizobium etli bv. mimosae str. IE4771 ;
;;;;alf225;51;Rhizobium etli bv. mimosae str. Mim1 ;
;;;;alf226;55;Rhizobium etli bv. phaseoli str. IE4803 ;
;;;;alf227;50;Rhizobium etli CFN 42 ;
;;;;alf228;54;Rhizobium etli CIAT 652 ;
1;;;;alf229;52;Rhizobium gallicum bv. gallicum R602 ;
1;;;;alf230;51;Rhizobium leguminosarum bv. trifolii CB782 ;
;;;;alf231;54;Rhizobium leguminosarum bv. trifolii WSM1325 ;
;;;;alf232;51;Rhizobium leguminosarum bv. trifolii WSM1689 ;
;;;;alf233;52;Rhizobium leguminosarum bv. trifolii WSM2304 ;
;;;;alf234;52;Rhizobium leguminosarum bv. viciae 3841 ;
1;;;;alf235;57;Rhizobium sp. IRBG74 ;
1;;;;alf236;55;Rhizobium sp. LPU83 ;
1;;;;alf237;51;Rhizobium sp. NT-26 ;
1;;;;alf238;54;Rhizobium tropici CIAT 899 ;
1;;;;alf239;54;Rhodobacter capsulatus SB 1003 ;
1;2*56;;;alf240;112;Rhodobacter sphaeroides 2.4.1 ;
;;;;alf241;57;Rhodobacter sphaeroides ATCC 17025 ;
;;;;alf242;58;Rhodobacter sphaeroides ATCC 17029 ;
;;;;alf243;58;Rhodobacter sphaeroides KD131 KCTC 12085 ;
;;;;alf244;55;Rhodobacter sphaeroides WS8N ;
1;;;;alf245;52;Rhodomicrobium vannielii ATCC 17100 ;
1;;;;alf246;50;Rhodopseudomonas palustris BisA53 ;
;;;;alf247;52;Rhodopseudomonas palustris BisB18 ;
;;;;alf248;51;Rhodopseudomonas palustris BisB5 ;
;;;;alf249;51;Rhodopseudomonas palustris DX-1 ;
;;;;alf250;51;Rhodopseudomonas palustris HaA2 ;
;;;;alf251;55;Rhodopseudomonas palustris TIE-1 ;
1;;;;alf252;53;Rhodospirillum centenum SW ATCC 51521 ;
1;rpm;;;alf253;95;Rhodospirillum photometricum DSM 122 ;
1;rru;;;alf254;55;Rhodospirillum rubrum ATCC 11170 ;
;;;;alf255;55;Rhodospirillum rubrum F11 ;
1;;;;alf256;33;Rickettsia africae ESF-5 ;
1;;;;alf257;33;Rickettsia akari str. Hartford ;
1;;;;alf258;33;Rickettsia australis str. Cutlack ;
1;;;;alf259;35;Rickettsia bellii OSU 85-389 ;
;;;;alf260;35;Rickettsia bellii RML369-C ;
1;;;;alf261;33;Rickettsia canadensis str. CA410 ;
;;;;alf262;33;Rickettsia canadensis str. McKiel ;
1;;;;alf263;33;Rickettsia conorii str. Malish 7 ;
1;;;;alf264;33;Rickettsia felis URRWXCal2 California 2 ;
1;;;;alf265;33;Rickettsia heilongjiangensis 054 ;
1;;;;alf266;33;Rickettsia helvetica C9P9 ;
1;;;;alf267;33;Rickettsia japonica YH ;
1;;;;alf268;33;Rickettsia massiliae MTU5 ;
;;;;alf269;33;Rickettsia massiliae str. AZT80 ;
1;;;;alf270;32;Rickettsia monacensis IrR/Munich ;
;;;;alf271;34;Rickettsia montanensis str. OSU 85-930 ;
1;;;;alf272;34;Rickettsia parkeri str. Portsmouth ;
1;;;;alf273;34;Rickettsia peacockii str. Rustic ;
1;;;;alf274;33;Rickettsia philipii str. 364D ;
1;rpl;;;alf275;33;Rickettsia prowazekii str. Breinl ;
1;;;;alf276;33;Rickettsia prowazekii str. BuV67-CWPP ;
;;;;alf277;33;Rickettsia prowazekii str. Chernikova ;
;;;;alf278;33;Rickettsia prowazekii str. Dachau ;
;;;;alf279;33;Rickettsia prowazekii str. GvV257 ;
;;;;alf280;33;Rickettsia prowazekii str. Katsinyian ;
;;;;alf281;33;Rickettsia prowazekii str. NMRC Madrid E ;
;;;;alf282;33;Rickettsia prowazekii str. Rp22 ;
;;;;alf283;33;Rickettsia prowazekii str. RpGvF24 ;
1;;;;alf284;33;Rickettsia rhipicephali str. 3-7-female6-CWPP ;
1;;;;alf285;34;Rickettsia rickettsii str. Arizona ;
;;;;alf286;34;Rickettsia rickettsii str. Brazil ;
;;;;alf287;34;Rickettsia rickettsii str. Colombia ;
;;;;alf288;34;Rickettsia rickettsii str. Hauke ;
;;;;alf289;34;Rickettsia rickettsii str. Hino ;
;;;;alf290;34;Rickettsia rickettsii str. Hlp#2 ;
;;;;alf291;34;Rickettsia rickettsii str. Iowa ;
;;;;alf292;35;Rickettsia rickettsii str. Morgan ;
;;;;alf293;34;Rickettsia rickettsii str. R ;
;;;;alf294;34;Rickettsia rickettsii str. Sheila Smith ;
1;;;;alf295;33;Rickettsia sibirica 246 ;
1;;;;alf296;33;Rickettsia slovaca 13-B ;
;;;;alf297;33;Rickettsia slovaca str. D-CWPP ;
1;rtb;111;1;alf298;33;Rickettsia typhi str. B9991CWPP ;
;;;;alf299;33;Rickettsia typhi str. TH1527 ;
;;;;alf300;33;Rickettsia typhi str. Wilmington ;
1;;111;1;alf301;39;Rickettsiales bacterium Ac37b ;
1;;;;alf302;48;Roseibacterium elongatum DSM 19469 DFL-43 ;
1;;111;1;alf303;38;Roseobacter denitrificans OCh 114 ;
1;;111;1;alf304;38;Roseobacter litoralis Och 149 ;
1;;333;1;alf305;54;Ruegeria pomeroyi DSS-3 ;
1;;555;1;alf306;64;Ruegeria sp. TM1040 ;
1;;333;1;alf307;56;Sinorhizobium fredii NGR234 ;
1;;333;1;alf308;56;Sinorhizobium medicae WSM419 ;
1;;333;1;alf309;56;Sinorhizobium meliloti 1021 ;
;;;;alf310;56;Sinorhizobium meliloti 2011 ;
;;;;alf311;59;Sinorhizobium meliloti AK83 ;
;;;;alf312;56;Sinorhizobium meliloti BL225C ;
;;;;alf313;57;Sinorhizobium meliloti GR4 ;
;;;;alf314;58;Sinorhizobium meliloti Rm41 ;
;;;;alf315;56;Sinorhizobium meliloti RMO17 ;
;;;;alf316;61;Sinorhizobium meliloti SM11 ;
1;;333;1;alf317;62;Sphingobium chlorophenolicum L-1 ;
1;;;;alf318;58;Sphingobium japonicum UT26S ;
1;;;;alf319;53;Sphingobium sp. SYK-6 ;
1;;;;alf320;57;Sphingobium sp. YBL2 ;
1;;333;1;alf321;63;Sphingomonas sanxanigenens DSM 19645 NX02 ;
1;;;;alf322;55;Sphingomonas sp. MM-1 ;
1;;;;alf323;53;Sphingomonas sp. WHSC-8 ;
1;;;;alf324;53;Sphingomonas taxi ATCC 55669 ;
1;;;;alf325;53;Sphingomonas wittichii RW1 ;
1;;111;1;alf326;47;Sphingopyxis alaskensis RB2256 ;
1;;;;alf327;50;Sphingopyxis sp. Kp5.2 ;
1;;;;alf328;47;Starkeya novella DSM 506 ;
1;;444;1;alf329;61;Thalassospira xiamenensis M-5 DSM 17429 ;
1;;444;1;alf330;58;Tistrella mobilis KA081020-065 ;
1;;111;1;alf331;34;Wolbachia endosymbiont of Cimex lectularius wCle ;
;;;;alf332;34;Wolbachia endosymbiont of Culex quinquefasciatus Pel wPip ;
;;;;alf333;34;Wolbachia endosymbiont of Drosophila melanogaster wMel ;
;;;;alf334;34;Wolbachia endosymbiont of Drosophila simulans wAu ;
;;;;alf335;35;Wolbachia endosymbiont of Drosophila simulans wHa ;
;;;;alf336;34;Wolbachia endosymbiont of Drosophila simulans wNo ;
;;;;alf337;34;Wolbachia endosymbiont of Onchocerca ochengi wOo ;
;;;;alf338;34;Wolbachia endosymbiont of Onchocerca volvulus str. Cameroon ;
;;;;alf339;34;Wolbachia endosymbiont strain TRS of Brugia malayi ;
1;;;;alf340;35;Wolbachia sp. wRi ;
1;;222;1;alf341;55;Xanthobacter autotrophicus Py2 ;
1;;;;alf342;49;Zymomonas mobilis subsp. mobilis ATCC 10988 ;
;;333;1;alf343;52;Zymomonas mobilis subsp. mobilis ATCC 29191 ;
;;;;alf344;52;Zymomonas mobilis subsp. mobilis NCIMB 11163 ;
;;;;alf345;52;Zymomonas mobilis subsp. mobilis NRRL B-12526 ;
;49+52;;;alf346;101;Zymomonas mobilis subsp. mobilis str. CP4 NRRL B-14023 ;
;;;;alf347;52;Zymomonas mobilis subsp. mobilis ZM4 ATCC 31821 ;
;;;;alf348;52;Zymomonas mobilis subsp. pomaceae ATCC 29192 ;
189;;;70;;;;